BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.612_1 (53 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.612_1 Length = 53 Score = 109 bits (272), Expect = 9e-27, Method: Compositional matrix adjust. Identities = 53/53 (100%), Positives = 53/53 (100%) Query: 1 LDDFHLSDLIHEESSPGFYFHYQKTIMSNSIFHKSKMDLKKENNFFETRTTEY 53 LDDFHLSDLIHEESSPGFYFHYQKTIMSNSIFHKSKMDLKKENNFFETRTTEY Sbjct: 1 LDDFHLSDLIHEESSPGFYFHYQKTIMSNSIFHKSKMDLKKENNFFETRTTEY 53 >gi|254780964|ref|YP_003065377.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 33.1 bits (74), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 14/17 (82%), Positives = 15/17 (88%) Query: 37 MDLKKENNFFETRTTEY 53 +DLKKE NFFETR TEY Sbjct: 327 IDLKKEKNFFETRVTEY 343 >gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 33.1 bits (74), Expect = 8e-04, Method: Compositional matrix adjust. Identities = 14/17 (82%), Positives = 15/17 (88%) Query: 37 MDLKKENNFFETRTTEY 53 +DLKKE NFFETR TEY Sbjct: 327 IDLKKEKNFFETRVTEY 343 >537021.9.peg.75_1 Length = 136 Score = 33.1 bits (74), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 14/17 (82%), Positives = 15/17 (88%) Query: 37 MDLKKENNFFETRTTEY 53 +DLKKE NFFETR TEY Sbjct: 111 IDLKKEKNFFETRVTEY 127 >gi|254781006|ref|YP_003065419.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 32.7 bits (73), Expect = 0.001, Method: Compositional matrix adjust. Identities = 14/17 (82%), Positives = 15/17 (88%) Query: 37 MDLKKENNFFETRTTEY 53 +DLKKE NFFETR TEY Sbjct: 100 IDLKKEKNFFETRVTEY 116 >gi|254780136|ref|YP_003064549.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 125 Score = 32.7 bits (73), Expect = 0.001, Method: Compositional matrix adjust. Identities = 14/17 (82%), Positives = 15/17 (88%) Query: 37 MDLKKENNFFETRTTEY 53 +DLKKE NFFETR TEY Sbjct: 100 IDLKKEKNFFETRVTEY 116 >gi|254780284|ref|YP_003064697.1| hypothetical protein CLIBASIA_00845 [Candidatus Liberibacter asiaticus str. psy62] Length = 623 Score = 21.6 bits (44), Expect = 2.7, Method: Compositional matrix adjust. Identities = 14/50 (28%), Positives = 24/50 (48%), Gaps = 6/50 (12%) Query: 3 DFHLSDLIHEE---SSPGFY---FHYQKTIMSNSIFHKSKMDLKKENNFF 46 D L D +H E S+P FH +++S ++ SK D+ + F+ Sbjct: 393 DCSLGDDVHRENMFSAPEISVDGFHEGSSLVSPALKSNSKRDVAQNRKFW 442 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.134 0.391 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 37,096 Number of Sequences: 1233 Number of extensions: 1053 Number of successful extensions: 11 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 53 length of database: 328,796 effective HSP length: 25 effective length of query: 28 effective length of database: 297,971 effective search space: 8343188 effective search space used: 8343188 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)