Query         537021.9.peg.593_1
Match_columns 38
No_of_seqs    1 out of 3
Neff          1.0 
Searched_HMMs 33803
Date          Tue May 24 21:33:57 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i peg_593.hhm -d /home/congqian_1/database/mmdb/mmdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 >3k5p_A D-3-phosphoglycerate d  49.5      18 0.00053   17.8   3.3   30    7-36      6-35  (84)
  2 >2fgc_A Acetolactate synthase,  19.1      81  0.0024   14.8   3.7   26   11-36     28-53  (106)
  3 >1kqf_A FDH-N, formate dehydro  17.7      43  0.0013   16.0   0.8   14   20-33      6-19  (111)
  4 >2pc6_A Probable acetolactate   13.6 1.1E+02  0.0034   14.1   3.6   25   12-36      4-28  (80)
  5 >2i9s_A MESD, mesoderm develop  13.2   1E+02   0.003   14.3   1.7   11    2-12     18-28  (97)
  6 >2rqk_A Mesoderm development c  12.1   1E+02  0.0031   14.2   1.5   11    2-12     17-27  (96)
  7 >2bv1_A Regulator of G-protein   7.9 1.2E+02  0.0035   14.0   0.4   11   22-32     50-60  (68)
  8 >2gnx_A Hypothetical protein;    7.8 1.6E+02  0.0048   13.4   1.1   14   24-37    107-120 (193)
  9 >1x99_A Lectin, XCL lectin; fu   7.6   2E+02  0.0058   13.0   3.5   23    2-24     56-78  (145)
 10 >2ofc_A Sclerotium rolfsii lec   7.1 2.1E+02  0.0062   12.8   3.5   23    2-24     53-75  (142)

No 1  
>>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infectious disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} (A:333-416)
Probab=49.52  E-value=18  Score=17.81  Aligned_cols=30  Identities=30%  Similarity=0.414  Sum_probs=26.4

Q ss_pred             EECCCEEEEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             833880899999708858999999997630
Q 537021.9.peg.5    7 AVRGDPFFLIVMVQNTPRFLKSLLLLFSSH   36 (38)
Q Consensus         7 avrgdpfflivmvqntprflksllllfssh   36 (38)
                      ..++.++++.++++|.|-.+...--.|+.|
T Consensus         6 ~~~~~~~~l~i~~~d~pGvla~I~~~l~~~   35 (84)
T 3k5p_A            6 PPRPTGTRFMHVHENRPGILNSLMNVFSHH   35 (84)
T ss_dssp             CCCSSSEEEEEEECCCTTHHHHHHHHHHHT
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHHHHHC
T ss_conf             877888549985035125999999999876


No 2  
>>2fgc_A Acetolactate synthase, small subunit; regulatory subunit, structural genomics, PSI, protein structure initiative; 2.30A {Thermotoga maritima MSB8} (A:1-106)
Probab=19.06  E-value=81  Score=14.77  Aligned_cols=26  Identities=19%  Similarity=0.411  Sum_probs=22.4

Q ss_pred             CEEEEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             80899999708858999999997630
Q 537021.9.peg.5   11 DPFFLIVMVQNTPRFLKSLLLLFSSH   36 (38)
Q Consensus        11 dpfflivmvqntprflksllllfssh   36 (38)
                      .+|++.++++|.|..|....-+|+.+
T Consensus        28 ~~~~lri~v~d~pGvLa~It~vl~~~   53 (106)
T 2fgc_A           28 REHLVSXLVHNKPGVXRKVANLFARR   53 (106)
T ss_dssp             EEEEEEEEEECCTTHHHHHHHHHHTT
T ss_pred             HEEEEEEEEECCCCHHHHHHHHHHHC
T ss_conf             28999999978878999999998626


No 3  
>>1kqf_A FDH-N, formate dehydrogenase, nitrate-inducible, major subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} (A:494-524,A:679-758)
Probab=17.73  E-value=43  Score=16.03  Aligned_cols=14  Identities=43%  Similarity=0.750  Sum_probs=11.6

Q ss_pred             ECCHHHHHHHHHHH
Q ss_conf             08858999999997
Q 537021.9.peg.5   20 QNTPRFLKSLLLLF   33 (38)
Q Consensus        20 qntprflksllllf   33 (38)
                      ||+|.|.-|||--+
T Consensus         6 ~n~pkf~vSllKa~   19 (111)
T 1kqf_A            6 SNYPKFFVSLMKSF   19 (111)
T ss_dssp             GGHHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHH
T ss_conf             45520357777653


No 4  
>>2pc6_A Probable acetolactate synthase isozyme III (small subunit); regulatory subunit, structural genomics, PSI; HET: MSE; 2.50A {Nitrosomonas europaea atcc 19718} (A:1-80)
Probab=13.58  E-value=1.1e+02  Score=14.06  Aligned_cols=25  Identities=20%  Similarity=0.308  Sum_probs=21.4

Q ss_pred             EEEEEEEEECCHHHHHHHHHHHHHH
Q ss_conf             0899999708858999999997630
Q 537021.9.peg.5   12 PFFLIVMVQNTPRFLKSLLLLFSSH   36 (38)
Q Consensus        12 pfflivmvqntprflksllllfssh   36 (38)
                      -|++.+++.|.|..|-...-+|+.|
T Consensus         4 k~~i~i~~~d~pGvLa~It~ifa~~   28 (80)
T 2pc6_A            4 RHIISLLXENEAGALSRVAGLFSAR   28 (80)
T ss_dssp             EEEEEEEEECSTTHHHHHHHHHHHH
T ss_pred             EEEEEEEEECCCCHHHHHHHHHHHC
T ss_conf             4999999987757999999998625


