BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.753_1
         (1033 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|188585188|ref|YP_001916733.1| DNA polymerase III catalytic subunit, DnaE type [Natranaerobius
            thermophilus JW/NM-WN-LF]
 gi|179349875|gb|ACB84145.1| DNA polymerase III catalytic subunit, DnaE type [Natranaerobius
            thermophilus JW/NM-WN-LF]
          Length = 1134

 Score =  865 bits (2234), Expect = 0.0,   Method: Composition-based stats.
 Identities = 410/1036 (39%), Positives = 614/1036 (59%), Gaps = 28/1036 (2%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            + K   FVHL  HS YSLL+G   +N ++ K    Q PA+A+TD   ++ A+EF ++A  
Sbjct: 1    MPKP--FVHLHTHSQYSLLDGKCRINELVQKAKEYQMPALALTDHGVMYGAVEFYKQAKE 58

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            AGI+PI+GC++ +  +                  +VLL     GY+ L++LVS  +  + 
Sbjct: 59   AGIKPILGCEVYVAPRGRTVKDPVKDKHQ---YHLVLLAENQTGYKNLMKLVSLAF-KEG 114

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLY 183
                 R+    L+    +G+I L+   +G I         +VA+ R    K +FG +  Y
Sbjct: 115  FYYKPRVDYELLERYH-DGIIALSACLAGEIPTLILQGQYEVAKNRADRLKSIFGQNNFY 173

Query: 184  VNLQRHRG-YDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + LQ H    ++   + ++Q++   ++ LVATN+  +L+ ++   HDVL+ +     +  
Sbjct: 174  LELQDHGLTEEQQVNTHLLQISRELDIGLVATNDIHYLTNQESSIHDVLLCIQTGKHLDD 233

Query: 243  KDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
            +DR +  + + Y K+  EM +IF D P A+ENT+ IA RC   L      LP F   E  
Sbjct: 234  QDRMKFPSNEFYFKDGDEMSNIFKDFPGAIENTLAIADRCQVELDFDTLHLPEFRVPEGY 293

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
            D    E + LR     GL  R  Q            ++RL++EL+VI++M ++ YFLIV 
Sbjct: 294  D----ENSYLRKLCQKGLLERYEQ-------VTTKIQERLEYELDVISKMGYASYFLIVW 342

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DF+++A +NNI VGPGRGS AGS+ AY+L IT++DP+R+ LLFERFLNP+R++MPD DID
Sbjct: 343  DFVRFAHENNILVGPGRGSAAGSLVAYSLRITNVDPIRYGLLFERFLNPERVNMPDIDID 402

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FC + R+ VI+YV  KYG++ VA IITFG++QA+AA+RDVGR + M Y  VDR+ K+IP+
Sbjct: 403  FCYENRERVIQYVVEKYGNDNVAHIITFGTMQARAAVRDVGRVMGMNYGDVDRVAKMIPH 462

Query: 482  DPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            DP   +  +A+  +  F++    DP V  L+ IS+ +EGL RHAS HAAGIVI   PL++
Sbjct: 463  DPGMTID-KALELNKDFKKLYDEDPQVRELINISKSIEGLPRHASIHAAGIVISKAPLTE 521

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSL 600
             VP+  +   D  VTQF M  +E+ GL+K DFLGLKTLT++ ++++ + Q     VDL+ 
Sbjct: 522  YVPLQCN--DDQVVTQFPMGTLEELGLLKMDFLGLKTLTMMNRAVEIVNQTQAETVDLNK 579

Query: 601  IPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVV 660
            IP DD +T+ L+    TLG+FQLESSGMR  L  ++P   EDIIA  +LYRPGP++ I  
Sbjct: 580  IPLDDEQTFRLIREGNTLGVFQLESSGMRGVLRDLKPTSFEDIIATSALYRPGPMEQIPT 639

Query: 661  YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKK 720
            +   K+G+ +I   H  + P+L+ET G+I+YQEQ+MQ+A  ++G+SL EAD+LRRA+GKK
Sbjct: 640  FIESKHGQREISYPHEDLKPILEETYGIIVYQEQIMQVASTMAGFSLGEADLLRRAIGKK 699

Query: 721  IKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMK 780
             K  + +QKE+F+ G    G  K    ++++L+ KFADYGFNKSH+AAYA I+YQ+A++K
Sbjct: 700  KKNILAEQKEKFVQGCINRGYGKETGEHVYDLIVKFADYGFNKSHSAAYAYIAYQSAYLK 759

Query: 781  THYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFK-VGDNRIYYSL 839
             +YP +F+AA +T  M++ +K+  +  +AR+  I+I+PP VN   VDF  V D RI + L
Sbjct: 760  ANYPTQFMAALLTNSMNDTDKLALYIDNAREMGIEILPPDVNESLVDFTAVSDFRIRFGL 819

Query: 840  AAIKGVGTTTARHIM-EASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSR 898
            AA+K VG      I+     +  F SL+DFCSR D +  N++ +ESL+  GA D F ++R
Sbjct: 820  AAVKNVGRGAVEEIITRRRKEGGFTSLDDFCSRTDLRACNKKAIESLIKVGAFDAFEHNR 879

Query: 899  MQLLQSLDNIQKYAQWVEKNRTNKHENIFAH-EKGTFSDKITLEKFSVENSSVRFENEQR 957
             Q+LQ LD   K AQ            +F     GT    +          +   + E+ 
Sbjct: 880  KQMLQVLDEAVKKAQAFTSGSVKGQVTMFEIVSDGTNKIDLDYPDVEEFTLNELLQMEKE 939

Query: 958  VLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGW 1017
            +LGF+ SGHPLD YK  L  +      E      G  I++A +    ++  T+KG ++ +
Sbjct: 940  LLGFFVSGHPLDNYKEKLANIDTSSLAELNQIKEGFRIKVAGICQDVKEIITKKGEQMAF 999

Query: 1018 VTFSEPAKEYEANFFP 1033
             T  + +   E   FP
Sbjct: 1000 CTLEDQSGTVELVIFP 1015


>gi|118580484|ref|YP_901734.1| DNA polymerase III, alpha subunit [Pelobacter propionicus DSM 2379]
 gi|118503194|gb|ABK99676.1| DNA polymerase III, alpha subunit [Pelobacter propionicus DSM 2379]
          Length = 1184

 Score =  865 bits (2234), Expect = 0.0,   Method: Composition-based stats.
 Identities = 430/1042 (41%), Positives = 630/1042 (60%), Gaps = 18/1042 (1%)

Query: 2    TQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQK 61
            +Q+  ++P FVHL VH+ YSLL+GA+ L +++ K  A   PA+AITD  N+F A+EF  K
Sbjct: 7    SQHPPQAP-FVHLHVHTQYSLLDGAIRLEDLIAKAKAHNMPALAITDHGNMFGAVEFYLK 65

Query: 62   ACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYL 121
               AGI+P+IGC++ I            +        ++LL    +GY+ L  L S  Y 
Sbjct: 66   CKKAGIKPLIGCEVYIAPDSRFSR-ESTRGISEAAYHLILLCENMQGYRNLSYLTSAGY- 123

Query: 122  LDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDR 181
             +      RI    LQE  +EGLI L+    G +    F +    A +    + +LF DR
Sbjct: 124  KEGFYYRPRIDRELLQE-HSEGLIALSACLKGEVAMQCFRDRMDDALETARWYSQLFPDR 182

Query: 182  LYVNLQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVV 240
             Y+ LQ +   ++     +++++A T +LPLVATN+  +L+ ED  AH+VL+ +     +
Sbjct: 183  YYIELQENTLPEQDVVNKRLMEVAATLQLPLVATNDCHYLNREDARAHEVLLCIQTGKTM 242

Query: 241  SQKDRPRVT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKE 299
            S     + +  + Y+K+  EMV+ F   PEA+ NT++IA RC   L +            
Sbjct: 243  SDPSHMKFSAEEFYVKSPEEMVAAFGYAPEAVSNTLKIADRCDLKLPLDTGEY--HFPHF 300

Query: 300  CDDIQKEEENELRNKAVAGLEVRL----AQGAIAKGYHAQDYRQRLDFELNVIARMKFSG 355
                 K  ++ L   AV GL+ R+    A+         Q Y +RL  EL  I  M+F  
Sbjct: 301  DPPAGKNHDDMLEELAVQGLKERMVTILAKYPDMSLERRQAYFERLQIELKCIREMQFPA 360

Query: 356  YFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSM 415
            YFLIV+DFI WAK   IPVGPGRGS AGS+ AYA+ ITD+DPL ++LLFERFLNP+R++M
Sbjct: 361  YFLIVSDFITWAKNKGIPVGPGRGSAAGSLVAYAIRITDLDPLPYNLLFERFLNPERITM 420

Query: 416  PDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRL 475
            PD D+DFCQDRR+EVI+YV  KYG ERV QIITFG+++AKA +RDVGRAL M Y  VDR+
Sbjct: 421  PDIDVDFCQDRREEVIQYVIEKYGRERVCQIITFGTMKAKAVVRDVGRALNMTYGDVDRI 480

Query: 476  CKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIG 535
             KLIP+D    +  +A+  + +  E    DP V  LL+ +  LEGL RHASTHAAG+V+ 
Sbjct: 481  AKLIPDDLKMTL-AKALKQEPQLNEMAERDPQVRDLLDTALCLEGLTRHASTHAAGVVVA 539

Query: 536  DRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGV 594
             R L + +P+Y+D ++    TQ++MK++E  GL+KFDFLGLK LT+++ ++  +   +  
Sbjct: 540  PRQLEEFLPVYKDQKTGSINTQYSMKYVEMVGLVKFDFLGLKNLTVIENAVHLVRAGKDP 599

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
              D++ +  DD E+Y L+++  T GIFQLESSGM++ L  ++P C ED+IA  +LYRPGP
Sbjct: 600  DFDITRLRDDDSESYDLISSGNTTGIFQLESSGMKEMLVKLKPSCFEDVIAACALYRPGP 659

Query: 655  IDNIVV--YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADV 712
            +   +V  +  RK+G++K+V   P ++P+LK+T GVI+YQEQVMQI++ L+GYSL  AD+
Sbjct: 660  LGCGMVDEFIERKHGRQKVVYDLPQLEPILKDTYGVIVYQEQVMQISRTLAGYSLGRADL 719

Query: 713  LRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVI 772
            LRRAMGKK    M K+KE F+ GA   GI    A  IF+ +AKFA+YGFNKSH+AAYA+I
Sbjct: 720  LRRAMGKKDPAVMAKEKEPFLEGAKAQGIDPKKAEAIFDQMAKFAEYGFNKSHSAAYALI 779

Query: 773  SYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGD 832
            +YQTAW+K+HYPVEFLAA +T +MD+ +K+ K   D R+  I+++PP VN   + F V  
Sbjct: 780  AYQTAWLKSHYPVEFLAALLTCDMDSTDKVIKNINDCREQGIEVLPPDVNKSGLTFTVVG 839

Query: 833  NRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALD 892
            N + + L A+KGVGT     I+EA  D PF  + DFC RVD ++ N++VLE+L+  GA D
Sbjct: 840  NSMRFGLGAVKGVGTGAVEAILEARQDGPFKDVYDFCERVDMRRSNKKVLEALIKCGAFD 899

Query: 893  CFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEK--GTFSDKITLEKFSVENSSV 950
                 R  +++ L+    + Q +++ R +   ++F  ++   +  +   L      +   
Sbjct: 900  STNAPRAAMMEGLETAMNFGQRIQQERASAQVSLFGDDEVARSGGNGHRLPDVPEWHDKE 959

Query: 951  RFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTR 1010
            +   E+  LGF  +GHPLD Y   ++++             G  IR+  +V S ++  T+
Sbjct: 960  KLALEKEALGFLITGHPLDRYVDDIKRLNCVEISRLTEQADGGEIRVCGIVSSLKEITTK 1019

Query: 1011 KGSRIGWVTFSEPAKEYEANFF 1032
            KG R+G+VT  +     E   F
Sbjct: 1020 KGDRMGFVTIEDLTGSVEVTVF 1041


>gi|78222430|ref|YP_384177.1| DNA polymerase III subunit alpha [Geobacter metallireducens GS-15]
 gi|78193685|gb|ABB31452.1| DNA polymerase III, alpha subunit [Geobacter metallireducens GS-15]
          Length = 1155

 Score =  862 bits (2227), Expect = 0.0,   Method: Composition-based stats.
 Identities = 418/1034 (40%), Positives = 613/1034 (59%), Gaps = 14/1034 (1%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL +H+ YSLL+GA+ L +++ K      PA+AITD   +F A+EF  K    G++P
Sbjct: 2    SFVHLHLHTQYSLLDGAIRLGDLIKKAKDTDMPAVAITDHGVMFGAMEFYLKCKDKGVKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIG ++ I          +G         ++LL     GY+ L +LVS  +  +      
Sbjct: 62   IIGSEVYIAPGSRFVKEVKGGEA-GAGYHLLLLCENMTGYRNLSKLVSVGF-KEGFYYKP 119

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            RI    L +  +EGLI L+    G +      +  + A      +  LF DR Y+ LQ +
Sbjct: 120  RIDKEVLAQY-SEGLICLSACLKGEVAYLCERDRMEEAIGVARWYADLFPDRYYIELQEN 178

Query: 190  RGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++ +    ++++A    LPLVATN+  +L+ ED  AH+VL+ +     ++   R R 
Sbjct: 179  GLAEQDKANKGLLEVAREVGLPLVATNDCHYLNREDARAHEVLLCIQTGKTMNDSARMRF 238

Query: 249  T-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
            +  + Y+K   EM + F   PEA+ NTV+IA RC+          P+F       + +  
Sbjct: 239  STDEFYVKTPEEMAAAFHYAPEAVSNTVKIAERCNLDFDFKTYYFPQFDPPVGQTLDQML 298

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            E+  R      L+    +         Q Y +RL  EL+ I +M F GYFLIVADFI WA
Sbjct: 299  EDAARKGLEFRLKEIRLKNPDMSPEQEQKYWERLRIELDCITQMGFPGYFLIVADFINWA 358

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K + IPVGPGRGS AGS+ AY++ ITD+DPL ++LLFERFLNP+R+SMPD D+DFCQDRR
Sbjct: 359  KDHGIPVGPGRGSAAGSLVAYSIRITDLDPLPYNLLFERFLNPERISMPDIDVDFCQDRR 418

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
            +EVI YV  KYG ++V QIITFG++ A+A +RDVGRAL M Y  VD++ KL+P      +
Sbjct: 419  EEVIHYVTGKYGRDQVCQIITFGTMSARAVIRDVGRALDMTYGDVDKIAKLVPEVLGIKL 478

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                IA + R +EA  AD  V  LLEI  +LEGL RHASTHAAG+V+  + L +  P+Y+
Sbjct: 479  KDA-IAQEPRLKEASEADSRVKELLEIGLRLEGLARHASTHAAGVVVAPKVLEEFCPVYK 537

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
            D ++    TQ++MK++EK GL+KFDFLGLK LT++  ++  +   +    D++ +  DD 
Sbjct: 538  DQKTGSLTTQYSMKYVEKIGLVKFDFLGLKNLTVIHNAVKIIRAGKDPNFDIAALRDDDR 597

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNNR 664
             +Y L++   T G+FQLESSGM+  L  ++P C ED+IA  +LYRPGP+ + +   + +R
Sbjct: 598  ASYDLISAGNTTGVFQLESSGMKDMLVKLKPSCFEDVIAACALYRPGPLGSGMVDDFIDR 657

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G++K+V   P ++P+LK+T GVI+YQEQVMQIA+ L+GYSL  AD+LRRAMGKK   E
Sbjct: 658  KHGRKKVVYDLPQLEPILKDTYGVIVYQEQVMQIARTLAGYSLGGADLLRRAMGKKDPAE 717

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            M KQ++ F+ GA   G+    A  IF+L+AKFA+YGFNKSH+AAYA+++YQTA++K HYP
Sbjct: 718  MAKQRDIFLEGAKNGGVDLQKAGAIFDLMAKFAEYGFNKSHSAAYALVAYQTAYLKAHYP 777

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKG 844
            VEFLAA +T +M N +K+ K   D R+  I+I+PP +N   + F+V  N I + L A+K 
Sbjct: 778  VEFLAALLTEDMGNTDKVVKTISDCREMGIEILPPDINDSHLSFRVLGNSIRFGLGAVKN 837

Query: 845  VGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQS 904
            VG      I+EA  +  F  L DFC RVD  K+N+RV+ESLV  GA D  G  R QL+ +
Sbjct: 838  VGEGAIEAIIEARQEGDFKDLFDFCERVDLHKVNKRVVESLVKCGAFDSTGGRRSQLMSA 897

