BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.60_1 (44 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.60_1 Length = 44 Score = 86.7 bits (213), Expect = 7e-20, Method: Compositional matrix adjust. Identities = 44/44 (100%), Positives = 44/44 (100%) Query: 1 LYQAVSVIDERIIPVNIKKLLIVSLLSSTAIISGCDSHSGDGVH 44 LYQAVSVIDERIIPVNIKKLLIVSLLSSTAIISGCDSHSGDGVH Sbjct: 1 LYQAVSVIDERIIPVNIKKLLIVSLLSSTAIISGCDSHSGDGVH 44 >gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Score = 28.5 bits (62), Expect = 0.023, Method: Compositional matrix adjust. Identities = 12/21 (57%), Positives = 18/21 (85%) Query: 15 VNIKKLLIVSLLSSTAIISGC 35 ++IK L++ SL+SST I+SGC Sbjct: 1 MDIKGLIVASLISSTVIMSGC 21 >gi|254780886|ref|YP_003065299.1| hypothetical protein CLIBASIA_03915 [Candidatus Liberibacter asiaticus str. psy62] Length = 41 Score = 26.6 bits (57), Expect = 0.076, Method: Compositional matrix adjust. Identities = 14/30 (46%), Positives = 22/30 (73%), Gaps = 1/30 (3%) Query: 15 VNIKKLLIVSLLSSTAIISGCDSHSGDGVH 44 +N K L++ S++SSTAI+S C S+S + H Sbjct: 1 MNAKGLIVASIISSTAIMSSC-SYSWNLKH 29 >gi|254780630|ref|YP_003065043.1| ribonuclease PH [Candidatus Liberibacter asiaticus str. psy62] Length = 242 Score = 21.6 bits (44), Expect = 2.5, Method: Composition-based stats. Identities = 11/33 (33%), Positives = 18/33 (54%) Query: 10 ERIIPVNIKKLLIVSLLSSTAIISGCDSHSGDG 42 +R+I ++ ++ +S L S II CD DG Sbjct: 91 QRMIGRALRSVVDLSALGSRQIIIDCDVIQADG 123 >537021.9.peg.542_1 Length = 54 Score = 21.2 bits (43), Expect = 3.3, Method: Compositional matrix adjust. Identities = 13/35 (37%), Positives = 18/35 (51%), Gaps = 1/35 (2%) Query: 3 QAVSVIDERIIPVNIKKLLIVSLLSST-AIISGCD 36 AV ID +IP LL++SL S ++ G D Sbjct: 8 YAVRGIDIFLIPAMFSSLLLISLFDSYECVMMGFD 42 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.137 0.378 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 26,392 Number of Sequences: 1233 Number of extensions: 647 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 44 length of database: 328,796 effective HSP length: 17 effective length of query: 27 effective length of database: 307,835 effective search space: 8311545 effective search space used: 8311545 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)