No 5  
>>2i9s_A MESD, mesoderm development candidate 2; ferredoxin-like-fold, chaperone; NMR {Mus musculus} (A:)
Probab=13.20  E-value=1e+02  Score=14.28  Aligned_cols=11  Identities=55%  Similarity=1.180  Sum_probs=7.9

Q ss_pred             EEEEEEECCCE
Q ss_conf             49999833880
Q 537021.9.peg.5    2 LLFFVAVRGDP   12 (38)
Q Consensus         2 llffvavrgdp   12 (38)
                      +..||.|.|||
T Consensus        18 lM~Fv~v~g~p   28 (97)
T 2i9s_A           18 LMMFVTVSGNP   28 (97)
T ss_dssp             EEEEEECCSSS
T ss_pred             EEEEEEECCCC
T ss_conf             69999977989


No 6  
>>2rqk_A Mesoderm development candidate 2; chaperone; NMR {Mus musculus} PDB: 2rqm_A (A:46-141)
Probab=12.11  E-value=1e+02  Score=14.24  Aligned_cols=11  Identities=55%  Similarity=1.180  Sum_probs=7.6

Q ss_pred             EEEEEEECCCE
Q ss_conf             49999833880
Q 537021.9.peg.5    2 LLFFVAVRGDP   12 (38)
Q Consensus         2 llffvavrgdp   12 (38)
                      +..||.|.|||
T Consensus        17 lM~Fv~v~g~p   27 (96)
T 2rqk_A           17 LMMFVTVSGNP   27 (96)
T ss_dssp             CEEEEECCCSS
T ss_pred             EEEEEEECCCC
T ss_conf             59999847999


No 7  
>>2bv1_A Regulator of G-protein signalling 1; RGS1, RGS, structural genomics, structural genomics consortium, B-cell activation, phosphorylation; 2.0A {Homo sapiens} PDB: 2gtp_C* (A:1-48,A:126-145)
Probab=7.85  E-value=1.2e+02  Score=14.01  Aligned_cols=11  Identities=64%  Similarity=0.896  Sum_probs=7.1

Q ss_pred             CHHHHHHHHHH
Q ss_conf             85899999999
Q 537021.9.peg.5   22 TPRFLKSLLLL   32 (38)
Q Consensus        22 tprflksllll   32 (38)
                      -||||||-..|
T Consensus        50 ~~~~~~~~~~~   60 (68)
T 2bv1_A           50 YPRFLKSDIYL   60 (68)
T ss_dssp             HHHHHTSHHHH
T ss_pred             CHHHCCCHHHH
T ss_conf             22121599999


No 8  
>>2gnx_A Hypothetical protein; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG, unknown function; 2.45A {Mus musculus} (A:1-193)
Probab=7.83  E-value=1.6e+02  Score=13.36  Aligned_cols=14  Identities=43%  Similarity=0.740  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHHHHC
Q ss_conf             89999999976305
Q 537021.9.peg.5   24 RFLKSLLLLFSSHI   37 (38)
Q Consensus        24 rflksllllfsshi   37 (38)
                      +|+.|++.|..+|+
T Consensus       107 ~Fl~SLl~L~~Ah~  120 (193)
T 2gnx_A          107 KFLPSLVTLHNAHT  120 (193)
T ss_dssp             CHHHHHHHHHHHHH
T ss_pred             HCCHHHHHHHHHHH
T ss_conf             25167887754668


No 9  
>>1x99_A Lectin, XCL lectin; fungal lectin, sugar binding protein; HET: MSE; 1.40A {Xerocomus chrysenteron} (A:)
Probab=7.64  E-value=2e+02  Score=12.97  Aligned_cols=23  Identities=30%  Similarity=0.440  Sum_probs=19.5

Q ss_pred             EEEEEEECCCEEEEEEEEECCHH
Q ss_conf             49999833880899999708858
Q 537021.9.peg.5    2 LLFFVAVRGDPFFLIVMVQNTPR   24 (38)
Q Consensus         2 llffvavrgdpfflivmvqntpr   24 (38)
                      .|-|.+-.||-|+.++-|.|--|
T Consensus        56 ~LRf~~~~Ge~F~Va~GvHNYkr   78 (145)
T 1x99_A           56 XLRFXSTKGERITVAVGVHNYKR   78 (145)
T ss_dssp             EEEEEETTCCEEEEEEEEETTEE
T ss_pred             EEEEECCCCCEEEEEEEEECCCC
T ss_conf             69997489988999996304873


No 10 
>>2ofc_A Sclerotium rolfsii lectin; dual specificity, sugar binding protein; 1.11A {Athelia rolfsii} PDB: 2ofd_A* 2ofe_A* (A:)
Probab=7.08  E-value=2.1e+02  Score=12.83  Aligned_cols=23  Identities=35%  Similarity=0.352  Sum_probs=19.2

Q ss_pred             EEEEEEECCCEEEEEEEEECCHH
Q ss_conf             49999833880899999708858
Q 537021.9.peg.5    2 LLFFVAVRGDPFFLIVMVQNTPR   24 (38)
Q Consensus         2 llffvavrgdpfflivmvqntpr   24 (38)
                      .|-|.+-.||-|+.++-|.|--|
T Consensus        53 ~LRf~~~~Ge~F~V~~GvHNYkr   75 (142)
T 2ofc_A           53 TLRFHADNGESFTATFGVHNYKR   75 (142)
T ss_dssp             EEEEEETTSCEEEEEEEEETTEE
T ss_pred             EEEEECCCCCEEEEEEEEECCCC
T ss_conf             48886489967999998652874


Done!