BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.509_1 (45 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.509_1 Length = 45 Score = 85.9 bits (211), Expect = 1e-19, Method: Compositional matrix adjust. Identities = 45/45 (100%), Positives = 45/45 (100%) Query: 1 LTNAIGISLKKALIDFSLISAHKKIMAITAKELSKRISISRCINA 45 LTNAIGISLKKALIDFSLISAHKKIMAITAKELSKRISISRCINA Sbjct: 1 LTNAIGISLKKALIDFSLISAHKKIMAITAKELSKRISISRCINA 45 >gi|254781043|ref|YP_003065456.1| succinate dehydrogenase flavoprotein subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 611 Score = 21.2 bits (43), Expect = 3.3, Method: Composition-based stats. Identities = 8/17 (47%), Positives = 13/17 (76%) Query: 27 AITAKELSKRISISRCI 43 A +AK+L+ R +SRC+ Sbjct: 288 APSAKDLASRDVVSRCM 304 >gi|254780704|ref|YP_003065117.1| ABC transporter, nucleotide binding/ATPase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 254 Score = 20.0 bits (40), Expect = 8.3, Method: Composition-based stats. Identities = 9/35 (25%), Positives = 16/35 (45%) Query: 10 KKALIDFSLISAHKKIMAITAKELSKRISISRCIN 44 K+AL D +L + A+ + + RC+N Sbjct: 19 KRALFDINLKIPQNSVTALIGPSGCGKSTFLRCLN 53 >gi|254780248|ref|YP_003064661.1| 30S ribosomal protein S14 [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Score = 19.6 bits (39), Expect = 9.9, Method: Compositional matrix adjust. Identities = 7/27 (25%), Positives = 18/27 (66%) Query: 17 SLISAHKKIMAITAKELSKRISISRCI 43 S + +K+ + + AK+ SKR+++ + + Sbjct: 5 SAVERNKRRLRVVAKQASKRLALKKIV 31 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.323 0.132 0.338 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 22,207 Number of Sequences: 1233 Number of extensions: 467 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 45 length of database: 328,796 effective HSP length: 18 effective length of query: 27 effective length of database: 306,602 effective search space: 8278254 effective search space used: 8278254 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 31 (16.5 bits)