Query: 905  LDNIQKYAQWVEKNRTNKHENIFAHEK-----GTFSDKITLEKFSVENSSVRFENEQRVL 959
            L++     Q +++ R +   ++F  E+     G    K+ L      +  ++   E+  L
Sbjct: 898  LEDAMAIGQKIQQERESAQVSLFGVEEIVRTNGNGKGKVQLPDIPEWDDKLKLGLEKEAL 957

Query: 960  GFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVT 1019
            GF+ +GHPL  Y+  +++               + ++L  +V S ++  T+KG R+ + T
Sbjct: 958  GFFITGHPLGRYEKEIKRFANVDTATLDERADKSEVKLCGIVTSLKELITKKGDRMAFAT 1017

Query: 1020 FSEPAKEYEANFFP 1033
              +     E   FP
Sbjct: 1018 LEDLLGSVEVVVFP 1031


>gi|169831212|ref|YP_001717194.1| DNA polymerase III, alpha subunit [Candidatus Desulforudis
            audaxviator MP104C]
 gi|169638056|gb|ACA59562.1| DNA polymerase III, alpha subunit [Candidatus Desulforudis
            audaxviator MP104C]
          Length = 1075

 Score =  861 bits (2224), Expect = 0.0,   Method: Composition-based stats.
 Identities = 402/1037 (38%), Positives = 595/1037 (57%), Gaps = 31/1037 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
             FVHL  H+ YSLL+GA  + +++ + A    PA+AITD   +F  +EF +    AG++P
Sbjct: 3    DFVHLHTHTEYSLLDGAARIKDLVRRAAEFGMPALAITDHGTMFGVVEFYKACRNAGVKP 62

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            +IGC++ +  +      +        +  +VLL     GY+ L+ LVS  +  +      
Sbjct: 63   VIGCEVYVAPRTRHDRQSG---IDDKLAHLVLLAENERGYRNLLRLVSLSFT-EGFYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            RI    L     EGLI L+   +G I           A +    ++ LFG   Y+ LQ H
Sbjct: 119  RIDREILA-THREGLIALSACLAGEIPELILAGKPDRALETAAEYRDLFGKNFYLELQDH 177

Query: 190  RGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
                +      +V +     + LVATN+  ++  E  E  D+L+ +     V    R R 
Sbjct: 178  GLPGQSVVNRGLVDIGKRLGIELVATNDVHYVEREQAENQDILLCIQTGKTVHDAGRLRF 237

Query: 249  TPDHYLKNR-SEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
              D +      EM  +F++LP AL NT  IA RC+  L      LP +          + 
Sbjct: 238  EGDQFYFKSGGEMARLFAELPAALANTRLIAERCNLTLDFETLHLPEYRVP----PNYDA 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            +  L      GL              + D R+RLD+EL VIA MK+S YFLIV DFI++A
Sbjct: 294  DTYLAELCHQGLAR-------RYSPVSDDIRRRLDYELRVIAEMKYSSYFLIVWDFIRFA 346

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            ++  I VGPGRGS AGS+ AY+L IT+IDPL + LLFERFLNP+R+S+PD D DFC +RR
Sbjct: 347  REKGILVGPGRGSAAGSLVAYSLGITNIDPLAYGLLFERFLNPERISLPDIDSDFCFERR 406

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG + VAQIITFG++ A+AA+RDVGRAL +PY++VDR+ KLIP +P   +
Sbjct: 407  GEVIDYVFEKYGRDCVAQIITFGTMAARAAVRDVGRALGLPYAEVDRIAKLIPGEPGMSI 466

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+       E    D +V ++LE ++ LEG+ RHAS HAAG+VI    L+  VP+YR
Sbjct: 467  E-KALERSPELAELYERDENVRKVLEAARALEGMPRHASIHAAGVVIAKEKLTNYVPLYR 525

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSLIPFDDH 606
                 +  TQF+M+ IE+ GL+K D LGL+TLT++  +++     RG K+++  IP DD 
Sbjct: 526  TS-DGVVATQFSMEAIEELGLLKMDLLGLRTLTVIGDTVELIRRHRGQKLEMETIPLDDP 584

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNNR 664
             TY LL    T G+FQLESSGMR  L  ++P+  ED+IALV+LYRPGP+ + +   +  R
Sbjct: 585  ATYDLLGRGDTAGVFQLESSGMRSILRELRPEVFEDVIALVALYRPGPLGSRMVEDFIKR 644

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+GK ++  +HP + P+LK+T GVI+YQEQVM+IA  L+G+SL EAD+LRRAMGKK  E 
Sbjct: 645  KHGKTEVQYLHPKLRPILKDTYGVILYQEQVMRIASDLAGFSLGEADLLRRAMGKKKPEI 704

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            +   +++F+ GA+ +G+   +A  IF+L+A FA YGFNKSH+AAYA+I+YQTA++K +YP
Sbjct: 705  IAGLRDQFLEGATAHGVDPAVAGQIFDLMAYFAGYGFNKSHSAAYALIAYQTAYLKANYP 764

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKG 844
            +E++AA +T   D+ EK+  + ++ R+  I+++PP VN    DF V  ++I + LA ++ 
Sbjct: 765  IEYMAALLTSVRDSPEKVSSYVEECRRLGIEVLPPDVNESRKDFTVVGDKIRFGLAGVRN 824

Query: 845  VGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
            VG      ++E    + PF SL DFCSR+D K +N+R++ESL+ AGA    G+ R QLL 
Sbjct: 825  VGEAAVNAVIETRERNGPFRSLPDFCSRLDGKVVNKRMVESLIRAGAFSSLGFRRTQLLA 884

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAH-------EKGTFSDKITLEKFSVENSSVRFENEQ 956
             +D    ++Q ++K + +   ++F              + +I +   +          E+
Sbjct: 885  VMDEALSFSQRLQKEKESGQLSLFGDWGDFGGEGTAAAAPEIVVPHLAEFERHEILAMEK 944

Query: 957  RVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIG 1016
             +LG Y SGHPL  +K  LR++      E      G  + L  +VV  +   TRKG  + 
Sbjct: 945  EMLGLYLSGHPLQEFKDTLRRLTTVNAVEIPELNPGQQVILGGLVVGLKTITTRKGEPMC 1004

Query: 1017 WVTFSEPAKEYEANFFP 1033
            ++   +     E   FP
Sbjct: 1005 FLNLEDLTSRAEIVIFP 1021


>gi|147678555|ref|YP_001212770.1| DNA polymerase III DnaE [Pelotomaculum thermopropionicum SI]
 gi|146274652|dbj|BAF60401.1| DNA polymerase III, alpha subunit [Pelotomaculum thermopropionicum
            SI]
          Length = 1196

 Score =  859 bits (2220), Expect = 0.0,   Method: Composition-based stats.
 Identities = 399/1031 (38%), Positives = 604/1031 (58%), Gaps = 26/1031 (2%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL +HS YSLL+GA  +N+ + + +  Q PA+AITD   +F  ++F +    AGI+P+
Sbjct: 15   FVHLHLHSEYSLLDGAARINDAVKRASEMQMPALAITDHGVMFGTVDFYKACKKAGIKPV 74

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +  +     T +       +  +VLL    EGY+ L+ LVS  ++        R
Sbjct: 75   LGCEVYVAPRSMDDRTPK---IDDNLSHLVLLAENEEGYRNLLNLVSMAFIR-GFYYKPR 130

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +    L E  + GLI L+G  +G +        ++ A +    ++ +FG +  ++ LQ H
Sbjct: 131  VDKELLSE-HSRGLIALSGCIAGEVSARILAGENEKARQAAGDYRDIFGPENFFLELQDH 189

Query: 190  RGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++     +++++     +PLV TN+  ++   D E  DVL+A+     V    R + 
Sbjct: 190  GFAEQRKVNREMLKIHKEMNIPLVVTNDVHYVRRGDAETQDVLLAIQTGKSVDDPGRMKF 249

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             + + YLK+  EM  +F +L  AL NTVEIA RC+  ++     LP +   E  D     
Sbjct: 250  QSEELYLKSPEEMNLLFGELSGALRNTVEIAGRCNVEIEFGKYYLPHYPVPEGYD----A 305

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            +  L      G            G  +   ++RL++EL VI +M +S YFLIV DFI +A
Sbjct: 306  DTYLAELCYQGARRI-------YGELSDGVKKRLEYELGVIKQMGYSAYFLIVWDFIHYA 358

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            ++N IPVGPGRGS AGS+ AY+L IT IDPL++ LLFERFLNP+R+SMPD D+DFC +RR
Sbjct: 359  RQNGIPVGPGRGSAAGSLVAYSLGITSIDPLKYGLLFERFLNPERVSMPDIDVDFCFERR 418

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             E+I YV  +YG +RVAQIITFG++ A+AA+RDVGRAL MPY +VDR+ KL+P +    +
Sbjct: 419  GEIIDYVVRRYGADRVAQIITFGTMAARAAIRDVGRALNMPYGEVDRVAKLVPMELHMTI 478

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+ +    RE     P V +L++ +  LEG+ RHASTHAAG+VI   PL+  +P+Y+
Sbjct: 479  E-KALNESPELRELYDQRPEVRKLIDTAAALEGMPRHASTHAAGVVITPEPLTNYLPLYK 537

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKV-DLSLIPFDDH 606
                    TQF M  +E+ GL+K D LGL+TLT++  +L  + +   +  D+  IP DD 
Sbjct: 538  A-TDGPVTTQFAMGTVEELGLLKMDLLGLRTLTVISDALRLIKESTGEELDIERIPVDDQ 596

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNNR 664
            +TY +L    T G+FQLESSGMR  L  ++P+  EDI+ALV+LYRPGP+ + +   +   
Sbjct: 597  KTYQMLARGETAGVFQLESSGMRSILRDLRPEVFEDIVALVALYRPGPLGSGMVDDFIKN 656

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G +K   +HP ++P+LK+T GVI+YQEQVM+IA  L+G+SL EAD+LRRAMGKK  E 
Sbjct: 657  KHGFKKTKYLHPRLEPILKDTYGVILYQEQVMRIASDLAGFSLGEADLLRRAMGKKKPEI 716

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            +   + +FI GA++NG+    A  IF+L+  FA YGFNKSH+AAYA++SYQTA++K +YP
Sbjct: 717  IAGLRSQFIEGAARNGVDGETAGQIFDLMEYFAGYGFNKSHSAAYALVSYQTAYLKANYP 776

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKG 844
            ++F+AA +T   DN +K+  + ++ R+  I+++PP VN     F V  N+I + LAA+K 
Sbjct: 777  LQFMAALLTSVKDNTDKVAAYIEECRRLGIEVLPPDVNESRESFTVAGNKIRFGLAAVKN 836

Query: 845  VGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
            VG      I+ A   D PF    DFC R+D++ +N+RVLESL+  GA D  GY R QL+ 
Sbjct: 837  VGMGAVDSIIRAREKDGPFSDYADFCRRLDTRVVNKRVLESLIKCGAFDSLGYRRAQLMA 896

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFSVENSSVRFENEQRVLGFY 962
            ++D+    AQ  ++ R N   ++     G+     I+  +            E+  LG Y
Sbjct: 897  AVDSGLALAQQSQRERENGQLSLLDFFGGSTDSVSISFPEVGEYPEDELLAMEKETLGLY 956

Query: 963  FSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSE 1022
             SGHPL  Y+  L ++      E       + + L  ++   ++  TR+G  + ++T  +
Sbjct: 957  ISGHPLSRYREALNRLTTVKTVEITDLPDNSEVVLGGLITDVKKINTRRGEVMAFLTLED 1016

Query: 1023 PAKEYEANFFP 1033
                 E   FP
Sbjct: 1017 LTGTVEVVVFP 1027


>gi|77918826|ref|YP_356641.1| DNA polymerase III subunit alpha [Pelobacter carbinolicus DSM 2380]
 gi|77544909|gb|ABA88471.1| DNA polymerase III, alpha subunit [Pelobacter carbinolicus DSM 2380]
          Length = 1156

 Score =  858 bits (2217), Expect = 0.0,   Method: Composition-based stats.
 Identities = 434/1042 (41%), Positives = 619/1042 (59%), Gaps = 23/1042 (2%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +EK P FVHL VH+ YSLL+GA+ + +++ +      PA+AITD  N+F A+EF  K   
Sbjct: 1    MEKVP-FVHLHVHTQYSLLDGAIRIGDLIKRAEDCGMPAVAITDHGNMFGAVEFFSKLKK 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            + ++PI+GC++ +      + +N           +VLL    EGYQ L  +VS  Y  + 
Sbjct: 60   SSVKPIVGCEVYVAPGSRFEKSN--VRGGDKAYHLVLLCQDIEGYQNLCRMVSAGY-REG 116

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLY 183
                 RI    L++   +GLI LT    G +         + A  R      +F + RLY
Sbjct: 117  FYYKPRIDWDLLRKY-NKGLIALTACLGGELPSLLMQGKHEQAVARARDMAAIFDENRLY 175

Query: 184  VNLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + LQ +   ++      ++ +     LPLVATN+  +L+ E   AH+VL+ V     +  
Sbjct: 176  LELQENFIAEQKPVNEGLIAIGKELGLPLVATNDCHYLTRESAAAHEVLLCVQTGKTMDD 235

Query: 243  KDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
             DR R    + YLK   EM  +F   PEAL NTV IA RC+  L       P++ +    
Sbjct: 236  PDRFRFSNDEFYLKTPEEMAELFHYAPEALANTVAIADRCNLELDFDTYHFPQYEKP--- 292

Query: 302  DIQKEEENELRNKAVAGLEVRLAQG----AIAKGYHAQDYRQRLDFELNVIARMKFSGYF 357
              +K  +  L   +  GLE RLA+             + Y  RL  EL  I  M F GYF
Sbjct: 293  -AEKTLDQVLEEDSWRGLEERLAEIRKVRPDFSAEEEKVYHDRLVRELECINSMGFPGYF 351

Query: 358  LIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPD 417
            LIVADFI WAK N IPVGPGRGS AGS+ AYA+ ITDIDP+ ++LLFERFLNP+R+SMPD
Sbjct: 352  LIVADFINWAKDNGIPVGPGRGSAAGSLVAYAIRITDIDPIPYNLLFERFLNPERVSMPD 411

Query: 418  FDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCK 477
             D+DFC   R++VI YV+ KYG E VAQIITFG++ AK  +RDVGRAL M Y  VDR+ K
Sbjct: 412  IDVDFCIYGREDVIEYVRQKYGEENVAQIITFGTMMAKGVIRDVGRALNMSYGDVDRIAK 471

Query: 478  LIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDR 537
            L+P      +    +  + R +E +  DP V +LL+I+  LEGL RHASTHAAG+V+  +
Sbjct: 472  LVPTVLNITLKEA-LEQEPRLQELQDKDPQVKQLLDIALTLEGLTRHASTHAAGVVVTPK 530

Query: 538  PLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKV 596
            PLS+ +P+Y D +S   VTQF MK++E+ GL+KFDFLGLKTLT++  ++  + +    + 
Sbjct: 531  PLSEYLPLYTDPKSGGQVTQFPMKYVEQIGLVKFDFLGLKTLTVIANAVRLIHEGNDPEF 590

Query: 597  DLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPID 656
            DL L+  DD +TY LL+   T G+FQLESSGM++ L  ++P C EDIIA+ +LYRPGP+ 
Sbjct: 591  DLKLVGDDDPDTYRLLSAGETTGVFQLESSGMKELLVKLKPSCFEDIIAVCALYRPGPLG 650

Query: 657  NIVVYNN--RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLR 714
            + +V +   RK+GK++I    P ++P+LK+T GVI+YQEQVM IAQ+L+ YSL  AD+LR
Sbjct: 651  SGMVDDFILRKHGKKEITYDFPQLEPILKDTYGVIVYQEQVMLIAQVLARYSLGGADLLR 710

Query: 715  RAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            RAMGKK  EEM KQKE F+SGA +N +    A  +F+L+ KFA YGFNKSH+AAYA+++Y
Sbjct: 711  RAMGKKKPEEMAKQKEIFMSGARENELDVKKAEAVFDLMEKFAAYGFNKSHSAAYALVAY 770

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
             TA++KTHYPVEF+AA +T +M+N EK+ K   + R   I+++PP +N     F V DN 
Sbjct: 771  HTAYLKTHYPVEFMAALLTEDMENTEKVIKNINEVRSMGIEVLPPDINASSSSFTVHDNA 830

Query: 835  IYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCF 894
            I + L A+KGVG      I+E   ++PF +L +FC RVD +K+N++V+E+L+  GA D  
Sbjct: 831  IRFGLGAVKGVGGAAIDAILEVRQEQPFTTLHEFCERVDLRKVNKKVVEALIKCGAFDSL 890

