HHsearch alignment for GI: peg_753 and conserved domain: PRK09248

>PRK09248 putative hydrolase; Validated.
Probab=98.41  E-value=8.5e-07  Score=75.99  Aligned_cols=177  Identities=12%  Similarity=0.103  Sum_probs=99.0

Q ss_pred             CHHHHHHCHHHHHHHCCCHHHHHHHHHHCCCCEEEEECCCH-HHHHH---HHHHH----HHHCCCCEEEEEEEEEEC-CC
Q ss_conf             13343314447644329989999999978998899811651-77499---99999----997699638999999854-76
Q 537021.9.peg.7   11 FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNN-LFSAL---EFSQK----ACAAGIQPIIGCQLDIDM-QD   81 (1033)
Q Consensus        11 FvhLh~hS~ySlldg~~~~e~LV~~A~~~G~~AiAITD~~n-l~Gav---~F~~a----ckk~gIKPIiG~E~~v~~-~~   81 (1033)
T Consensus         4 ~~DlH~HT~~S-~ha~~ti~E~~~aA~~~Gl~~i~iTDH~p~~~~~~~~~~~~~~~~~~r~~~~i~Il~GiE~dIl~~~G   82 (246)
T PRK09248          4 LVDTHTHTIAS-GHAYSTLHENAAEAKQKGIKLFAITDHGPDMPGAPHYWHFINLRVLPRFVDGVGILRGIEANIKNIDG   82 (246)
T ss_pred             CEEECCCCCCC-CCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCCCHHHHHHHHHHHHHHCCCEEEEEEECCCCCCCC
T ss_conf             55857788876-89979699999999986996899898996668971067886699989876174177544414468888


Q ss_pred             CCCCCCCCCCCCCCCCEEEEEECCHHHHH------HHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCEEEECCCCCCHH
Q ss_conf             64334456566667753999956968999------999999899732487787400789998634898899819767967
Q 537021.9.peg.7   82 NLKMTNQGKTPFPTVPSIVLLVSTAEGYQ------RLIELVSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPI  155 (1033)
Q Consensus        82 ~~~~~~~~~~~~~~~~~lvlLAkN~~Gy~------nL~kL~S~a~~~~~~~~~p~i~~~~L~e~~~egLIvlsg~~~g~i  155 (1033)
T Consensus        83 ~lD~~~~~l~~----lD~vIaSvH~~~~~~~~~~~~t~~~i~--------------------ai-~n~~vdiigHp~~~~  137 (246)
T PRK09248         83 EIDLPGSMLKK----LDIVIAGFHEPVFAPGDKETNTQAMIN--------------------AI-KSGRVDIIGHPGNPK  137 (246)
T ss_pred             CCCCHHHHHHH----CCEEEEEEECCCCCCCCHHHHHHHHHH--------------------HH-HCCCCCEEECCCCCC
T ss_conf             74851989963----999999831444687379999999999--------------------98-579976898999998


Q ss_pred             HHHHHCCCHHHHHHHHHHHHHHCCCCEEEEEECCCH----HH-HHHHHHHHHHHHHHCCCEEEECCCCCCCHH
Q ss_conf             888877997899999999987659868999943991----15-899999999999818989980883007878
Q 537021.9.peg.7  156 DRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHRG----YD-RYRESQVVQLAYTHELPLVATNNSLFLSEE  223 (1033)
Q Consensus       156 ~~~l~~~~~~~a~~~l~~l~~~Fgd~~ylEl~~~~~----~e-~~~~~~l~~lA~~~~iPlVaTndv~Y~~~~  223 (1033)
T Consensus       138 ------~~~-D~e~v~~aa~e---~g~~lEIN~s~~r~~r~~~~~~~~~il~~a~~~Gv~i~i~SDAH~~~~v  200 (246)
T PRK09248        138 ------YPI-DIEAVVKAAAE---HNVALEINNSSFKHSRKGSEDNCRAIAALCKKAGVWVALGSDAHIAFDI  200 (246)
T ss_pred             ------CCC-CHHHHHHHHHH---HCCEEEEECCCCCCCCCCCCCCHHHHHHHHHHCCCEEEEECCCCCHHHH
T ss_conf             ------885-89999999998---4969999588666677876446899999999819939985898887775