BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.54_1 (64 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.54_1 Length = 64 Score = 124 bits (311), Expect = 3e-31, Method: Compositional matrix adjust. Identities = 64/64 (100%), Positives = 64/64 (100%) Query: 1 MIKQRILTKKSLYMSLSFLKKGLLCCKIRIWNQRSQTILKSYRYKQVCKIQIIQEGSALL 60 MIKQRILTKKSLYMSLSFLKKGLLCCKIRIWNQRSQTILKSYRYKQVCKIQIIQEGSALL Sbjct: 1 MIKQRILTKKSLYMSLSFLKKGLLCCKIRIWNQRSQTILKSYRYKQVCKIQIIQEGSALL 60 Query: 61 LFYI 64 LFYI Sbjct: 61 LFYI 64 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.331 0.141 0.416 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 35,842 Number of Sequences: 1233 Number of extensions: 983 Number of successful extensions: 2 Number of sequences better than 100.0: 2 Number of HSP's better than 100.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 64 length of database: 328,796 effective HSP length: 35 effective length of query: 29 effective length of database: 285,641 effective search space: 8283589 effective search space used: 8283589 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (22.0 bits) S2: 31 (16.5 bits)