RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= 537021.9.peg.60_1 (44 letters) >gnl|CDD|182941 PRK11067, PRK11067, outer membrane protein assembly factor YaeT; Provisional. Length = 803 Score = 27.7 bits (62), Expect = 0.65 Identities = 12/28 (42%), Positives = 17/28 (60%) Query: 17 IKKLLIVSLLSSTAIISGCDSHSGDGVH 44 +KKLLI SLL S+A + G + +H Sbjct: 3 MKKLLIASLLFSSATVYGAEGFVVKDIH 30 >gnl|CDD|184283 PRK13731, PRK13731, conjugal transfer surface exclusion protein TraT; Provisional. Length = 243 Score = 27.7 bits (61), Expect = 0.67 Identities = 12/25 (48%), Positives = 19/25 (76%) Query: 15 VNIKKLLIVSLLSSTAIISGCDSHS 39 + KKL++V+L+SST +SGC + S Sbjct: 1 MKTKKLMMVALVSSTLALSGCGAMS 25 >gnl|CDD|182518 PRK10525, PRK10525, cytochrome o ubiquinol oxidase subunit II; Provisional. Length = 315 Score = 27.1 bits (60), Expect = 1.1 Identities = 9/21 (42%), Positives = 14/21 (66%) Query: 17 IKKLLIVSLLSSTAIISGCDS 37 K L +SL + T ++SGC+S Sbjct: 7 NKSLGWLSLFAGTVLLSGCNS 27 >gnl|CDD|182939 PRK11063, metQ, DL-methionine transporter substrate-binding subunit; Provisional. Length = 271 Score = 25.5 bits (56), Expect = 2.9 Identities = 8/30 (26%), Positives = 9/30 (30%) Query: 15 VNIKKLLIVSLLSSTAIISGCDSHSGDGVH 44 K V L T + GC D H Sbjct: 3 FKFKTFAAVGALIGTLALVGCGQDEKDPNH 32 >gnl|CDD|164798 PHA00407, PHA00407, phage lambda Rz1-like protein. Length = 84 Score = 24.9 bits (54), Expect = 4.5 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 7/33 (21%) Query: 14 PVNIKK-------LLIVSLLSSTAIISGCDSHS 39 ++ KK LI LL A ISGC S S Sbjct: 21 RLSTKKTLRRWKAALIGLLLICVATISGCASES 53 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.320 0.137 0.378 Gapped Lambda K H 0.267 0.0760 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 655,805 Number of extensions: 22927 Number of successful extensions: 59 Number of sequences better than 10.0: 1 Number of HSP's gapped: 59 Number of HSP's successfully gapped: 10 Length of query: 44 Length of database: 5,994,473 Length adjustment: 17 Effective length of query: 27 Effective length of database: 5,627,137 Effective search space: 151932699 Effective search space used: 151932699 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.0 bits)