BLAST/PSIBLAST alignment of GI: peg_753 and GI: 190891309 at iteration 1
>gi|190891309|ref|YP_001977851.1| DNA polymerase III protein, alpha subunit [Rhizobium etli CIAT 652] Length = 1165
>gi|190696588|gb|ACE90673.1| DNA polymerase III protein, alpha subunit [Rhizobium etli CIAT 652] Length = 1165
 Score = 1352 bits (3498), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 643/1031 (62%), Positives = 807/1031 (78%), Gaps = 6/1031 (0%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            +P F+HL+VHS+YSLLEGAL L  IL K A D QPAIAITDTNNLF ALEFSQKA   G+
Sbjct: 16   TPGFIHLRVHSAYSLLEGALPLKKILYKAAGDNQPAIAITDTNNLFVALEFSQKAMDDGL 75

Query: 68   QPIIGCQLDIDMQDNLKMTNQG-KTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            QPIIGCQ+ IDM+D L+   +G +     +PSIVLL +T  GY+RL++LVSR YL     
Sbjct: 76   QPIIGCQVSIDMEDGLETEKRGGQQALVKLPSIVLLAATEAGYERLVDLVSRAYLGGDSN 135

Query: 127  QSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNL 186
            Q++ I  SWL+E GTEGLI LTG  +GP+D A     +  AE RLL  K+LFGDRLYV L
Sbjct: 136  QAIHIRASWLEEAGTEGLIALTGALTGPVDAAIREGHTAQAEARLLMLKRLFGDRLYVEL 195

Query: 187  QRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
            QRH  YD+  E ++V LAY H+LPLVATN + F + +DY+AHD LMAVAH+ +VS   R 
Sbjct: 196  QRHGTYDKPHEQKIVGLAYAHDLPLVATNEAFFPTRDDYDAHDALMAVAHNAIVSDDSRF 255

Query: 247  RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
            R+TPDHYLK+R+EM  +F+DLPEALENT+EIARRCSF+L+   PILPRF     D  + E
Sbjct: 256  RLTPDHYLKSRAEMAKLFADLPEALENTIEIARRCSFVLKTRKPILPRFTGATDDAEEAE 315

Query: 307  EENE--LRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
                  LR +AV GL+ RL+   ++ GY  +DYR+RL+FEL+VI RM+F GYFLIVADFI
Sbjct: 316  RAEAGELRRQAVEGLDRRLSTLGMSPGYEEKDYRERLEFELSVIERMRFPGYFLIVADFI 375

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
            +WAK+++IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNP+R+SMPDFDIDFCQ
Sbjct: 376  KWAKQHDIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPERVSMPDFDIDFCQ 435

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            DRR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL+PN+PA
Sbjct: 436  DRREEVIRYVQAKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKLVPNNPA 495

Query: 485  HPVSL-QAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
            +P  L +AI ++ + +E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLS+LV
Sbjct: 496  NPTPLSKAIEEEPKLQEEAAKEPVVARLLDIAQKIEGLYRHASTHAAGIVIGDRPLSKLV 555

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPF 603
            PMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++DF+A+RG+ VDL+ IP 
Sbjct: 556  PMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKVAVDFVAKRGISVDLAAIPL 615

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNN 663
            DD +TY +L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI  YN 
Sbjct: 616  DDKKTYEMLSRGETVGVFQVESAGMRKALIGMKPDCIEDIIALVALYRPGPMENIPTYNA 675

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G E++ SIHP+ID +LKETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKIK 
Sbjct: 676  RKHGDEELESIHPMIDHLLKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIKA 735

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
            EMD+Q+ERF+ GA KNG+SK  A NIFELLAKFA+YGFNKSHAAAYA++SYQTA+MK HY
Sbjct: 736  EMDQQRERFVDGAVKNGVSKPQADNIFELLAKFANYGFNKSHAAAYAIVSYQTAYMKAHY 795

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEFLAASMTL+M N EK+  F QDA++  I+++ PSV T    F+ GDNRIYY+LAA+K
Sbjct: 796  PVEFLAASMTLDMSNTEKVNDFRQDAKRLGIEVIAPSVQTSFRQFETGDNRIYYALAALK 855

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
            GVG +   HI+E   D PF  +EDFC R+D +++NRRVLESL++AGA DCFG  R QL  
Sbjct: 856  GVGESAVDHIVEVRGDTPFAGIEDFCLRIDPRQVNRRVLESLIYAGAFDCFGTDRAQLSA 915

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
             LD I  YAQ  ++N+ +   +IF     +  +KI L  FS   +S R   E +VLGFY 
Sbjct: 916  GLDRILGYAQRAQENKLSGQSDIFGSTLTSGPEKIALPPFSPWLASERLLKEFQVLGFYL 975

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIR--GNNIRLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            + HPLD Y  IL+KM ++ + E  A I+   +N RLA  V+SKQ++KTR G+++G + FS
Sbjct: 976  TAHPLDSYNNILQKMRVQTFAEFSAAIKQGASNARLAGTVISKQERKTRTGNKMGIIVFS 1035

Query: 1022 EPAKEYEANFF 1032
            + + ++EA  F
Sbjct: 1036 DSSGQFEAVLF 1046