Query: 895  GYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKIT---LEKFSVENSSVR 951
            G  R Q L  L+   +  Q V++ +     ++F  ++       +   L +    +  V+
Sbjct: 891  GGHRAQYLVVLEEAMEIGQKVQREKAEGQASLFGTDEIVSQRGTSYGVLPEMEEWSDKVK 950

Query: 952  FENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRK 1011
               E+  LGFY +GHPL  Y+ ++R+       +         +RL  MV   +   T+K
Sbjct: 951  LGFEKESLGFYITGHPLGRYQEVIRRFANCTTADVAERADKEEVRLCGMVSGIKDLVTKK 1010

Query: 1012 GSRIGWVTFSEPAKEYEANFFP 1033
            G R+ +VT  + +   E   FP
Sbjct: 1011 GERMAFVTLEDLSGFVEMVVFP 1032


>gi|319790471|ref|YP_004152104.1| DNA polymerase III, alpha subunit [Thermovibrio ammonificans HB-1]
 gi|317114973|gb|ADU97463.1| DNA polymerase III, alpha subunit [Thermovibrio ammonificans HB-1]
          Length = 1150

 Score =  857 bits (2215), Expect = 0.0,   Method: Composition-based stats.
 Identities = 398/1035 (38%), Positives = 616/1035 (59%), Gaps = 16/1035 (1%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            + +   FVHL +HS YS+L+GA+ + +++ K      PA+AITD  N+F++ E  +    
Sbjct: 1    MVRKGDFVHLHLHSQYSILDGAIKVKDLVKKAKELGMPAVAITDHGNMFASYELYKACKE 60

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GI+PIIG +  I          +G         ++LL    +G + L++L +  +  + 
Sbjct: 61   EGIKPIIGQEFYIAKGSRFDR-KKGGEGEKGSYHLILLAKNDKGLKNLMKLSTIGFT-EG 118

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                 RI    L++  +EGLI L+    G +   +     + A +    +K+LFG+  Y+
Sbjct: 119  FYYKPRIDKEVLEKY-SEGLIALSACIQGEVPLLYLMGKEEEARRAAQWYKELFGEDFYL 177

Query: 185  NLQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             LQ H   ++ +    +++LA   ++ LVATN++ +L++ED+EAHDVL+ +     +S +
Sbjct: 178  ELQYHGIPEQKKANEFLIKLAKELDIELVATNDAHYLNKEDWEAHDVLLCLQTGKKLSDE 237

Query: 244  DRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             R R  + + Y+K+  EM+ +F ++P+A+ NT++IA +    L+         + K    
Sbjct: 238  KRMRFPSREFYVKDAQEMLEVFKEVPQAVFNTLKIAEKVEERLETFENKGY-LLPKYEVP 296

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
                 ++ LR  A  GLE R  +  I  G   Q Y +RL+ EL +I  M F GYFLIV D
Sbjct: 297  EGHTYDSFLRKLAEEGLERRFKEQGITDGEKKQVYYERLNHELKIINDMGFPGYFLIVWD 356

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI WAK+N IPVGPGRGS AGS+ AYA+ ITDIDP+RF+LLFERFLNP+R++MPD D+D 
Sbjct: 357  FINWAKRNGIPVGPGRGSAAGSLVAYAIGITDIDPIRFNLLFERFLNPERVTMPDIDVDI 416

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQD RD VI+YV+ KYG ++V QIITFG+++ K  +RDVGR L +P  +VD+L KLIP+D
Sbjct: 417  CQDGRDRVIQYVREKYGEDKVCQIITFGTMKTKMVIRDVGRVLGIPPKEVDKLAKLIPDD 476

Query: 483  PAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQL 542
                    A+      RE    D ++ RL++I+++L+GL R    HAAG+VI    L+  
Sbjct: 477  AKSV--EDAVERAPEIRELAEKDETIARLIKIAKRLQGLARQTGVHAAGVVIAPETLTDY 534

Query: 543  VPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLI 601
            +P+ +  +     TQ++M  +E  GL+K DFLGLKTLT++ +++  + +R  V++  + +
Sbjct: 535  IPLAK-SKDGDITTQYDMGQVEALGLLKMDFLGLKTLTIIDRTIKLIKERHGVEIVPTKL 593

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV-- 659
            P DD ET+ LL +  T+G+FQLES GMR  ++ ++P   EDIIALV+LYRPGP+++ +  
Sbjct: 594  PLDDPETFKLLQSGNTVGVFQLESRGMRNLMKRLKPSVFEDIIALVALYRPGPLNSGMAE 653

Query: 660  VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGK 719
             Y  RK+G+E++  I P ++P+LKET G+ IYQEQ+MQIA +L+GYSL EAD+LRRAMGK
Sbjct: 654  SYIRRKHGQEEVDYIFPELEPVLKETYGLFIYQEQIMQIANILAGYSLGEADLLRRAMGK 713

Query: 720  KIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWM 779
            K KE M++Q+  F+S A + G  +     +F+ +AKFA+YGFNKSH+AAY  ++Y TA++
Sbjct: 714  KKKEIMEEQRSIFVSRAVERGYPREKIEKLFDDIAKFAEYGFNKSHSAAYGFLAYVTAYL 773

Query: 780  KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSL 839
            K HYP E  A  M+++ D  ++I KF +D ++  I ++PP +N     F++    I + L
Sbjct: 774  KAHYPKELFATMMSIDFDKTDEIVKFIKDCKENGINVLPPDINRSGAYFEIEGEAIRFGL 833

Query: 840  AAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSR 898
            A IKGVG   A HI E   +   F  L DFC RVD K +NR+V+E+L+ AGA D  G +R
Sbjct: 834  AGIKGVGEKAALHIEEVRKEGGEFKDLFDFCRRVDLKVVNRKVIEALIKAGAFDSTGINR 893

Query: 899  MQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRV 958
               L +LD     AQ ++K+++    ++F   +     ++   +       V+ E E++ 
Sbjct: 894  ASNLAALDRAMNAAQSIQKSQSKGLLSLFGEAESIV--QVEFPEVEEWPERVKLEYERQA 951

Query: 959  LGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWV 1018
            +GFY SGHPL  +K I+  +      E      G  + LA  +   + ++T++G     V
Sbjct: 952  IGFYLSGHPLLEFKEIVT-LAFDSTAEKEEWKDGQELTLAGAITDVKLRRTQRGDLWATV 1010

Query: 1019 TFSEPAKEYEANFFP 1033
              ++         FP
Sbjct: 1011 ELTDLDGSTSVLVFP 1025


>gi|148264552|ref|YP_001231258.1| DNA polymerase III, alpha subunit [Geobacter uraniireducens Rf4]
 gi|146398052|gb|ABQ26685.1| DNA polymerase III, alpha subunit [Geobacter uraniireducens Rf4]
          Length = 1157

 Score =  857 bits (2214), Expect = 0.0,   Method: Composition-based stats.
 Identities = 415/1039 (39%), Positives = 624/1039 (60%), Gaps = 20/1039 (1%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            + ++ +FVHL +H+ YSLL+GA+ L +++ K    + PA+AITD  ++F A+EF  K   
Sbjct: 1    MSEA-NFVHLHLHTQYSLLDGAIRLGDLVKKAKGYEMPAVAITDHGSMFGAIEFYTKCKD 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GI+PIIG ++ I         +       +   ++LL    +GY+ L  LVS  Y  + 
Sbjct: 60   KGIKPIIGSEVYIAPGSRFSKESGNGHESTSSYHLILLCENLQGYKNLSWLVSAGY-KEG 118

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                 RI    L +  +EGLI L+    G +      N  + A      + ++F DR Y+
Sbjct: 119  FYYKPRIDKEILAQ-HSEGLIALSACLKGEVAYQCGRNRVEDAIATARWYSEIFPDRYYI 177

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             LQ +   ++     +++ LA    LPLVATN+  +L+ ED +AH+VL+ +     ++  
Sbjct: 178  ELQENTLPEQDLVNKRLLDLAAELSLPLVATNDCHYLNREDAKAHEVLLCIQTGKTMNDP 237

Query: 244  DRPRVT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
            +R   +  + Y K+  EM + F   PEA+ NTV IA RC+  L       P++I+     
Sbjct: 238  NRMHFSAEEFYFKSPQEMAAAFHYAPEAIANTVRIAERCNLELDFKTYHFPQYIKP---- 293

Query: 303  IQKEEENELRNKAVAGLEVR----LAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFL 358
              K  ++ L  ++  GL+ R     A+         Q Y +RL  EL+ I +M F GYFL
Sbjct: 294  ADKTLDDVLEEQSYEGLKERLVTVRAKYPDITPEQEQGYYERLRIELDCIKQMGFPGYFL 353

Query: 359  IVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDF 418
            IVADFI WAK + IPVGPGRGS AGS+ AY++ ITDIDP+ ++LLFERFLNP+R+SMPD 
Sbjct: 354  IVADFINWAKDHGIPVGPGRGSAAGSLVAYSIRITDIDPIPYNLLFERFLNPERISMPDI 413

Query: 419  DIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKL 478
            D+DFCQDRR+EVI+YV  KYG ++V QIITFG++ A+  LRDVGRAL M Y  VD++ KL
Sbjct: 414  DVDFCQDRREEVIQYVTEKYGRDKVCQIITFGTMAARGVLRDVGRALDMAYGDVDKIAKL 473

Query: 479  IPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRP 538
            +P      +    +  + +  E   AD  V  LL+++  LEGL RHASTHAAG+V+    
Sbjct: 474  VPEVLGITLDKA-LQQEPKLNELAAADRRVKELLDVALCLEGLARHASTHAAGVVVAPDV 532

Query: 539  LSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVD 597
            L +  P+Y+D ++    TQ++MK++EK GL+KFDFLGLK LT++  ++  +   +    D
Sbjct: 533  LEEFCPVYKDQKNGSITTQYSMKYVEKIGLVKFDFLGLKNLTVIHNAVKIIRAGKDPAFD 592

Query: 598  LSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDN 657
            ++L+  DD E+Y LL +  T G+FQLESSGM+  L  ++P C EDIIA+ +LYRPGP+ +
Sbjct: 593  ITLLRDDDEESYRLLQSGNTTGVFQLESSGMQGLLVKLKPSCFEDIIAVCALYRPGPLGS 652

Query: 658  IV--VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRR 715
             +   + +RK+GK+K+V   P ++P+LK+T GVI+YQEQVMQI++ L+GYSL +AD+LRR
Sbjct: 653  GMVDDFIDRKHGKKKVVYDLPQLEPILKDTYGVIVYQEQVMQISRTLAGYSLGQADLLRR 712

Query: 716  AMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQ 775
            AMGKK  E M K+K  F++GA + GI    A +IF+L+AKFA+YGFNKSH+AAYA+++YQ
Sbjct: 713  AMGKKDPEVMAKEKIPFLAGAKEQGIDPKKAESIFDLMAKFAEYGFNKSHSAAYALVAYQ 772

Query: 776  TAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRI 835
            TA++K HYPVEF+AA +T +M N +K+ K   D R   I+++PP +N     F+V    I
Sbjct: 773  TAYLKAHYPVEFMAALLTEDMGNTDKVIKNISDCRDMGIEVLPPDINASDHSFRVLGKSI 832

Query: 836  YYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFG 895
             + L A+K VG +    I+E+     F  + DFC RVD +++N+RV+ESLV  GA D  G
Sbjct: 833  RFGLGAVKNVGESAIEAIIESRKSGSFADIYDFCERVDLRRVNKRVVESLVKCGAFDSTG 892

Query: 896  YSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEK---GTFSDKITLEKFSVENSSVRF 952
              R  L+ +L++     Q +++ R +   ++F   +   G  + K +L      +  +  
Sbjct: 893  ARRAPLMAALEDAMVLGQKIQQERDSAQVSLFGVAEIVRGNGNGKGSLPDVPEWDDKLLL 952

Query: 953  ENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKG 1012
              E+  LGFY +GHPLD Y   +++       +         ++L  +VV+K++  T+KG
Sbjct: 953  NQEKEALGFYITGHPLDRYSSQIKRFATVHTSDFGEISDRAEVKLCGIVVTKKEFITKKG 1012

Query: 1013 SRIGWVTFSEPAKEYEANF 1031
             R+ +VT  +     E   
Sbjct: 1013 ERMAFVTLEDLHGSVEVVV 1031


>gi|222056375|ref|YP_002538737.1| DNA polymerase III, alpha subunit [Geobacter sp. FRC-32]
 gi|221565664|gb|ACM21636.1| DNA polymerase III, alpha subunit [Geobacter sp. FRC-32]
          Length = 1156

 Score =  857 bits (2214), Expect = 0.0,   Method: Composition-based stats.
 Identities = 418/1037 (40%), Positives = 619/1037 (59%), Gaps = 19/1037 (1%)

Query: 7    KSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAG 66
              P FVHL +H+ YSLL+GA+ L +++ K+   + PA+AITD  N+F A+EF  K    G
Sbjct: 2    SQPDFVHLHLHTQYSLLDGAIRLGDLIKKVKGYEMPAVAITDHGNMFGAIEFYTKCKDKG 61

Query: 67   IQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            I+PIIG ++ I         +       +   +VLL    +GY+ L  LVS  Y  +   
Sbjct: 62   IKPIIGSEVYIAPGSRFSKESGNGHESTSSYHLVLLCQNLQGYRNLSWLVSAGY-KEGFY 120

Query: 127  QSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNL 186
               RI    L E  +EGLI L+    G +      N  + A      + +LF  R Y+ L
Sbjct: 121  YKPRIDKEILAE-HSEGLIALSACLKGEVAYQCGRNRIEDAVATARWYSELFPGRYYIEL 179

Query: 187  QRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDR 245
            Q +   ++     +++++A    LPLVATN+  +L+ ED +AH+VL+ +     ++  + 
Sbjct: 180  QENTLPEQDVANKRLLEVASELSLPLVATNDCHYLNREDAKAHEVLLCIQTGKTMNDPNH 239

Query: 246  PRVT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQ 304
               +  + Y K+  EM + F   PEA+ NTV IA  C F L       P++I+       
Sbjct: 240  MHFSAEEFYFKSPQEMAAAFHYAPEAIANTVRIAESCDFELDFKTYHFPQYIKP----AD 295

Query: 305  KEEENELRNKAVAGLEVR----LAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIV 360
            K  ++ L  +A  GL+ R     A+         + Y  RL  EL+ I +M F GYFLIV
Sbjct: 296  KSLDDVLEEQAYEGLKDRLVAVRAKYPDLTADQEKGYYDRLRIELDCIKQMGFPGYFLIV 355

Query: 361  ADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDI 420
            ADFI WAK + IPVGPGRGS AGS+ AY++ ITD+DP+ ++LLFERFLNP+R+SMPD D+
Sbjct: 356  ADFINWAKDHGIPVGPGRGSAAGSLVAYSIRITDLDPIPYNLLFERFLNPERISMPDIDV 415

Query: 421  DFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIP 480
            DFCQDRR+EVI+YV  KYG ++V QIITFG++ A+  LRDVGRAL M Y  VDR+ KL+P
Sbjct: 416  DFCQDRREEVIQYVTEKYGRDKVCQIITFGTMAARGVLRDVGRALDMSYGDVDRIAKLVP 475

Query: 481  NDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLS 540
                  +    +  + +  E   ADP +  LL+++  LEGL RHASTHAAG+V+    L 
Sbjct: 476  EVLGITLEKA-LQQEPKLNELAEADPRIKELLDVALCLEGLARHASTHAAGVVVAPDVLE 534

Query: 541  QLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLS 599
               P+Y+D ++    TQ++MK++EK GL+KFDFLGLK LT++  ++  +   +    D++
Sbjct: 535  AFCPVYKDQKNGSITTQYSMKYVEKIGLVKFDFLGLKNLTVIHNAVKLIRAGKNADFDIT 594

Query: 600  LIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV 659
            ++  DD ETY LL +  T G+FQLESSGM+  L  ++P C EDIIA+ +LYRPGP+ + +
Sbjct: 595  VLRDDDEETYKLLQSGNTTGVFQLESSGMQGLLVKLKPSCFEDIIAVCALYRPGPLGSGM 654

Query: 660  --VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAM 717
               + +RK+G++K+V   P ++P+LK+T GVI+YQEQVMQI+++L+GYSL +AD+LRRAM
Sbjct: 655  VDDFIDRKHGRKKVVYDLPQLEPILKDTYGVIVYQEQVMQISRVLAGYSLGQADLLRRAM 714

Query: 718  GKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            GKK  E M K+K  F++GA K  I    A  IF+L+AKFA+YGFNKSH+AAYA+++YQTA
Sbjct: 715  GKKDPEVMAKEKIPFLAGAEKQNIDPKKAEAIFDLMAKFAEYGFNKSHSAAYALVAYQTA 774

