Query 537021.9.peg.54_1 Match_columns 64 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Mon May 23 04:35:33 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_54.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 KOG0303 consensus 30.7 13 0.00032 18.7 -0.2 31 12-42 175-211 (472) 2 KOG0278 consensus 20.3 61 0.0015 15.2 1.6 35 27-61 166-201 (334) 3 KOG4001 consensus 17.4 67 0.0017 14.9 1.3 17 14-30 140-156 (259) 4 KOG0279 consensus 17.1 68 0.0017 14.9 1.3 35 14-48 237-276 (315) 5 KOG0283 consensus 16.3 60 0.0015 15.2 0.8 15 20-34 426-440 (712) 6 COG4456 VagC Virulence-associa 15.6 1E+02 0.0026 14.1 1.9 30 32-62 8-39 (74) 7 pfam03146 NtA Agrin NtA domain 14.8 84 0.0021 14.4 1.3 13 21-33 32-44 (128) 8 cd03739 SOCS_SOCS5 SOCS (suppr 14.5 1.1E+02 0.0027 13.9 1.8 23 34-56 31-53 (57) 9 pfam11518 DUF3221 Protein of u 12.8 1.3E+02 0.0032 13.5 2.5 28 19-52 70-98 (99) 10 TIGR00759 aceE 2-oxo-acid dehy 11.8 33 0.00085 16.5 -1.5 33 25-57 540-577 (905) No 1 >KOG0303 consensus Probab=30.72 E-value=13 Score=18.71 Aligned_cols=31 Identities=32% Similarity=0.601 Sum_probs=21.6 Q ss_pred HHHHHHHHHCCEEEE------EEEEEECHHHHHHHHC Q ss_conf 442078640360488------8898612137788630 Q 537021.9.peg.5 12 LYMSLSFLKKGLLCC------KIRIWNQRSQTILKSY 42 (64) Q Consensus 12 lymslsflkkgllcc------kiriwnqrsqtilksy 42 (64) .-.|.||-..|-+-| |||||+.|..+++..- T Consensus 175 ~i~S~sfn~dGs~l~TtckDKkvRv~dpr~~~~v~e~ 211 (472) T KOG0303 175 MVYSMSFNRDGSLLCTTCKDKKVRVIDPRRGTVVSEG 211 (472) T ss_pred EEEEEEECCCCCEEEEECCCCEEEEECCCCCCEEEEC T ss_conf 5999896268765654025541587758887275552 No 2 >KOG0278 consensus Probab=20.33 E-value=61 Score=15.19 Aligned_cols=35 Identities=26% Similarity=0.673 Sum_probs=24.2 Q ss_pred EEEEEECHHHHHHHHCCCCE-EEEEEEEECCCEEEE Q ss_conf 88986121377886302001-468999832857999 Q 537021.9.peg.5 27 KIRIWNQRSQTILKSYRYKQ-VCKIQIIQEGSALLL 61 (64) Q Consensus 27 kiriwnqrsqtilksyrykq-vckiqiiqegsalll 61 (64) .+|.|..|+-|+.+|...+. |--..+.|+|.-+.. T Consensus 166 tVRLWD~rTgt~v~sL~~~s~VtSlEvs~dG~ilTi 201 (334) T KOG0278 166 TVRLWDHRTGTEVQSLEFNSPVTSLEVSQDGRILTI 201 (334) T ss_pred CEEEEEECCCCEEEEEECCCCCCEEEECCCCCEEEE T ss_conf 368787216837877764899861466258978999 No 3 >KOG4001 consensus Probab=17.39 E-value=67 Score=14.95 Aligned_cols=17 Identities=35% Similarity=0.638 Sum_probs=14.1 Q ss_pred HHHHHHHCCEEEEEEEE Q ss_conf 20786403604888898 Q 537021.9.peg.5 14 MSLSFLKKGLLCCKIRI 30 (64) Q Consensus 14 mslsflkkgllcckiri 30 (64) .|.|-...|++||.+|- T Consensus 140 vs~scveRGlll~rvRD 156 (259) T KOG4001 140 VSVSCVERGLLLVRVRD 156 (259) T ss_pred CCHHHHHCCEEEEEEHH T ss_conf 26417751503788618 No 4 >KOG0279 consensus Probab=17.07 E-value=68 Score=14.93 Aligned_cols=35 Identities=23% Similarity=0.547 Sum_probs=24.7 Q ss_pred HHHHHHHCCEEEE-----EEEEEECHHHHHHHHCCCCEEE Q ss_conf 2078640360488-----8898612137788630200146 Q 537021.9.peg.5 14 MSLSFLKKGLLCC-----KIRIWNQRSQTILKSYRYKQVC 48 (64) Q Consensus 14 mslsflkkgllcc-----kiriwnqrsqtilksyrykqvc 48 (64) -|+.