BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.683_1 (37 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.683_1 Length = 37 Score = 76.3 bits (186), Expect = 9e-17, Method: Compositional matrix adjust. Identities = 37/37 (100%), Positives = 37/37 (100%) Query: 1 MWNILKKAKSFSLIFQFTINEYCRSNRNSITFSSGEI 37 MWNILKKAKSFSLIFQFTINEYCRSNRNSITFSSGEI Sbjct: 1 MWNILKKAKSFSLIFQFTINEYCRSNRNSITFSSGEI 37 >gi|254780463|ref|YP_003064876.1| putative peptidoglycan binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 673 Score = 23.5 bits (49), Expect = 0.76, Method: Compositional matrix adjust. Identities = 8/24 (33%), Positives = 14/24 (58%) Query: 1 MWNILKKAKSFSLIFQFTINEYCR 24 M N + K++ I Q ++EYC+ Sbjct: 429 MLNSINKSQDIERILQKNMHEYCK 452 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.324 0.132 0.397 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 21,388 Number of Sequences: 1233 Number of extensions: 431 Number of successful extensions: 2 Number of sequences better than 100.0: 2 Number of HSP's better than 100.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 37 length of database: 328,796 effective HSP length: 11 effective length of query: 26 effective length of database: 315,233 effective search space: 8196058 effective search space used: 8196058 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 31 (16.5 bits)