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            ++KTHYPVEF+AA +T +M + +K+ K   D R   I+++PP +N   + F+V  N I +
Sbjct: 775  YLKTHYPVEFMAALLTEDMGSTDKVIKNISDCRDMGIEVLPPDINASDLSFRVLGNSIRF 834

Query: 838  SLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
             L A+K VG +    I+EA     F  + DF  RVD +K+N+RV+ESL+  GA D  G  
Sbjct: 835  GLGAVKNVGESAIEAILEARKTGSFADIFDFGERVDQRKVNKRVVESLIKCGAFDSTGAK 894

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEK---GTFSDKITLEKFSVENSSVRFEN 954
            R  L+  L++     Q +++ R +   ++F  E+   G  + K +L      +       
Sbjct: 895  RAPLMAGLEDAMSLGQKIQQERESAQVSLFGVEEMTRGNGNGKGSLPDLPEWDDKFLLNQ 954

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSR 1014
            E+  LGFY +GHPLD Y   +R+       +         +++  +VV+K++  T+KG R
Sbjct: 955  EKEALGFYITGHPLDRYSAQIRRFASVHTSDFAEIKDKAEVKICGIVVAKKEFITKKGDR 1014

Query: 1015 IGWVTFSEPAKEYEANF 1031
            + +VT  +     E   
Sbjct: 1015 MAFVTLEDLHGTVEVVV 1031


>gi|121534258|ref|ZP_01666082.1| DNA polymerase III, alpha subunit [Thermosinus carboxydivorans Nor1]
 gi|121307028|gb|EAX47946.1| DNA polymerase III, alpha subunit [Thermosinus carboxydivorans Nor1]
          Length = 1129

 Score =  856 bits (2212), Expect = 0.0,   Method: Composition-based stats.
 Identities = 402/1031 (38%), Positives = 610/1031 (59%), Gaps = 27/1031 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL VH+ YSLL+GA  + +++ +      PA+AITD  N++  ++F ++A AAGI+P
Sbjct: 2    SFVHLHVHTEYSLLDGASRIKHLVCRAKELGMPALAITDHGNMYGVIDFYKQARAAGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +   + T            +VLL  T +GY+ LIELVSR    +      
Sbjct: 62   IIGCEVYVAPRSRWEKTA---VEGEAYYHLVLLAETDQGYRNLIELVSRAN-SEGFYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDR-LYVNLQR 188
            R+    L+   + GLI L+G  +G I         + AE     ++ +FG R  ++ LQ 
Sbjct: 118  RVDKELLRTY-STGLICLSGCIAGEIPALLLKGDFEGAEALAHEYRDIFGPRNFFLELQD 176

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++    +Q+  LA    L LVATN+  ++ + D E HDVL+ +     V    R R
Sbjct: 177  HNLPEQKQVNAQLALLADKLGLGLVATNDIHYVDKGDAECHDVLLCIQTGKTVDDSGRMR 236

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                + YLK+ +EM ++F   P+A+ NT+ IA RC   ++     LP F           
Sbjct: 237  FPNNEFYLKSPAEMAALFGWRPDAITNTLVIAERCQVSIEFGKLHLPEFPVPAG----LT 292

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
             +  LR      L  R   G            +RL++EL VI +M +S YFLIV DF+ +
Sbjct: 293  ADEYLRRLCFERLPRRYPTGTAQAT-------ERLEYELAVIQKMGYSSYFLIVWDFVNF 345

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+  +IPVGPGRGS AGS+ +Y L IT+IDPL++ LLFERFLNP+R++MPD DIDFC +R
Sbjct: 346  ARSRDIPVGPGRGSAAGSIVSYLLGITNIDPLKYGLLFERFLNPERVTMPDIDIDFCYER 405

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R ++I YV  +YG + VAQIITFG++ A+AA+RDVGRAL +PY +VDR+ KLIP +    
Sbjct: 406  RGQIIDYVAKRYGADHVAQIITFGTMAARAAVRDVGRALNLPYGEVDRIAKLIPTELGTT 465

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+   +  RE    D  V +LL+++  +EGL RHASTHAAG+VI    L+Q VP+ 
Sbjct: 466  L-QRALEVSTELRELYETDDKVRKLLDLAMAVEGLPRHASTHAAGLVIAKEKLTQYVPLQ 524

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDD 605
                     TQ++   +E+ GL+K D LGL+TLT++  +L+ + + RG+++D+  IP DD
Sbjct: 525  N-STEGFVTTQYDKDRVEEIGLLKMDLLGLRTLTVIGDTLELVRKSRGIRLDIDAIPLDD 583

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNN 663
             +T  LL    TLG+FQ+ES+GM   ++ ++P+  +D+I LV+LYRPGP+ + +   +  
Sbjct: 584  AKTCQLLANGETLGVFQMESAGMTNLVKELKPERFDDLIPLVALYRPGPLGSGMVADFIA 643

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
             ++GK+++   HPL++P+LKET GVI+YQEQVMQIA +++G++L +AD+LRRAMGKK  E
Sbjct: 644  GRHGKKEVQYPHPLLEPILKETFGVILYQEQVMQIASVMAGFTLGQADLLRRAMGKKKHE 703

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             ++ Q++ F+ GA++ GI    A NIFEL+A FADYGFNKSH+AAYA+++YQTA++K HY
Sbjct: 704  VLEAQRDNFMRGAAERGIDSATAANIFELMAHFADYGFNKSHSAAYALVAYQTAYLKAHY 763

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            P EF+AA +T  M   EK+  + ++ R+  I ++PP +N    +F V    I + LA +K
Sbjct: 764  PQEFMAALLTSVMGANEKVGLYIEECRRLGIPVLPPDINASRENFTVDGQAIRFGLAGVK 823

Query: 844  GVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG     +I+ A  +   F SL DFC+RVD + +N+RV+ESL+  GA D  G+ R QLL
Sbjct: 824  NVGDAAIANIIAARDSGGKFTSLVDFCTRVDMRTVNKRVIESLIKCGAFDSLGWRRSQLL 883

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFY 962
              LD   + A   +++  +    +F+ E    +D I                E+ + GFY
Sbjct: 884  AILDQAVEAAASRQRDLASGQMGLFSDETVNSADDIVPPPLEELPKEQLLAMEKEMTGFY 943

Query: 963  FSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSE 1022
             +GHPLD Y+  L        +E +    G  + +A ++   ++  T+ G  + + T  +
Sbjct: 944  VTGHPLDKYRDQLNNY--TKIDELMQYADGQTVCIAGLIAGAKRITTKGGEMMCFATLED 1001

Query: 1023 PAKEYEANFFP 1033
               + E   FP
Sbjct: 1002 FTNQVEVVIFP 1012


>gi|258514118|ref|YP_003190340.1| DNA polymerase III DnaE [Desulfotomaculum acetoxidans DSM 771]
 gi|257777823|gb|ACV61717.1| DNA polymerase III, alpha subunit [Desulfotomaculum acetoxidans DSM
            771]
          Length = 1145

 Score =  856 bits (2212), Expect = 0.0,   Method: Composition-based stats.
 Identities = 395/1034 (38%), Positives = 612/1034 (59%), Gaps = 26/1034 (2%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
            PSFVHL VH+ YSLL+GA  +  ++ K  +    A+AITD   +F  ++F +     GI+
Sbjct: 2    PSFVHLHVHTEYSLLDGAARIKEVVKKAKSLGMSALAITDHGVMFGVVDFFKACKKEGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PI+GC++ +  +     T +       +  +VLL     GY+ L+ LVS  +  +     
Sbjct: 62   PILGCEVYVAPRSRHDRTPR---VDDNLYHLVLLAKNETGYRNLLNLVSISFT-EGFYYK 117

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQ 187
             R+    L    +EGLI L+G  +G +      +  + A      + K+FG D  Y+ +Q
Sbjct: 118  PRVDKEVLAMY-SEGLIALSGCIAGEVAEYILKDLPEQARAAAAEYLKIFGEDNYYLEIQ 176

Query: 188  RHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
             H   ++ +   ++V+++    +PLVATN+  ++++E+ E  DVL+ +     V    R 
Sbjct: 177  DHSFPEQKKANRELVKISEELNIPLVATNDVHYVAKENAEMQDVLLCIQTGKTVDDPKRM 236

Query: 247  RV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
            +  + + YLK+  EM  +F +LP+AL+NTV IA +C   ++     LP +   E      
Sbjct: 237  KFQSQEFYLKSPEEMAELFPELPQALQNTVSIADKCEISMEFGQLHLPFYQVPEG----H 292

Query: 306  EEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
              E+ LR     GL  R            +  RQR++FEL+VI +M +S YFLIV DFI 
Sbjct: 293  TVESYLRELCEKGLLDRYG------AAPEESVRQRMEFELSVIEQMGYSAYFLIVWDFID 346

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            +A++N +PVGPGRGS AGS+ +Y L IT++DPL++ LLFERFLNP+R+SMPD DID C +
Sbjct: 347  YARQNGVPVGPGRGSAAGSLVSYVLGITNLDPLKYDLLFERFLNPERVSMPDIDIDICYE 406

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RR++VI YV  KYG ERVAQI TFG++ AK A+RDVGRAL M Y +VDR+ KL+P +   
Sbjct: 407  RRNKVIEYVVRKYGAERVAQIATFGTMAAKGAIRDVGRALAMSYGEVDRVAKLVPAELHM 466

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
             +  +A++++    EA   +P V RL++ ++ LEG+ RHASTHAAG+VI  +PL+  +P+
Sbjct: 467  TIE-KALSENQDLLEAYNNEPEVRRLIDTAKGLEGMPRHASTHAAGVVITKQPLTHYLPL 525

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKV-DLSLIPFD 604
            Y+        TQF  + +E+ GL+K D LGL+TLT++  ++  + +R     D+  I  +
Sbjct: 526  YK-STDGPVTTQFAKEPVEELGLLKMDLLGLRTLTVIADAVAEVNKRAGSPLDIDKITLE 584

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYN 662
            D  T+ LL+    +G+FQLESSGMR  L  ++P+  EDI+ALV+LYRPGP+ + +   + 
Sbjct: 585  DKNTFDLLSRGEGIGVFQLESSGMRAILRDLKPEVFEDIVALVALYRPGPLGSGMVDDFI 644

Query: 663  NRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIK 722
              K+G +K+  +HP+++P+LK+T GVI+YQEQVM+I+  L+G+SL EAD+LRRAMGKK  
Sbjct: 645  KNKHGLQKVSYLHPILEPILKDTYGVILYQEQVMRISSDLAGFSLGEADLLRRAMGKKKP 704

Query: 723  EEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTH 782
            E +   + +F+ GA+K  +   +A  +F+L+  FA YGFNKSH+AAYA++SYQTA++K +
Sbjct: 705  EVIAGLRSQFMEGAAKKDVDPEVAGKVFDLMEFFAGYGFNKSHSAAYALVSYQTAYLKAN 764

Query: 783  YPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAI 842
            YP EF+AA +T   DN +K+  + ++ R+  I ++PP VN     F V  ++I + LAA+
Sbjct: 765  YPAEFMAALLTSVRDNSDKVAVYIEECRRMGIVVLPPDVNESRDGFTVVGDKIRFGLAAM 824

Query: 843  KGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            K VG      I+       PF +  DFC+R+D++ +NRRVLESL+  GA D  G+ R QL
Sbjct: 825  KNVGLAAVYSIISMREQGGPFKNYADFCNRLDTRVVNRRVLESLIKGGAFDSLGHRRAQL 884

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKIT--LEKFSVENSSVRFENEQRVL 959
            +  +D     AQ  +++R +   ++F   +      ++  L   +    S     E+  L
Sbjct: 885  MAVVDTGLSIAQQAQRDRNSGQMSLFEFLEEEEEYNLSFVLPDIAEYLYSEMLALEKESL 944

Query: 960  GFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVT 1019
            G Y SGHPL  Y+ +LR+       E      G  + L  ++++ +Q  T+KG  + +V 
Sbjct: 945  GLYISGHPLAEYREVLRQNDTVNAGELPDFTEGETVALGGLIINYKQITTKKGDAMAFVN 1004

Query: 1020 FSEPAKEYEANFFP 1033
              +     E   FP
Sbjct: 1005 LEDLTGVVEVVIFP 1018


>gi|296133826|ref|YP_003641073.1| DNA polymerase III, alpha subunit [Thermincola sp. JR]
 gi|296032404|gb|ADG83172.1| DNA polymerase III, alpha subunit [Thermincola potens JR]
          Length = 1146

 Score =  855 bits (2209), Expect = 0.0,   Method: Composition-based stats.
 Identities = 391/1034 (37%), Positives = 608/1034 (58%), Gaps = 26/1034 (2%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            +  F+HL VH+ YSLL+GA  + +++   A     A+A+TD  ++F  ++F +    AGI
Sbjct: 2    AADFIHLHVHTEYSLLDGAARIRDLVSAAAEKGMKALAVTDHGSMFGVIDFYKACKKAGI 61

Query: 68   QPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQ 127
            +PI+GC++ +  +    M ++          +VLL     GY+ L+ +VS  Y       
Sbjct: 62   KPILGCEVYVAPRS---MDDREPGRDDANYHLVLLAENETGYKNLLHIVSEAYTRG-FYY 117

Query: 128  SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNL 186
              R   + L++  +EGLI L+    G I  A     S  A      ++ +FG    ++ L
Sbjct: 118  KPRTDKAALRK-HSEGLIALSACLGGEIATAIVNGQSDKARAAAREYEDIFGKGNFFLEL 176

Query: 187  QRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDR 245
            Q H   ++     ++V++     +PLV TN+  ++ + D E  DVL+ +     +   DR
Sbjct: 177  QDHGLENQRMVNMELVKIGRELNIPLVVTNDVHYVRKSDAEVQDVLLCIGTGRTMEDADR 236

Query: 246  PRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQ 304
                T + YLK+  EM  +  + PEAL NTV IA RC+         LP ++  E     
Sbjct: 237  MEFGTSEFYLKDAREMALLAGEYPEALANTVNIAARCNVEFDFSQNYLPDYMIPEG---- 292

Query: 305  KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
               E+ LR   + GL+ R            ++ R+RL++EL VI  M F GYFLIV DF+
Sbjct: 293  HTVESYLRQLCLDGLKKRYPNAG-------EEVRRRLEYELQVINDMGFPGYFLIVWDFV 345

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
            ++A++  I VGPGRGS AGS+ AY L IT+IDPL++ LLFERFLNP+R++MPD DIDFC 
Sbjct: 346  RFAREKGILVGPGRGSAAGSLVAYTLGITNIDPLKYDLLFERFLNPERVTMPDIDIDFCY 405

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            ++R+EVIRYV  +YG +RVAQIITFG++ A+AA+RDVGRAL MPY++VDR+ K+IP +  
Sbjct: 406  EKREEVIRYVIERYGADRVAQIITFGTMAARAAIRDVGRALNMPYAEVDRVAKMIPGELG 465

Query: 485  HPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
              +    +      RE    +P V +L+++++ +EG+ RHASTHAAG+VIG  PL++ +P
Sbjct: 466  MTLDKA-LEASPELRELYETEPKVHKLVDMARAIEGMPRHASTHAAGVVIGREPLTRYLP 524

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPF 603
            +YR     +  TQF  + +E+ GL+K D LGL+TLT++  +++ +      ++D+  IP 
Sbjct: 525  LYRSS-DGVVTTQFAKETVEEIGLLKMDLLGLRTLTVIGDAVNIIKHTTGDEIDIDNIPL 583

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VY 661
            DD  TY +L     +G+FQLESSGMR  L+ ++P+ ++DIIALV+LYRPGP+ + +   +
Sbjct: 584  DDRATYEMLGRGDAIGVFQLESSGMRAILKELKPEVLDDIIALVALYRPGPLGSGMVEDF 643

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
              RK+G+ +I  +HP ++P+LK+T GVI+YQEQVM+IA  L+G++L EAD+LRRAMGKK 
Sbjct: 644  IRRKHGQSEIKYLHPALEPILKDTYGVILYQEQVMRIASDLAGFTLGEADLLRRAMGKKK 703

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
             E +   + +FI GA KN I +TIA  IF+L+  FA YGFNKSH+AAYA++SYQTA++K 
Sbjct: 704  PEVIAGLRNQFIEGARKNNIEETIAGQIFDLMEYFAGYGFNKSHSAAYALVSYQTAYLKA 763

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            +YPV ++AA +T    + +K+  + ++ ++  I I+PP +N   V+F V  ++I + LAA
Sbjct: 764  NYPVAYMAALLTSVAGSSDKVAVYIEECKRMGIDILPPDINESLVNFTVVGDKIRFGLAA 823