|....+--| -|+||++.++.++.+++-+-+- T Consensus 237 ~sl~fspnrywL~~at~~sIkIwdl~~~~~v~~l~~d~~g 276 (315) T KOG0279 237 NSLCFSPNRYWLCAATATSIKIWDLESKAVVEELKLDGIG 276 (315) T ss_pred EEEEECCCCEEEEECCCCCEEEEECCCHHHHHHCCCCCCC T ss_conf 6688559820576515771599963651201200302224 No 5 >KOG0283 consensus Probab=16.28 E-value=60 Score=15.22 Aligned_cols=15 Identities=33% Similarity=0.625 Sum_probs=9.8 Q ss_pred HCCEEEEEEEEEECH Q ss_conf 036048888986121 Q 537021.9.peg.5 20 KKGLLCCKIRIWNQR 34 (64) Q Consensus 20 kkgllcckiriwnqr 34 (64) --|-|-||+|||+-- T Consensus 426 iSGSLD~KvRiWsI~ 440 (712) T KOG0283 426 ISGSLDGKVRLWSIS 440 (712) T ss_pred EECCCCCCEEEEECC T ss_conf 522555416886058 No 6 >COG4456 VagC Virulence-associated protein and related proteins [Function unknown] Probab=15.57 E-value=1e+02 Score=14.05 Aligned_cols=30 Identities=33% Similarity=0.672 Sum_probs=22.6 Q ss_pred ECHHH--HHHHHCCCCEEEEEEEEECCCEEEEE Q ss_conf 12137--78863020014689998328579999 Q 537021.9.peg.5 32 NQRSQ--TILKSYRYKQVCKIQIIQEGSALLLF 62 (64) Q Consensus 32 nqrsq--tilksyrykqvckiqiiqegsalllf 62 (64) +.||| .+-+..|+.. -+..|+.+|+.+.+- T Consensus 8 snrSQAVRLP~e~~f~~-~~VeI~r~G~~lII~ 39 (74) T COG4456 8 SNRSQAVRLPKEFRFPE-DRVEIIREGDRLIIE 39 (74) T ss_pred CCCEEEEECCHHEECCC-CEEEEEEECCEEEEE T ss_conf 49710276544210278-589999958958998 No 7 >pfam03146 NtA Agrin NtA domain. Agrin is a multidomain heparan sulphate proteoglycan, that is a key organiser for the induction of postsynaptic specialisations at the neuromuscular junction. Binding of agrin to basement membranes requires the amino terminal (NtA) domain. This region mediates high affinity interaction with the coiled-coil domain of laminins. The binding of agrin to laminins via the NtA domain is subject to tissue-specific regulation. The NtA domain-containing form of agrin is expressed in non-neuronal cells or in neurons that project to non-neuronal cell such as motor neurons. The structure of this domain is an OB-fold. Probab=14.79 E-value=84 Score=14.45 Aligned_cols=13 Identities=31% Similarity=0.956 Sum_probs=9.9 Q ss_pred CCEEEEEEEEEEC Q ss_conf 3604888898612 Q 537021.9.peg.5 21 KGLLCCKIRIWNQ 33 (64) Q Consensus 21 kgllcckiriwnq 33 (64) .+-.-||+|+|.- T Consensus 32 ~~tY~ckVrVWR~ 44 (128) T pfam03146 32 QHTYSCKVRVWRY 44 (128) T ss_pred CCEEEEEEEEEEE T ss_conf 6637677899998 No 8 >cd03739 SOCS_SOCS5 SOCS (suppressors of cytokine signaling) box of SOCS5-like proteins. Together with CIS1, the CIS/SOCS family of proteins is characterized by the presence of a C-terminal SOCS box and a central SH2 domain. SOCS5 inhibits Th2 differentiation by inhibiting IL-4 signaling. The general function of the SOCS box is the recruitment of the ubiquitin-transferase system. The SOCS box interacts with