BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.671_1 (38 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.671_1 Length = 38 Score = 78.6 bits (192), Expect = 2e-17, Method: Compositional matrix adjust. Identities = 38/38 (100%), Positives = 38/38 (100%) Query: 1 VNRYAGQQKSAPISYCRLITGEISARSGINQPLPSKNK 38 VNRYAGQQKSAPISYCRLITGEISARSGINQPLPSKNK Sbjct: 1 VNRYAGQQKSAPISYCRLITGEISARSGINQPLPSKNK 38 >gi|254780964|ref|YP_003065377.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 20.4 bits (41), Expect = 5.2, Method: Composition-based stats. Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 23 ISARSGINQPLPSK 36 ++ARS +NQ LP K Sbjct: 25 LNARSDVNQLLPLK 38 >gi|254780845|ref|YP_003065258.1| ribonucleotide-diphosphate reductase subunit beta [Candidatus Liberibacter asiaticus str. psy62] Length = 352 Score = 20.4 bits (41), Expect = 5.2, Method: Composition-based stats. Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 23 ISARSGINQPLPSK 36 ++ARS +NQ LP K Sbjct: 25 LNARSDVNQLLPLK 38 >537021.9.peg.74_1 Length = 196 Score = 20.0 bits (40), Expect = 7.5, Method: Composition-based stats. Identities = 8/14 (57%), Positives = 11/14 (78%) Query: 23 ISARSGINQPLPSK 36 ++ARS +NQ LP K Sbjct: 25 LNARSDVNQLLPLK 38 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.312 0.129 0.366 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,949 Number of Sequences: 1233 Number of extensions: 422 Number of successful extensions: 4 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of query: 38 length of database: 328,796 effective HSP length: 12 effective length of query: 26 effective length of database: 314,000 effective search space: 8164000 effective search space used: 8164000 T: 11 A: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.0 bits) S2: 31 (16.5 bits)