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            +K VG     HI+   + K F SL DFC R + + + +RV+ESL+  GA D    +R QL
Sbjct: 824  VKNVGRQAIEHIIAVRSKKKFASLLDFCERAEHRVVTKRVIESLIKGGAFDSLTGNRRQL 883

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFENEQRVL 959
            L+ LD   ++A   +K+ +    ++F       +F  ++ L              E+ +L
Sbjct: 884  LEGLDRCLEWAAKRQKDLSTGQISLFDVYEGDSSFGGEVPLPPVPDFPQHELLAMEKEML 943

Query: 960  GFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVT 1019
            G Y SGHPL+ Y+  L +       + V       + +  ++   ++  TR+G  +  + 
Sbjct: 944  GLYISGHPLEQYRRELAEKTTATTAQLVEMQDQEEVVIGGIIAGMRKITTRRGETMLLMN 1003

Query: 1020 FSEPAKEYEANFFP 1033
              +     E   FP
Sbjct: 1004 LEDLVGSVEVIVFP 1017


>gi|95930421|ref|ZP_01313157.1| DNA polymerase III, alpha subunit [Desulfuromonas acetoxidans DSM
            684]
 gi|95133461|gb|EAT15124.1| DNA polymerase III, alpha subunit [Desulfuromonas acetoxidans DSM
            684]
          Length = 1158

 Score =  854 bits (2205), Expect = 0.0,   Method: Composition-based stats.
 Identities = 426/1039 (41%), Positives = 623/1039 (59%), Gaps = 15/1039 (1%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +E + +FVHL +HS YSLL+GA+ + N+++++   + PA+AITD  N+F A+EF  KA A
Sbjct: 1    MEHA-NFVHLHLHSQYSLLDGAIKIPNLIERVKEYKMPAVAITDHGNMFGAMEFYTKATA 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            AG++PIIGC++ +      + +N  +        +VLL     GY+ L  LVS  Y  + 
Sbjct: 60   AGVKPIIGCEVYVAPGRRTEKSN-ARGSSEASYHLVLLCQNKIGYRNLCYLVSTAY-REG 117

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLF-GDRLY 183
                 RI    L E   EGLI ++    G I           A  R     ++F  DR Y
Sbjct: 118  FYYKPRIDWDLLTEY-NEGLIAMSACLGGEIPTLINLGRPDDALARAEQMAQVFDDDRFY 176

Query: 184  VNLQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + LQ +   ++    + ++ ++    LPLVATN+  +L  ED  AH+VL+ +     +  
Sbjct: 177  LELQENGIPEQATANTGLIDISGKLGLPLVATNDCHYLRREDAYAHEVLLCIQTGKTMDD 236

Query: 243  KDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
            + R R      Y++   EM  +FS +P+AL+NTVEIA+RC+          P++ +    
Sbjct: 237  EKRMRFANDGFYVRTPDEMRELFSHVPQALDNTVEIAQRCNLDFDFDTYHFPQYEKPADK 296

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
             + +  E   R+     L++  +          Q Y+ RL+ EL  I  M F GYF+IVA
Sbjct: 297  TLDEVLEEMARDGLEDRLKMIRSLNPDLSAEEEQVYQDRLERELKTIRDMGFPGYFIIVA 356

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DFI WAK ++IPVGPGRGS AGS+ A+A+ ITDIDP+ + LLFERFLNP+R+SMPD D+D
Sbjct: 357  DFINWAKDHDIPVGPGRGSAAGSLVAFAIRITDIDPIPYDLLFERFLNPERISMPDIDVD 416

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FC   R++VI+YVQ +YG   VAQIITFG+L AK  ++DVGRAL MPY +VD+L KL+P 
Sbjct: 417  FCIYGREKVIQYVQEEYGAPNVAQIITFGTLGAKGVIKDVGRALNMPYGEVDKLSKLVPA 476

Query: 482  DPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
                 +   A+  + R +E   +D  V  LL ++  LEGL RHASTHAAG+V+   PL+ 
Sbjct: 477  VLNITLK-DALQQEPRIQEMAKSDVRVKELLNVALSLEGLTRHASTHAAGVVVTPNPLTD 535

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-QRGVKVDLSL 600
             +P+Y D +S   VTQF M ++EK GL+KFDFLGLKTLT++  +L  +   +    DL++
Sbjct: 536  YLPLYTDQKSGGQVTQFPMSYVEKIGLVKFDFLGLKTLTVIDNALRLIHSAKNPDFDLNV 595

Query: 601  IPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVV 660
            I  DD  TY LL+   T G+FQLESSGM++ L  ++P+C EDIIA  +LYRPGP+ + +V
Sbjct: 596  IGDDDEATYELLSHGDTTGVFQLESSGMKELLVKLKPNCFEDIIAACALYRPGPLGSGMV 655

Query: 661  YNN--RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMG 718
             +   RK+G++ IV   P ++P+LK+T GVI+YQEQVM IAQ L+ YSL  AD+LRRAMG
Sbjct: 656  DDFILRKHGQKDIVYDFPQLEPILKDTYGVIVYQEQVMLIAQTLANYSLGGADLLRRAMG 715

Query: 719  KKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            KK  EEM+KQK  F+ GA +N +    A  +F+L+A FA YGFNKSH+AAYA+++Y TA+
Sbjct: 716  KKKPEEMEKQKVLFLKGAKENNLDPKKAEAVFDLMAMFAAYGFNKSHSAAYALVAYHTAY 775

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K HYPVEF+AA +T +M+N +K+ K   + R   I+++PP +N     F V +N + + 
Sbjct: 776  LKAHYPVEFMAALLTEDMENTDKVIKNIAEVRSMGIEVLPPDINASIRSFTVHENAMRFG 835

Query: 839  LAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            L A+KGVGT     I+     D P+DSL DFC RVD  K+N++V+ESL+  GA D  G  
Sbjct: 836  LGAVKGVGTAALDSIIHVREVDGPYDSLNDFCERVDLGKVNKKVVESLIKCGAFDSLGGK 895

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKG---TFSDKITLEKFSVENSSVRFEN 954
            R Q + +L++  +  Q V++ +    E++F  E+    + S    L   +  +  +R  N
Sbjct: 896  RAQYMDALESAMEIGQQVQREKQQGQESLFGMEEMVTRSGSSYGELPDVAEWDDKLRLNN 955

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSR 1014
            E+  LGFY +GHPL  Y   +++         V       +R+  +V  K++  T+KG R
Sbjct: 956  EKEALGFYITGHPLSRYAEDIKRFATCDLSGLVERNDKEEVRVCGIVSGKKELVTKKGDR 1015

Query: 1015 IGWVTFSEPAKEYEANFFP 1033
            + ++T  +     E   FP
Sbjct: 1016 MAFITLEDLTGSLEVVVFP 1034


>gi|258593588|emb|CBE69929.1| DNA polymerase III, alpha subunit [NC10 bacterium 'Dutch sediment']
          Length = 1146

 Score =  853 bits (2203), Expect = 0.0,   Method: Composition-based stats.
 Identities = 429/1034 (41%), Positives = 618/1034 (59%), Gaps = 24/1034 (2%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL VH+ YSLL+GA SL  ++ K    + PA+A+TD  NLF A++F   A   GI+
Sbjct: 4    SDFVHLHVHTQYSLLDGACSLETLVAKAKEYKMPALAMTDHGNLFGAIDFYTLAMKEGIK 63

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIG ++ I      + +NQ  + +     I LL     GY+ L++LVS  YL +     
Sbjct: 64   PIIGSEVYIAPGSRFEKSNQD-SGYEGASHITLLAKDQVGYRNLMKLVSAGYL-EGFYYK 121

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQ 187
             RI      +   +GLI L+G  +    +A        A++ +  +    G +  ++ +Q
Sbjct: 122  PRIDRELFAQ-HCQGLIALSGCLNSEAAKALLDGDEARAKETVGWYMDALGRENYFLEVQ 180

Query: 188  RHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
             H   ++      V++LA   +LP+VATN+  + S+ED  AH+VL+ +     +  KDR 
Sbjct: 181  NHGIAEQKTVTDGVLRLAKAFDLPIVATNDLHYPSKEDARAHEVLLCIQTGKTIQDKDRW 240

Query: 247  RVTPDHYLKN-RSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
            R + D +     +EM  IF++LPEA+ NT+ +A RC+  LQ     LPR+   E     +
Sbjct: 241  RFSTDQFYFKSAAEMKQIFAELPEAVRNTITVAERCNLQLQFGQLRLPRYQVPEG----Q 296

Query: 306  EEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
              E+ L + A  GL++R     +       +   RL +EL+VI +  FSGYFL+V DFI+
Sbjct: 297  TLESYLAHLAWEGLKIRYPDANV-------EVEARLKYELDVIQKTGFSGYFLVVWDFIK 349

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            +AK   I VGPGRGS A S+ AY L IT+IDPLR+ L+FERFLNP+R+SMPD DIDF  D
Sbjct: 350  FAKDRGISVGPGRGSAAASLVAYCLNITNIDPLRYGLIFERFLNPERISMPDMDIDFSDD 409

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RRDEVI YV  KYG + VAQIITFG++ AKA +RDVGR L MPY++VD++ KL+PN    
Sbjct: 410  RRDEVIEYVTRKYGADNVAQIITFGTMGAKAVIRDVGRGLGMPYAEVDKIAKLVPNRINI 469

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
             +    IA+     EA      V  L ++++ LEGL RHASTHAAG+VI   PL++ VP+
Sbjct: 470  SLDEA-IAESPPLTEAVQNRTEVGELWQVAKCLEGLTRHASTHAAGVVISGDPLTEHVPL 528

Query: 546  YRDVRSD-LPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPF 603
            Y+D ++   P TQ+ MK IEK GL+K DFLGL+TLT++  +L+ +A  RG K+ +  IP 
Sbjct: 529  YKDPKAGSKPTTQYAMKAIEKIGLLKVDFLGLRTLTVIANTLELIASGRGDKITIEKIPL 588

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNN 663
            DD   + LL+   T G+FQLESSGMR  +  ++P+ +ED+IALV+LYRPGP+  I  + N
Sbjct: 589  DDPAVFSLLSEARTFGVFQLESSGMRDLMRRLKPERLEDVIALVALYRPGPMVMIDDFIN 648

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RKNGK KI   HPL++ +LKET G+++YQEQVM+IA  L+G+S+ EADVLR+AMGKK  E
Sbjct: 649  RKNGKVKIRYDHPLMETILKETYGIMVYQEQVMRIASDLAGFSMGEADVLRKAMGKKDPE 708

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             MD+Q+++F+ GA   G+    A  IF+ +A FA Y FNK HA +YA+++YQTA++K HY
Sbjct: 709  MMDQQRKKFVDGAKVKGVQARTAEKIFDKMAPFAGYAFNKPHATSYALLAYQTAYLKAHY 768

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEF+AA +T EM + + I K+  + +Q  I ++PP VN     F V   +I + L AIK
Sbjct: 769  PVEFMAALLTSEMADTDGIVKYIDECKQMGITVLPPDVNESESRFTVVGEQIRFGLVAIK 828

Query: 844  GVGTTTARHIME-ASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG T  + I+       PF SL DFC RVD +  N+RV+ESL+  GA D  G +R QL+
Sbjct: 829  NVGETAIQSILATRRDKGPFRSLFDFCERVDLRLTNKRVIESLIKCGAFDSLGAARAQLI 888

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEK---GTFSDKITLEKFSVENSSVRFENEQRVL 959
               D   +     ++ R++   ++    +   G       L      + + R   E+  L
Sbjct: 889  AVADKAMEAGAGTQRERSHGQGSLLDVLEATGGLSQQAEALPAIPEWSPTQRLAAEKETL 948

Query: 960  GFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVT 1019
            GFY +GHPL  Y+ ++ K+G    +   A      + L A+V + ++  T+ G R+ +VT
Sbjct: 949  GFYVTGHPLADYRDVIAKVGAVTTDRLAACQDKETVTLCAIVSAVKEITTKSGDRMAFVT 1008

Query: 1020 FSEPAKEYEANFFP 1033
            F + A   EA  FP
Sbjct: 1009 FEDMAGTVEAVAFP 1022


>gi|302392623|ref|YP_003828443.1| DNA polymerase III catalytic subunit, DnaE type [Acetohalobium
            arabaticum DSM 5501]
 gi|302204700|gb|ADL13378.1| DNA polymerase III catalytic subunit, DnaE type [Acetohalobium
            arabaticum DSM 5501]
          Length = 1129

 Score =  852 bits (2202), Expect = 0.0,   Method: Composition-based stats.
 Identities = 397/1034 (38%), Positives = 613/1034 (59%), Gaps = 30/1034 (2%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL  H+ YSLL+GA  +  ++ + A    PA+AITD  N++ A+EF + A  AGI+
Sbjct: 2    SGFVHLHCHTEYSLLDGAARIGELVTQAADYGMPALAITDHGNMYGAVEFYKAAKDAGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIG ++ +  +      NQ      +   +VLL    +GY+ L++LVS+ YL +     
Sbjct: 62   PIIGSEVYVAPESRF---NQKHNRADSPYHLVLLAKNNQGYRNLLKLVSKGYL-EGFYYK 117

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDR-LYVNLQ 187
             +I L  L++   EGLI L+G  +G I R       Q  ++ + T++ +FG+   Y+ LQ
Sbjct: 118  PQIDLELLRKY-NEGLICLSGCLAGRIARGLLNEQQQQVKEMISTYQDIFGENDFYLELQ 176

Query: 188  RHRGY-DRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
                  ++     +++L    ++PLVATN+  +L++ED +AHDVL+ +    +++ +DR 
Sbjct: 177  DQGLRKEKIINHSLIELGEEMDVPLVATNDVHYLNQEDAQAHDVLLCIQTGKLLTTEDRM 236

Query: 247  RV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
            +    + YLK+  EM  IFS++P+A+ENTVEIA+RC+  L      LP +   E    +K
Sbjct: 237  KFPNDEFYLKSGQEMADIFSEVPQAIENTVEIAKRCNVELDFDQTYLPYYDVPE----EK 292

Query: 306  EEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
               + LR   + G            G    + ++RLD+EL +I  M +  YFLIV DFI+
Sbjct: 293  NLSSYLRELCLKGARK-------RYGEVTDEVQERLDYELEIINEMGYPAYFLIVWDFIE 345

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            +AK+  I VGPGRGS AGS+ +Y L ITDIDPL   L+FERFLNP R+SMPD DIDFC  
Sbjct: 346  YAKEKGIMVGPGRGSAAGSLVSYVLGITDIDPLEHGLIFERFLNPQRVSMPDIDIDFCYQ 405

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RRDEVI YV  KYG +RVAQIITFG++ A+A +RDVGR L + Y+QVD++ KLIP D   
Sbjct: 406  RRDEVIDYVTEKYGQDRVAQIITFGTMAARAVVRDVGRVLDLSYAQVDKIAKLIPFDA-- 463

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
                +A+      ++       +  L++ +QKLEGL RHASTHAAG+VI    L++  P+
Sbjct: 464  -DLDEALESSQELKDLCQKKDEIKELIDYAQKLEGLPRHASTHAAGVVISKEELTEYTPL 522

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKV-DLSLIPFD 604
             ++       TQ+ M  +E  GL+K DFLGL+TLT++  +L+ + +      DL  IP D
Sbjct: 523  QQN--KGEVTTQYPMGDLEAIGLLKMDFLGLRTLTVINNTLEIIERTQGIKLDLDEIPLD 580

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYN 662
            D +TY LL T  T G+FQ+ES+  ++ +  ++P   ED+IAL++L RPGP+ + +   + 
Sbjct: 581  DEQTYQLLQTGNTEGLFQIESNLFQRLIADLKPTRFEDLIALLALGRPGPLGSGMVDDFI 640

Query: 663  NRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIK 722
             R++G+ ++   H  ++ +L+ET GVI+YQEQVM+IA  ++GYSL EAD+LRR MGKK  
Sbjct: 641  KRRHGEAEVEYPHADLEEILEETYGVILYQEQVMRIANEIAGYSLGEADILRRGMGKKKP 700

Query: 723  EEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTH 782
            E + K +++FI GA   G S+ +A  +F+L+  F  YGFNKSH+AAYA +SY+TA++KT+
Sbjct: 701  ELLKKHRQKFIDGALDKGYSEELANELFDLMEYFGGYGFNKSHSAAYAFVSYRTAYLKTY 760

Query: 783  YPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAI 842
            YPVE++AA ++  M N +K+ ++ ++  +  I+++PP VN   V F V  +RI + L A+
Sbjct: 761  YPVEYMAALLSSIMGNSDKVARYIEECNRMGIEVLPPDVNESEVRFTVVGDRIRFGLEAV 820