Elongins B and C, Cullin-5 or Cullin-2, Rbx-1, and E2. Therefore, SOCS-box-containing proteins probably function as E3 ubiquitin ligases and mediate the degradation of proteins associated through their N-terminal regions. Probab=14.54 E-value=1.1e+02 Score=13.91 Aligned_cols=23 Identities=30% Similarity=0.541 Sum_probs=17.1 Q ss_pred HHHHHHHHCCCCEEEEEEEEECC Q ss_conf 13778863020014689998328 Q 537021.9.peg.5 34 RSQTILKSYRYKQVCKIQIIQEG 56 (64) Q Consensus 34 rsqtilksyrykqvckiqiiqeg 56 (64) .-+.-||.|.|||-..+.-+..+ T Consensus 31 ~Lk~yLkEYHYKqrVRvR~~d~e 53 (57) T cd03739 31 MLQDFLKEYHYKQKVRVRWLERE 53 (57) T ss_pred HHHHHHHHHHHHCEEEEEECCCC T ss_conf 99999999765502455533556 No 9 >pfam11518 DUF3221 Protein of unknown function (DUF3221). This family of proteins with unknown function appears to be restricted to Bacillus. Some members in this family of proteins are annotated as YobA however this cannot be confirmed. YobA is a protein with unknown function. Probab=12.81 E-value=1.3e+02 Score=13.51 Aligned_cols=28 Identities=43% Similarity=0.735 Sum_probs=18.4 Q ss_pred HHCCEEEEEEEEEECHHHHHHHHCCCCE-EEEEEE Q ss_conf 4036048888986121377886302001-468999 Q 537021.9.peg.5 19 LKKGLLCCKIRIWNQRSQTILKSYRYKQ-VCKIQI 52 (64) Q Consensus 19 lkkgllcckiriwnqrsqtilksyrykq-vckiqi 52 (64) ||.| -||++| +..||.||.-|- |-|+.+ T Consensus 70 Lk~G---~KIKVW---~s~ilESyPak~~v~KfEi 98 (99) T pfam11518 70 LKVG---QKIKVW---YSQLLESYPAKMIVEKFEV 98 (99) T ss_pred HHCC---CEEEEE---HHHHHCCCCCCEEEEEEEE T ss_conf 3058---779983---1322133887407898886 No 10 >TIGR00759 aceE 2-oxo-acid dehydrogenase E1 component, homodimeric type; InterPro: IPR004660 Most members of this family are pyruvate dehydrogenase complex, E1 component. It includes a counterexample from Pseudomonas putida, MdeB, that is active as an E1 component of an alpha-ketoglutarate dehydrogenase complex rather than a pyruvate dehydrogenase complex. The second pyruvate dehydrogenase complex E1 protein from Alcaligenes eutrophus, PdhE, complements an aceE mutant of Escherichia coli but is not part of a pyruvate dehydrogenase complex operon, is more similar to the Pseudomonas putida MdeB than to E. coli AceE, and may have also have a different primary specificity. ; GO: 0016491 oxidoreductase activity. Probab=11.77 E-value=33 Score=16.54 Aligned_cols=33 Identities=30% Similarity=0.368 Sum_probs=22.9 Q ss_pred EEEEEEEECHHHHHHHH-----CCCCEEEEEEEEECCC Q ss_conf 88889861213778863-----0200146899983285 Q 537021.9.peg.5 25 CCKIRIWNQRSQTILKS-----YRYKQVCKIQIIQEGS 57 (64) Q Consensus 25 cckiriwnqrsqtilks-----yrykqvckiqiiqegs 57 (64) --.|.|||++-|+-.-+ --||.--+=||.|||- T Consensus 540 FrqiGIYsp~GQ~Y~P~D~~~l~~YkEs~~GQ~L~EGI 577 (905) T TIGR00759 540 FRQIGIYSPNGQKYTPEDADSLLAYKESKDGQILQEGI 577 (905) T ss_pred CCCCCEECCCCCEEECCCHHHHHHHHHHCCCCCHHHHH T ss_conf 37453057898745103433467764502685413105 Done!