Query: 843  KGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            K VG      I+ A   +  F+SL DFC +V   K+N+RV+ESL+ AGA D  G  R Q+
Sbjct: 821  KNVGQKAIEEIIRARQEEGAFESLTDFCQKVFLGKVNQRVIESLIKAGAFDSLGAYRSQM 880

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENI--FAHEKGTFSDKITLEKFSVENSSVRFENEQRVL 959
            L  ++++ + A  ++K + N  ++   F +     + ++ L + S  +       E+  L
Sbjct: 881  LTVIEDLYEQAHKIQKEKGNGQQSFGDFLNADEFGNVEVKLPEMSEYSHDQLLAMEREYL 940

Query: 960  GFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVT 1019
            G Y SGHP+D Y+ +L +   +             +R   ++ S  Q  T+ G  + ++ 
Sbjct: 941  GLYISGHPIDKYQDLLAENRFESIVAIKDLADKEEVRFGGIINSINQIITKNGKDMAFLE 1000

Query: 1020 FSEPAKEYEANFFP 1033
              +   + E   FP
Sbjct: 1001 LEDRTGQLEVVVFP 1014


>gi|20808235|ref|NP_623406.1| DNA polymerase III DnaE [Thermoanaerobacter tengcongensis MB4]
 gi|20516832|gb|AAM25010.1| DNA polymerase III alpha subunit [Thermoanaerobacter tengcongensis
            MB4]
          Length = 1148

 Score =  852 bits (2201), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/1050 (36%), Positives = 600/1050 (57%), Gaps = 46/1050 (4%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VH+ YSLL+G+  + +++ K       AIAITD   ++  ++F ++A A GI+PI
Sbjct: 5    FVHLHVHTEYSLLDGSCRIKDLIAKTKELGMKAIAITDHGAMYGVIDFYKEAVAQGIKPI 64

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +  +   +M ++          +VLL     GY+ L+++V+   L +      R
Sbjct: 65   IGCEIYVAPR---RMQDREYGIDDENYHLVLLAKDMTGYKNLMKIVTAASL-EGFYYKPR 120

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +   +L +  +EGLI L+   +G +         + A++  L +  +FG    Y+ LQ H
Sbjct: 121  VDKEFL-KNHSEGLIALSACLAGEVPSLILRGDYEKAKEVALFYDSIFGRGNFYLELQDH 179

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++     ++V+++    +PLVATN+  +L ++D  AH+VL+ +     +  +DR   
Sbjct: 180  GILEQKKVNRELVRMSKETGIPLVATNDVHYLEKKDARAHEVLLCIQTGKTIEDEDRMLF 239

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM  +F+   EA+ENT +IA  C+   + +   LP++   E  D     
Sbjct: 240  PTDEFYLKSPEEMEELFACCKEAIENTEKIAEMCNIEFEFNKTKLPKYDLPEGVDSY--- 296

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               LRN    GL              +Q+   RL++EL+VI +M +  YFLIV DFI++A
Sbjct: 297  -EYLRNLCYEGLYK-------RYKSPSQEVIDRLEYELSVIKQMGYVDYFLIVWDFIKFA 348

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K N I  GPGRGS AGS+ AY L IT++DP++++LLFERFLNP+R+SMPD D DFC +RR
Sbjct: 349  KDNGIMTGPGRGSAAGSLVAYTLGITNVDPIKYNLLFERFLNPERVSMPDIDSDFCYERR 408

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG + VAQIITFG++ A+A +RDVGRAL  PY++VD + K+IP +    +
Sbjct: 409  QEVIDYVVRKYGKDNVAQIITFGTMAARAVIRDVGRALNYPYAEVDEIAKMIPFELGMTI 468

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                +  +   +E    D  V +L++IS+ LEGL RHASTHAAG+VI   PL   VP+ +
Sbjct: 469  DRA-LELNPELKERYEKDERVKQLIDISKALEGLPRHASTHAAGVVISKEPLVNYVPLQK 527

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDDH 606
            +   D  VTQF M  +E+ GL+K DFLGL+TLT+++ +++ + +   + +DL  + +DD 
Sbjct: 528  N--DDSVVTQFPMTTLEELGLLKMDFLGLRTLTVIRDTIEMVKKNKGIIIDLDSLNYDDP 585

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            + Y L++   T G+FQLES GMRQ +  ++P  +EDIIA +SLYRPGP+D I  Y   +N
Sbjct: 586  KVYELISKGETEGVFQLESPGMRQFMTELKPKNLEDIIAGISLYRPGPMDQIPKYLANRN 645

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              EKI   HP++ P+L+ T G ++YQEQVMQI + ++GYSL  AD++RRAM KK  + M+
Sbjct: 646  NPEKIEYEHPILKPILEVTYGSLVYQEQVMQIVRDVAGYSLGRADLVRRAMAKKKMDVME 705

Query: 727  KQKERFISG------------ASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI G            A +NG+ +  A  +F+ + +FA+Y FNKSHAAAYAVI+Y
Sbjct: 706  QERKNFIYGIVDEEGNVVVPGALRNGLDEETANRLFDQMLEFANYAFNKSHAAAYAVIAY 765

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTA++K ++PVEF+AA +   +DN++KI  + Q  ++  I+++PP +N     F V  ++
Sbjct: 766  QTAYLKRYFPVEFMAALLNSFVDNLDKIAFYVQVCKKMGIKVLPPDINESDSYFTVVGDK 825

Query: 835  IYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + L+A+K VG      I+    A   F S+ DF  R+   +LN++ +ESL+ AGA   
Sbjct: 826  IRFGLSAVKNVGINVTEEIVREREARGKFKSVIDFFERMQDSQLNKKAIESLIKAGAFAS 885

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFE 953
             G  R QLLQS D + +  +  + +      ++F   +                 +    
Sbjct: 886  LGVKRSQLLQSYDKLIESVKKAKSSAIEGQISLFEVSEEHKEIDFRFPDVEEYPKNRILS 945

Query: 954  NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV----------ATIRGNNIRLAAMVVS 1003
             E+  LG Y SGHPL+ Y   + K+      +                   + +A ++V+
Sbjct: 946  MEKETLGLYISGHPLEEYLEDIPKITNVTTLDFKINPEDEMFTSKLEDNQEVTIAGVIVA 1005

Query: 1004 KQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K+ K TR  + + +VT  +     E   FP
Sbjct: 1006 KKVKFTRNSNIMAFVTLEDMYGTVEVIVFP 1035


>gi|302037892|ref|YP_003798214.1| DNA polymerase III subunit alpha [Candidatus Nitrospira defluvii]
 gi|300605956|emb|CBK42289.1| DNA polymerase III, alpha subunit [Candidatus Nitrospira defluvii]
          Length = 1150

 Score =  851 bits (2199), Expect = 0.0,   Method: Composition-based stats.
 Identities = 425/1036 (41%), Positives = 621/1036 (59%), Gaps = 22/1036 (2%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            +  FVHL +H+ YSLL+GA  ++ ++ ++ +  QPA+A+TD  N+F A+EF +KA  AG+
Sbjct: 2    ASQFVHLHLHTQYSLLDGANQIDPLMQQVKSFGQPAVAMTDHGNMFGAVEFYRKAKEAGV 61

Query: 68   QPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQ 127
            +PIIGC+  +     L+              ++LL +  +GYQ LI+LVS+ YL +    
Sbjct: 62   KPIIGCEAYMAPGSRLEKN--SHLAHNDYYHLILLATNLKGYQNLIKLVSKAYL-EGFYY 118

Query: 128  SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNL 186
              R+    LQ+   EGLI L+G  SG +           A K    ++++FG D  Y+ L
Sbjct: 119  KPRMDKEILQQ-HHEGLIGLSGCLSGEVAYLIGQKDLAGATKAAGEYREIFGKDNYYLEL 177

Query: 187  QRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDR 245
            Q +    +      ++++    ++PL  TN+  +L +ED   HD+++ +     ++  +R
Sbjct: 178  QANGLEHQRIANDGLLEIHKKLDIPLAGTNDCHYLKKEDSRPHDLMLCLQTGKTINDPNR 237

Query: 246  PRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQ 304
             +  T   Y+K+  + +S F ++P A+ NTV+IA  C+  L ++   LP+F   E     
Sbjct: 238  MKFDTDQLYVKSTEQALSEFKEMPTAVSNTVKIAEACTLDLALNKTYLPQFKVPEG---- 293

Query: 305  KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
               E+ +   A+ GL  RL +   +    A  Y+ RL  E+ VI  M F+GYFLIV D I
Sbjct: 294  YTRESYVEQLALEGLAARLKERPSSIPEIA--YQVRLKEEVAVICSMGFAGYFLIVWDII 351

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
            ++A+   IPVGPGRGS AGS+ AYAL ITD+DPL +SLLFERFLNP+R+S+PD D+DFC 
Sbjct: 352  KFARSRGIPVGPGRGSAAGSLVAYALRITDLDPLVYSLLFERFLNPERVSLPDIDMDFCM 411

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            DRRDEVI YV +KYG + VAQIITFG+++AKAA+RDVGR L+MPY++VDR+ KL+P+D  
Sbjct: 412  DRRDEVINYVIHKYGEDHVAQIITFGTMKAKAAIRDVGRVLEMPYAEVDRIAKLVPDDLK 471

Query: 485  HPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
              +    +  + R +E    D  V  L+ ++Q LEGL RHASTHAAGIVI D+PL++ VP
Sbjct: 472  MTLDKA-LEQEPRLKELVDKDVKVKELMSVAQSLEGLARHASTHAAGIVISDQPLTEHVP 530

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDL---SLI 601
            +Y+  + +  VTQ++M  +EK GL+KFDFLGLKTLT++ ++   + +            +
Sbjct: 531  LYKGPKDE-IVTQYSMGDVEKIGLVKFDFLGLKTLTMIHRAETLVNEVHPDQPPLRVEQL 589

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            PFDD +T+ LL++  T G+FQLESSGMR  L G++PD  EDIIA+++LYRPGP+D I  +
Sbjct: 590  PFDDPDTFALLSSGKTTGVFQLESSGMRDLLMGLKPDRFEDIIAIIALYRPGPMDLIPDF 649

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
              RK GK  I    P ++P+LK+T GVI+YQEQVM IA  ++G+SL +AD+LRRAMGKK 
Sbjct: 650  IKRKQGKIPIAYEMPELEPILKDTYGVIVYQEQVMAIANKVAGFSLGQADILRRAMGKKK 709

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
             EEM+K + +F+ GA +  IS+  A  ++EL+ KFA YGFNKSHAAAYAV+ YQTA++K 
Sbjct: 710  PEEMEKLRVQFLEGAKQKKISEKKADKLYELIQKFAGYGFNKSHAAAYAVVCYQTAYLKA 769

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYP EF+AA MT +M N +KI  +  + R   I ++PP VN    +F V D  I + LAA
Sbjct: 770  HYPTEFMAALMTTDMGNADKIVGYFTECRGLGIPVLPPDVNQSQKNFAVVDQSIRFGLAA 829

Query: 842  IKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQ 900
            IK VG      I+E   +  PF S  D   RVD +KLN+R++E L+ AGA D  G  R Q
Sbjct: 830  IKNVGEGAVEAIIEVRNETGPFRSFFDLFRRVDLRKLNKRMMEGLIKAGAFDSMGGRRSQ 889

Query: 901  LLQSLDNIQKYAQWVEKNRTNKHENIFAHEK---GTFSDKITLEKFSVENSSVRFENEQR 957
             L  LD        ++K R     +IF  +        D+  L      N     + E+ 
Sbjct: 890  YLAVLDQAMDEGMSIQKERALGQTSIFGDDTVGMPQQLDEPALPDVPEWNQGELLKYERE 949

Query: 958  VLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGW 1017
            + GFY S HPL  Y+  ++        +      G  ++L  ++ + +   T+KG R+ +
Sbjct: 950  LTGFYISAHPLARYEAAIQLFANTTTMQIPDVPDGREVKLCGIITAVKSMLTKKGDRMAY 1009

Query: 1018 VTFSEPAKEYEANFFP 1033
            +T  +     E   FP
Sbjct: 1010 ITLEDLHGLVEVIAFP 1025


>gi|302343800|ref|YP_003808329.1| DNA polymerase III, subunit alpha [Desulfarculus baarsii DSM 2075]
 gi|301640413|gb|ADK85735.1| DNA polymerase III, alpha subunit [Desulfarculus baarsii DSM 2075]
          Length = 1152

 Score =  851 bits (2198), Expect = 0.0,   Method: Composition-based stats.
 Identities = 423/1033 (40%), Positives = 633/1033 (61%), Gaps = 17/1033 (1%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            +PSFVHL  H++YSLL+GA+ L  ++ + A     A+A+TD  N+F AL F Q+A  AG+
Sbjct: 2    TPSFVHLHTHTAYSLLDGAIRLPELIKRTAELGMNAVAVTDHGNMFGALNFFQQAKKAGL 61

Query: 68   QPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQ 127
            +PIIGC++ +   D     +  +    T   +VLL    EGYQ L+ LVS  +  +    
Sbjct: 62   KPIIGCEVYVAPGDRRDKEH--RPGHETAFHLVLLCKNLEGYQNLVRLVSAGFT-EGFYY 118

Query: 128  SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYVNL 186
              RI +  L++    GLI L+    G +       +   A        +  G+   ++ L
Sbjct: 119  KPRIDMELLRQ-HNGGLIALSACLGGRVPHYLLRGNIDQALAAAEDMAQTMGEGNFFIEL 177

Query: 187  QRHRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDR 245
            Q H   ++      + ++A    L LV TN+  FL  +D+EAHD+L+ +     ++  +R
Sbjct: 178  QDHGLVEQKQVNPGLREIAQRLGLGLVVTNDCHFLRRQDHEAHDILLCIQTGKTIADAER 237

Query: 246  PRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
              ++P+ Y K+  EM  +F D PEA+ NT++IA RC   + +     P++   E     +
Sbjct: 238  MTMSPELYFKSPEEMALLFPDCPEAMANTMDIAARCDLDIPLGQLRFPQYPLPEG----Q 293

Query: 306  EEENELRNKAVAGLEVRLAQGAIAKGY-HAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
              E++L   A  GLE RLA+            Y++RL++E++V+ +M F+GYFL+V+DFI
Sbjct: 294  SAEDQLTRMARRGLERRLAEMDARGLKFDRDFYKKRLEYEIDVLLQMGFAGYFLVVSDFI 353

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
             WAK   IPVGPGRGS AGS+ AY++ ITD+DP+R+ L+FERFLN +R SMPD D+DFC 
Sbjct: 354  VWAKSQGIPVGPGRGSAAGSLVAYSMRITDLDPIRYGLIFERFLNIERKSMPDIDVDFCY 413

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            +RR EVI+YV  +YG + VAQIITFGS+ A+A +RDVGRA+ +P+  VD++ KL+P    
Sbjct: 414  NRRPEVIQYVTERYGSDHVAQIITFGSMLARAVIRDVGRAMNVPFGDVDQIAKLVPTALG 473

Query: 485  HPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
              +    +  + R  +    +P V +L+ I++ LEGL RHASTHAAG+VIGD PL ++VP
Sbjct: 474  MTLDKA-LEQEPRLAQRIKDEPQVAKLVRIAKSLEGLPRHASTHAAGVVIGDVPLDRVVP 532

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPF 603
            +YR  + +  VTQF+MK +EKAGLIKFDFLGL+TLT++  ++  + Q R    D+  I  
Sbjct: 533  LYRGSQGEC-VTQFDMKCVEKAGLIKFDFLGLRTLTVIDVAVKMIRQGRDPSFDIDAIDM 591

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VY 661
            DD  +Y LL+   T G+FQLESSGM++ L  M+P+  ED+IALV+LYRPGP+++ +   +
Sbjct: 592  DDKASYELLSRGDTTGVFQLESSGMKELLTKMRPEVFEDVIALVALYRPGPLESGMVDDF 651

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
               K+G +K+    P ++P+LKET GVI+YQEQV +IA++L+GYSL E D+LRRAMGKK+
Sbjct: 652  VACKHGAKKVSYPLPQLEPVLKETYGVIVYQEQVQEIARILAGYSLGEGDILRRAMGKKV 711

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
             E M  Q+ERF+SGA  NG+S+  A  IF+L+ KFA YGFNKSH+AAY +I+YQTA++K 
Sbjct: 712  PEVMAAQRERFVSGAKANGVSEKKAGEIFDLMEKFAGYGFNKSHSAAYGLIAYQTAFLKA 771

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            H+P EF+AA +T E+ N +KI     + R  N++++PP +N    +F V D+ I + LAA
Sbjct: 772  HFPHEFMAALLTSEVSNTDKIMLHIAECRDQNLKVLPPDINHSGREFTVDDDAIRFGLAA 831

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            +K VG      I+EA  +KPF+ + DFC RV+  K+NRRV+ESL+  GA D  G  R Q 
Sbjct: 832  VKNVGEGAVDAIIEARQEKPFEDIFDFCERVNLAKVNRRVIESLIKCGAFDSLGAHRAQN 891

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENI-FAHEKGTFSDKITLEKFSVENSSVRFENEQRVLG 960
            + +LD+  +  Q + ++R     N+  A  +   S + T+        +     E+  LG
Sbjct: 892  MAALDDAMEQGQKLGRDRDGGQINMFAAFSEAAASARPTMPDVPPWLEADALTYEKEALG 951

Query: 961  FYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTF 1020
            FY +GHPL  +   ++++G+       A   G ++RLA +    ++K T+KG R+ +V  
Sbjct: 952  FYITGHPLGRFAEDIKRLGVLDSVTVQAAADGMSVRLAGLATEIKEKITKKGDRMAFVRL 1011

Query: 1021 SEPAKEYEANFFP 1033
             +     E   FP
Sbjct: 1012 EDLKGSLELVVFP 1024


>gi|313903425|ref|ZP_07836816.1| DNA polymerase III catalytic subunit, DnaE type [Thermaerobacter
            subterraneus DSM 13965]
 gi|313466246|gb|EFR61769.1| DNA polymerase III catalytic subunit, DnaE type [Thermaerobacter
            subterraneus DSM 13965]
          Length = 1218

 Score =  851 bits (2198), Expect = 0.0,   Method: Composition-based stats.
 Identities = 390/1111 (35%), Positives = 584/1111 (52%), Gaps = 106/1111 (9%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VHS YSLL+GA  +  +  + A    PA+A+TD   ++ A++F +     GI+PI
Sbjct: 4    FVHLHVHSEYSLLDGAARVGELAARAAELGMPALALTDHGVMYGAIDFYKACKKHGIKPI 63

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC+L +  +       +          ++ L     GY+ LI +VSR Y  +      R
Sbjct: 64   IGCELYLARRTRHDREPK---LDDQPYHLLALAQNETGYRNLIRIVSRAY-AEGFYYKPR 119

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHR 190
                 L +  +EGLI+ +G     I R       + A + +  + ++FGDR Y  +Q H 
Sbjct: 120  ADRELLAQY-SEGLIVTSGCIGSEIPRLLLEGREEEALQAVRWYLEVFGDRFYFEIQDHG 178

Query: 191  GYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVT 249
              +  R  +++++LA   ++P+VATN+  +L+++D  AH+VL+ +     +   +R R  
Sbjct: 179  LPEERRAYARILELARRFDVPVVATNDVHYLNKDDAAAHEVLLCIQTGKTLDDPNRMRFE 238

Query: 250  -PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEE 308
             P+ YLK   EM ++F D+PEAL NTV++A RC    +    +LP +   E  D      
Sbjct: 239  GPEFYLKTPEEMAALFRDVPEALANTVKLAERCQLEFEFGRFLLPHYEVPEGHD----AA 294

Query: 309  NELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAK 368
            + LR    + L  R             + R RL+ EL VI RM +  YFLIV DF+ +A+
Sbjct: 295  SYLRYLCESKLPERYPNAGS-------EVRDRLNHELEVITRMGYPAYFLIVWDFVDYAR 347

Query: 369  KNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRD 428
            +N I VGPGRGS AGS+ AY L ITDIDPLR++LLFERFLNP+R++MPD DIDF   RRD
Sbjct: 348  RNGIAVGPGRGSAAGSLVAYVLGITDIDPLRYNLLFERFLNPERVTMPDIDIDFDDHRRD 407

Query: 429  EVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVS 488
            EVI YV  KYG +RVAQIITFG + A+A +RDVGR + +PY +VD++ K++P      + 
Sbjct: 408  EVIEYVVRKYGRDRVAQIITFGRMLARAVIRDVGRVMGLPYGEVDKIAKMVPAQLGITLD 467

Query: 489  LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRD 548
             QA+      ++A    P V +L+++++KLEG+ RHAS HAAG+VIG  PL + VP+ R 
Sbjct: 468  -QALESSPELKQAYDQQPVVRQLVDMARKLEGMPRHASVHAAGVVIGRDPLMEHVPLQR- 525

Query: 549  VRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDHET 608
            ++    VTQF M  +E+ GL+K DFLGL+TL ++Q++   + Q G +  L+  P      
Sbjct: 526  MQDGSTVTQFPMTTLEELGLLKMDFLGLRTLHVIQETEQIIHQTGARDVLAEEPGPAGPG 585

Query: 609  YHL--------------------------------------------LTTKGTLGIFQLE 624
                                                                    F+  
Sbjct: 586  GAGGPAGAGGAGGASGEVGKDGPRGAGGAGGGPGGDGTAARRPFRVRDIPLDDAATFEAM 645

Query: 625  SSGMRQALEGMQPDCI------------EDIIALVSLYRPGPIDNIV--VYNNRKNGKEK 670
            S G   A+  ++                ED+IA V+L+RPGP+ + +   +  RK+G+  
Sbjct: 646  SRGETAAMFQVESSGFTQMLRSLKPSSIEDLIAAVALFRPGPLGSGMVDDFIKRKHGQVP 705

Query: 671  IVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKE 730
            +   HP ++P+LKET G I+YQEQVMQIA +++G++L EAD+LRRAMGKK  EEM KQ+E
Sbjct: 706  VEYPHPWLEPILKETYGTIVYQEQVMQIASVMAGFTLGEADLLRRAMGKKKPEEMQKQRE 765

Query: 731  RFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAA 790
            +F++GA+  GI   +A  IF+L+  FA YGFNKSH+AAY  ++Y TA++KTHYP  ++AA
Sbjct: 766  KFLAGAAAKGIDAELAGRIFDLMEYFAGYGFNKSHSAAYGYLAYVTAYLKTHYPAPYMAA 825

Query: 791  SMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKV-------GDNRIYYSLAAIK 843
            +++  M N +++ ++  + R+  I ++PP VN     F V       G   I + LAA+K
Sbjct: 826  TLSSVMSNSDRVAEYIAECRRLGIPVLPPDVNQSEARFTVVPDPGAPGGQAIRFGLAAVK 885

Query: 844  GVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG      I+ A     PF SL+DFC RVD +++NRR LESL+ AGA D  G  R +L+
Sbjct: 886  NVGFGAIESIVAARQEGGPFRSLDDFCRRVDLRQVNRRALESLIKAGAFDSLGEPRARLV 945

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFS--------------------DKITLEK 942
              L+ +   AQ   K R     ++                             +   L  
Sbjct: 946  AGLEEVMNRAQRWHKERETGQVSLLDLTAALVGAGGRGSGGGGTGAGAAAADLEVTELPP 1005

Query: 943  FSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVV 1002
                  + +   E+ VLG Y SGHPL  Y+  L +       +      G  +++  +V 
Sbjct: 1006 VDEWPPNRKLAMEKEVLGLYLSGHPLAHYQRELARRVTATTRQLADREDGARVQVGGLVQ 1065

Query: 1003 SKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
              ++  TR G  + +V   +     E   FP
Sbjct: 1066 GVRRITTRGGDFMAFVQLEDLEGTVEVVVFP 1096


>gi|260892340|ref|YP_003238437.1| DNA polymerase III, alpha subunit [Ammonifex degensii KC4]
 gi|260864481|gb|ACX51587.1| DNA polymerase III, alpha subunit [Ammonifex degensii KC4]
          Length = 1139

 Score =  850 bits (2196), Expect = 0.0,   Method: Composition-based stats.
 Identities = 407/1035 (39%), Positives = 596/1035 (57%), Gaps = 28/1035 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
             FVHL +H+ YSLL+GA  + +++ +     Q A+AITD   ++  ++F +     GI+P
Sbjct: 2    DFVHLHLHTEYSLLDGAARIKDVVKRAKELGQNALAITDHGVMYGVVDFYKACQEVGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +  +     T +          +VLL    EGY+ LIELVSR +L +      
Sbjct: 62   ILGCEVYVAPRGMTDRTPK---VDDNPYHLVLLAENEEGYRNLIELVSRAFL-EGFYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L +   +GLI L+   +G +         + AE+    ++ +FG D  ++ LQ 
Sbjct: 118  RVDKYLLAQK-AKGLIALSACLAGEVAAHLLAGDFKKAEEAAGEYRDIFGKDNFFLELQD 176

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++      +++LA   ++PLVATN+  ++   D E  D+L+ +     V   DR R
Sbjct: 177  HGLPEQKPVNEGLIKLASRLDIPLVATNDVHYVERADAEVQDLLLCIQTGKSVGDPDRLR 236

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              +   YLK+  EM  +F D P+AL  TVEIA RC   L      LP F   E       
Sbjct: 237  FGSDQFYLKSALEMARLFPDHPDALRATVEIASRCEVKLSFGEYHLPEFPVPEG----HT 292

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
              + LR    AG + R             +  +RL +EL VI RM +  YFLIV D I +
Sbjct: 293  PASYLRELCYAGAKKRYGDPL------PPEVEERLAYELQVIERMGYPPYFLIVWDVIHF 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A++N I VGPGRGS AGS+ AY L IT+IDPL++ LLFERFLNP+R+S+PD D DFC + 
Sbjct: 347  ARRNGIMVGPGRGSAAGSLVAYCLGITNIDPLKYGLLFERFLNPERVSLPDIDTDFCFEM 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            RD+V+ YV  +YG +RVAQI TF  L A+AA+RD GRAL M Y++VDR+ +L+P +P   
Sbjct: 407  RDKVLEYVVRRYGADRVAQIATFAQLSARAAIRDAGRALGMSYAEVDRVARLVPGEPGMT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            V  +A+ +    +E    + SV +LL+++ KLEG+ RHASTHAAG+VI   PL +LVP++
Sbjct: 467  V-ARALEESPELKELYEKEASVKKLLDVAAKLEGIPRHASTHAAGVVITPEPLIRLVPLH 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
            R +      TQF  + +E+ GL+K D LGL+TLT+++ +L  + +RGVK+DL  IP DD 
Sbjct: 526  R-MPDGTVATQFTKEGVEELGLLKMDLLGLRTLTVIRDTLRHVNRRGVKLDLEKIPLDDP 584

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNNR 664
             T+ LL    T+G+FQLESSGMR  L  +QP C ED+IALV+LYRPGP+ + +   +  R
Sbjct: 585  ATFELLCRGDTIGVFQLESSGMRALLRSLQPSCFEDLIALVALYRPGPLGSGMVDDFIKR 644

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G   I   HP ++P+L+ET GVI+YQEQVMQIA  L+G+SL EAD+LRRAMGKK  EE
Sbjct: 645  KHGLLPIEYPHPWLEPILRETYGVIVYQEQVMQIASRLAGFSLGEADLLRRAMGKKKPEE 704

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            +   + RF+ G+ + G+ + +A  IF+ +  FA YGFNKSH+AAYA+++YQTA++K +YP
Sbjct: 705  LAALRSRFVKGSVERGVDERLAEEIFDRMEYFAGYGFNKSHSAAYALVAYQTAYLKANYP 764

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVG-DNRIYYSLAAIK 843
            VE++AA +T   D  EK+  + ++ R+  I+I PP +N    DF    D  I + LAA+K
Sbjct: 765  VEYMAALLTSVRDRTEKVALYVEECRRLGIKIFPPDINESERDFSPTPDGGIRFGLAAVK 824

Query: 844  GVGTTTARHIM-EASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG      I+       PF    DFC+RV  + LNR+VLESL  AGA    G++R ++L
Sbjct: 825  NVGEGAVEAILQARREGGPFRDFADFCARVGGRALNRKVLESLAKAGAFASLGHTRKEIL 884

Query: 903  QSLDNIQKYAQWVEKNRTNK-HENIF---AHEKGTFSDKITLEKFSVENSSVRFENEQRV 958
            +S+D   K A   +  +       +F       G +  K                 E+ +
Sbjct: 885  ESIDEGLKIANRAKAKKQQGIQICLFQNMEDFGGGYRLKFNRPNGEEFPRRELLRMEKEL 944

Query: 959  LGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWV 1018
            LG Y SGHPL  Y+ +LR +      +         +++  M+V  ++ +TR+G  +  V
Sbjct: 945  LGLYISGHPLAEYRDLLRLLTDVQVADLAEMEEDAEVKVGGMIVGMKRLRTRRGEPMAAV 1004

Query: 1019 TFSEPAKEYEANFFP 1033
               +     EA  FP
Sbjct: 1005 YLEDLTGVVEAVLFP 1019


>gi|51891797|ref|YP_074488.1| DNA polymerase III DnaE [Symbiobacterium thermophilum IAM 14863]
 gi|51855486|dbj|BAD39644.1| DNA polymerase III alpha subunit [Symbiobacterium thermophilum IAM
            14863]
          Length = 1252

 Score =  849 bits (2192), Expect = 0.0,   Method: Composition-based stats.
 Identities = 386/1036 (37%), Positives = 574/1036 (55%), Gaps = 35/1036 (3%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
            P FVHL +H+ YSLL+GA  +  +  + A     A+A+TD   LF  L F +     G++
Sbjct: 29   PEFVHLHLHTEYSLLDGANRIEPLARRAAELGMRAMAMTDHGVLFGVLPFYKAMRNHGVK 88

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC+L +            K+       + +L     GY+ L++LVS  Y  +     
Sbjct: 89   PIIGCELYVAPGSR-----HVKSGGEKPYHLTVLAENYTGYKNLVKLVSAGYT-EGFYYK 142

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQ 187
             R+ L  L     EGLI+L+G  +G + + F     + A + +  ++++FG D  ++ LQ
Sbjct: 143  PRVDLELLNTY-REGLIVLSGCLAGEVAQKFLAGQPEEARRAIGRYREIFGPDHYFLELQ 201

Query: 188  RHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
                 ++   ++ +       LP+VATN++ +L  +D    DVL+ +  +  +   +R R
Sbjct: 202  DLGLPEQQGLNRFL---LEQGLPVVATNDAHYLRPQDARTQDVLICIGTNKTIDDPNRMR 258

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
            + T + Y+K+  EM   F  +P ALEN++ IA RC+  L +    LP +      D    
Sbjct: 259  MGTSELYVKSAEEMYWRFGHVPGALENSLAIAERCNVELPLGQIHLPHYALPPGYD---- 314

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                LR      +      G    G   +   +RL+ ELNVI  M F+GYFLIV DF+++
Sbjct: 315  APGYLRKLCYERI------GPRYGGRPPEGAMERLEHELNVIISMGFAGYFLIVWDFVEF 368

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+   IPVGPGRGSGA S+ AY L ITD+DPLR+ LLFERFLNP+R+ MPDFDIDFC +R
Sbjct: 369  ARSRGIPVGPGRGSGASSLVAYVLGITDVDPLRYGLLFERFLNPERVDMPDFDIDFCYER 428

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV NKYG E VAQ+ITF ++ A+AA+RDVGRAL M Y +VDR+ KL+P   +  
Sbjct: 429  RGEVIEYVHNKYGAECVAQVITFNTMAARAAVRDVGRALGMSYGEVDRVAKLLPWGQS-- 486

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
                A+      R        +  L++ ++ +EG+ R+ S HAAG+VI   PL + VP+Y
Sbjct: 487  -LDAALEKTEELRTLYEEREEIRTLIDTARAVEGMPRNPSVHAAGVVITADPLVEHVPLY 545

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
            + +  D  VTQF+M  +++ GL+K DFLGL+TLT++  ++ F+ Q     D+  IP DD 
Sbjct: 546  K-MGDDSIVTQFDMDQLKEIGLLKMDFLGLRTLTVIDHAVKFVRQYQPDFDIERIPMDDP 604

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            ETY ++    TLG+FQ+E+  +   L  M+P   EDIIA +SL RPGP+++I  Y   K 
Sbjct: 605  ETYAMIARGETLGLFQIEAGWVADVLRQMKPTRFEDIIATISLCRPGPMEHIPDYIAGKQ 664

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
                +  +HP ++P+L ET GV++YQEQ++QIA LL+G SL +AD+LRRA+ KK +E+M+
Sbjct: 665  NPAGVKYLHPDLEPILSETYGVMVYQEQIIQIAHLLAGLSLGQADLLRRAIAKKKREDME 724

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
            K    F+    + G S  +A  +++ + +FA+YGFNK HA  YA ++YQTA++K H+PV 
Sbjct: 725  KYGRLFMEALEQRGYSHEVATALYDQMIRFANYGFNKCHATPYAKVAYQTAYLKRHHPVA 784

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            F+AA M   M    K+  + ++ R+  IQ++PP VNT    F      I + L A+K +G
Sbjct: 785  FMAALMNSVMGQEAKLALYIEECRRLGIQVLPPDVNTSFARFVPDGRTIRFGLGAVKNIG 844

Query: 847  TTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY------SRM 899
                  I+ A  +  PF SL D C RVD + LNRR LESL+ AGA D           R 
Sbjct: 845  WNAVDAIVAAREEGGPFTSLRDLCERVDLRPLNRRALESLIMAGAFDRVAPPGGRPARRS 904

Query: 900  QLLQSLDNIQKYAQWVEKNRTNKHENIF--AHEKGTFSDKITLEKFSVENSSVRFENEQR 957
            Q+L++LD I   AQ ++++R     ++F         + +  L              E+ 
Sbjct: 905  QMLEALDKILDDAQKLQRHRQAGQISLFDLGVAGPGTAGEEPLPDIPEFPPQRLLAMEKE 964

Query: 958  VLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGW 1017
            VLGFY SGHPL  Y+  L   G            G  + +  MV   +Q  TR G+ + +
Sbjct: 965  VLGFYVSGHPLRQYQAALAAHGCLPVAALPEQRDGARVAVGGMVAGLKQVTTRSGANMAF 1024

Query: 1018 VTFSEPAKEYEANFFP 1033
            +T  +   + E   FP
Sbjct: 1025 LTLEDQTGQVEVVVFP 1040


>gi|217967773|ref|YP_002353279.1| DNA polymerase III, alpha subunit [Dictyoglomus turgidum DSM 6724]
 gi|217336872|gb|ACK42665.1| DNA polymerase III, alpha subunit [Dictyoglomus turgidum DSM 6724]
          Length = 1127

 Score =  847 bits (2188), Expect = 0.0,   Method: Composition-based stats.
 Identities = 404/1026 (39%), Positives = 630/1026 (61%), Gaps = 27/1026 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL VH+ YSLL+GA  ++ ++D+  A   PA+AITD   ++  ++F +KA   GI+P
Sbjct: 2    SFVHLHVHTEYSLLDGACRIDELIDQAVAFNMPAVAITDHGVMYGVVDFYKKAIEKGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +          +       +  ++LL    EGY+ LI+LVS  +L +      
Sbjct: 62   IIGCEVYVAPASRFDKKQRTD-----LFHLILLAKDFEGYKNLIKLVSLSFL-EGFYYKP 115

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            R+    L++  ++GL+ L+   +G I      N+ + A+  +  +  +FG+  Y+ LQ +
Sbjct: 116  RVDKDLLRQY-SKGLVALSSCLAGEIPTYILQNNIERAKNAIKEYLDIFGEDFYLELQNN 174

Query: 190  RGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++    + +++LA    +PLVATN+  +L +ED E HD+L+ +   + ++ KDR R 
Sbjct: 175  GMEEQEYVNNYLIRLAKEFNVPLVATNDVHYLRKEDAEIHDILLCIQTGSKLNDKDRLRF 234

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + Y K+  EM+++F D+PEA+ENT +IA RC+  + ++  ILP F   E +      
Sbjct: 235  KTNEFYFKSPDEMINLFKDVPEAIENTFKIAERCNVEIPLNNIILPVFEVPEGE----TL 290

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            ++        G + R  +         Q+ ++RL +E++VI +M FSGYFLIV DF+ +A
Sbjct: 291  DSYFEKLCWEGAKKRFGEN------IPQEIKERLSYEISVIKQMGFSGYFLIVQDFVNYA 344

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K   IPVGPGRGS AGS+ +Y L IT+I+P R+ L+FERFLNP+R++MPD DIDFC +RR
Sbjct: 345  KSKGIPVGPGRGSAAGSLVSYVLGITNIEPTRWGLIFERFLNPERVTMPDIDIDFCFERR 404

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
            +EVI YV+NKYG E VAQIITFG++ A+A++RDVGR L +PY++VDR+ KLI   P +  
Sbjct: 405  EEVIEYVRNKYGREHVAQIITFGTMAARASVRDVGRVLDVPYNEVDRIAKLI---PPNTS 461

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A++     R    ++P   R++EI++++EG  RHAS HAAGIVI   PL + VP+  
Sbjct: 462  IEEALSTSEELRNLVESNPQAKRIIEIAKRIEGNARHASIHAAGIVISKDPLMEYVPLQ- 520

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDDH 606
             +  +  VTQF M  +E+ GL+K DFLGL+TLT++  ++  + +   +++D+S I   D 
Sbjct: 521  VMNGNDVVTQFPMTNLEELGLLKMDFLGLRTLTVIYDTVKKIKENYGIEIDISNISLTDE 580

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            + Y LL    T+G+FQLES GMR  L  ++P+  ED+IA+++LYRPGP+  +  Y  RK 
Sbjct: 581  KVYELLQKGDTIGVFQLESRGMRNLLRDIKPEKFEDLIAVLALYRPGPLGRLESYIKRKR 640

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
            G+EK+  +HP ++P+L ET GVIIYQEQVM+IA  L+G++L +ADVLRRAMGKK  E M+
Sbjct: 641  GEEKVEYMHPALEPILSETYGVIIYQEQVMEIAHKLAGFTLGQADVLRRAMGKKKPEVME 700

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
            +Q+  F+ GA + GI + +AV IFE +AKFA+YGFNKSH+AAYA +S+QTA++K +YP E
Sbjct: 701  EQRGIFVKGAVERGIPEEVAVEIFEDMAKFAEYGFNKSHSAAYAFVSFQTAYLKVYYPKE 760

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            ++A+ +T   +N  K+ K+  +A++  I+I+PP +N   VDF V    I + L+AIK VG
Sbjct: 761  YMASLLTSVKNNTTKLSKYIAEAKRIGIKILPPDINESMVDFTVTPQGIRFGLSAIKNVG 820

Query: 847  TTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLD 906
               A  I+E      F S+ DF  R+ SK +N+R LESL+ +GA D FGYSR  LL ++D
Sbjct: 821  ENVAEAIVEEREKGKFKSIFDFIKRLSSKVINKRTLESLIKSGAFDSFGYSRRALLANID 880

Query: 907  NIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSGH 966
             I + AQ ++K       ++   E     + I        +     + E+ +LGFY S  
Sbjct: 881  KILESAQVIKKAHV-GQVSLIDLEALPQDEFIN--NMPEFSIDEILDMEKEMLGFYVSYD 937

Query: 967  PLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKE 1026
            P +  + +  K+     ++ +    G+ + +  ++ + ++   RK  ++ + T  +   E
Sbjct: 938  PQEELRKLSEKLFDYTIDDLLEIESGSQVVVPGILKNVREVIDRKNQKMLFATLEDFTGE 997

Query: 1027 YEANFF 1032
             E   F
Sbjct: 998  AEITVF 1003


>gi|325295328|ref|YP_004281842.1| DNA polymerase III, alpha subunit [Desulfurobacterium
            thermolithotrophum DSM 11699]
 gi|325065776|gb|ADY73783.1| DNA polymerase III, alpha subunit [Desulfurobacterium
            thermolithotrophum DSM 11699]
          Length = 1147

 Score =  847 bits (2187), Expect = 0.0,   Method: Composition-based stats.
 Identities = 408/1035 (39%), Positives = 615/1035 (59%), Gaps = 19/1035 (1%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +     FVHL +HS YSLL+GA+ + +++ K       A+A+TD  N++++ E  ++  A
Sbjct: 1    MANKGDFVHLHLHSQYSLLDGAIKIKDLVKKAKEYGMSAVAVTDHGNMYASYELYKECTA 60

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GI+PIIG +  I          +G         +VLL     G + L++L S  +L + 
Sbjct: 61   EGIKPIIGQEFYIAKGSRFDR-KKGNEGEKGSYHLVLLAKNEIGLKNLMKLSSIAFL-EG 118

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                 RI    L++  +EGLI L+    G I   +     + A+     +K+LFGD  Y+
Sbjct: 119  FYYKPRIDKEVLEKY-SEGLIALSACIQGEIPVLYLQGKEEEAKNVAKWYKELFGDDFYL 177

Query: 185  NLQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             +Q H   ++ +    +++L+   ++ LVATN++ +L +ED+EAHDVL+ +     +S +
Sbjct: 178  EIQYHGIKEQEKANQFLIKLSKELDIDLVATNDAHYLEKEDWEAHDVLLCLQTGKKLSDE 237

Query: 244  DRPRVT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
            +R R +  + Y K+ +EM+ +F ++P A+ NT+++A +    ++    +LP++       
Sbjct: 238  NRLRFSTKEFYFKDANEMLELFKEVPHAVFNTLKVAEKIDVKIKNTGYLLPKYDVP---- 293

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
                 E+ LR  A  GLE R  +  I  G   Q Y QRL  EL +I+ M F GYFLIV D
Sbjct: 294  PDYTYESYLRELAEKGLERRFKELGITNGEIKQKYYQRLQHELKIISDMGFPGYFLIVWD 353

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI WAKKN IPVGPGRGS AGS+ AYA+ ITDIDPLRF+LLFERFLNP+R++MPD D+D 
Sbjct: 354  FINWAKKNGIPVGPGRGSAAGSLVAYAIGITDIDPLRFNLLFERFLNPERVTMPDIDVDI 413

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQ+ RD VI+YV++KYG ++V QIITFG+++ K  +RDVGR L +P  +VD+  KLIPND
Sbjct: 414  CQEGRDRVIQYVRDKYGEDKVCQIITFGTMKTKMVVRDVGRVLGIPPKEVDKFAKLIPND 473

Query: 483  PAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQL 542
                    AI      +E    + ++ +LL+I+ KL+GL R    HAAG+VI    L++ 
Sbjct: 474  AKS--IEDAIDRAPEIKELAQENETISKLLKIASKLQGLARQTGVHAAGVVIAPDTLTKY 531

Query: 543  VPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLI 601
            +P+ +  +     TQ++M  IE  GL+K DFLGLKTLT++ K++  + +R  +++D   I
Sbjct: 532  IPLAK-SKDGDITTQYDMGQIESLGLLKMDFLGLKTLTIIDKTIKLIKERHGIEIDTRKI 590

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV-- 659
            P DD +T+ LL    T+G+FQLES GMR  +  ++P   EDIIALV+LYRPGP+++ +  
Sbjct: 591  PLDDEKTFKLLQEGNTVGVFQLESQGMRNLMRRLKPSVFEDIIALVALYRPGPLNSGMAE 650

Query: 660  VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGK 719
             Y  RK+G E +  I P ++P LKET G+ IYQEQ+MQIA +L+GYSL EAD+LRRAMGK
Sbjct: 651  SYIRRKHGLEPVDYIFPELEPYLKETYGLFIYQEQIMQIANVLAGYSLGEADILRRAMGK 710

Query: 720  KIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWM 779
            K K+ M++Q+  FI+ A + G  +     +F+ +AKFA+YGFNKSH+AAY  ++Y TA++
Sbjct: 711  KKKDVMEEQRNIFITRAVERGYPREKVEKLFDDIAKFAEYGFNKSHSAAYGFLAYVTAYL 770

Query: 780  KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSL 839
            K HYP E +   ++++ D  ++I K  +D R+  I + PP VN     F +    I + L
Sbjct: 771  KAHYPKELMTTMLSIDYDKTDEIVKLIKDCRENGIPVFPPDVNKSDALFSIEGKGIRFGL 830

Query: 840  AAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSR 898
            A IKGVG   A+HI++    +  F  L DFC RVD K++N++V+ESL+ AGA D  G SR
Sbjct: 831  AGIKGVGEKAAQHIVKIRKENGEFKDLYDFCERVDLKQVNKKVIESLIKAGAFDSTGISR 890

Query: 899  MQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRV 958
               L+ LDN    AQ ++K ++    N+F +E    + +    K       ++ E E++ 
Sbjct: 891  AANLEVLDNAMSVAQSLQKTKSKGLMNLFDNETKIVNKE--FPKVREWPDRIKLEYERQA 948

Query: 959  LGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWV 1018
            +GFY SGHPL  YK I++        E  +   G  ++LA  +     K+T++G     V
Sbjct: 949  IGFYLSGHPLLEYKDIVQ-FSFDLTSEKDSWKDGQEVKLAGAITEVTTKRTQRGDLWATV 1007

Query: 1019 TFSEPAKEYEANFFP 1033
              S+         FP
Sbjct: 1008 EISDLEGTVSILVFP 1022


>gi|307265890|ref|ZP_07547439.1| DNA polymerase III, alpha subunit [Thermoanaerobacter wiegelii
            Rt8.B1]
 gi|306919059|gb|EFN49284.1| DNA polymerase III, alpha subunit [Thermoanaerobacter wiegelii
            Rt8.B1]
          Length = 1145

 Score =  846 bits (2185), Expect = 0.0,   Method: Composition-based stats.
 Identities = 385/1049 (36%), Positives = 603/1049 (57%), Gaps = 45/1049 (4%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VHS YSLL+G+  + +++ K       AIAITD   ++ A++F ++A A GI+PI
Sbjct: 2    FVHLHVHSEYSLLDGSCRIKDLIAKTKELNMKAIAITDHGVMYGAIDFYKEAVAQGIKPI 61

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +  +    M ++          +VLL     GY+ L+++V+   + +      R
Sbjct: 62   IGCEIYVAPRS---MQDREYGIDNENYHLVLLAKDMTGYKNLMKIVTVASI-EGFYYKPR 117

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +   +L+E  +EGLI L+   +G +         + A++  L +  +FG    Y+ LQ H
Sbjct: 118  VDREFLKE-HSEGLIALSACLAGEVPSYILRGEYEKAKEAALFYDSIFGRGNFYLELQDH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP-R 247
               ++     ++++L+    +PLVATN+  +L ++D +AH+VL+ +     +  +DR   
Sbjct: 177  GILEQQKVNKELIRLSKETGIPLVATNDVHYLEKKDAKAHEVLLCIQTGKTIDDEDRMSF 236

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM ++FS   EA+ENT +IA  C+   + +   LP++   E  D     
Sbjct: 237  PTDEFYLKSPEEMENLFSCCKEAIENTEKIADMCNVEFEFNKTKLPKYDLPEGVDSY--- 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               LRN    GL  R           +++  +RLD+EL+VI +M +  YFLIV DFI++A
Sbjct: 294  -EYLRNLCYEGLYKRYKN-------PSKEVIERLDYELSVIKQMGYVDYFLIVWDFIKFA 345

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K N I  GPGRGS AGS+ AY L IT+IDP++++LLFERFLNP+R+SMPD D DFC +RR
Sbjct: 346  KDNGIMTGPGRGSAAGSLVAYTLGITNIDPIKYNLLFERFLNPERVSMPDIDSDFCYERR 405

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG + VAQIITFG++ A+A +RDVGRAL  PY++VD + K+IP +    +
Sbjct: 406  QEVIDYVVKKYGKDNVAQIITFGTMAARAVIRDVGRALNYPYAEVDTIAKMIPFELGMTI 465

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                ++ +   +     +  V +L++IS+ LEGL RHASTHAAG+VI   PL   VP+ +
Sbjct: 466  DKA-LSLNPELKARYENEEKVKQLIDISRSLEGLPRHASTHAAGVVISKEPLVNYVPLQK 524

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDDH 606
            +   D  VTQF M  +E+ GL+K DFLGL+TLT+++ +++ + +   V +D   + +DD 
Sbjct: 525  N--EDSIVTQFPMTTLEELGLLKMDFLGLRTLTVIRDTIEMVKKNKGVIIDFDSMEYDDP 582

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            + Y L++   T G+FQLES GM+Q +  ++P  +EDIIA +SLYRPGP+D I  Y   +N
Sbjct: 583  KVYELISKGETEGVFQLESPGMKQFMTELKPKNLEDIIAGISLYRPGPMDQIPRYLANRN 642

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E IV  HPL+ P+L  T G ++YQEQVMQI + ++GYSL  +D++RRAM KK  + M+
Sbjct: 643  HPESIVYDHPLLKPILDVTYGCMVYQEQVMQIVRDVAGYSLGRSDLVRRAMAKKKMDVME 702

Query: 727  KQKERFISG------------ASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI G            A +NG+ +  A  +F+ +  FA+Y FNKSHAAAYAVI+Y
Sbjct: 703  QERKNFIYGIVDEEGNVIVPGALRNGLDEATANKLFDEMLDFANYAFNKSHAAAYAVIAY 762

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTA++K +YPVEF+AA +   +DN++KI  + Q  ++  I+++PP +N     F V +++
Sbjct: 763  QTAYLKRYYPVEFMAALLNSFVDNLDKIAFYVQVCKKMGIKVLPPDINESDSYFTVVEDK 822

Query: 835  IYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + L+A+K VG      I+     +  F S+ DF  R+   +LN++ +ESL+ AGA   
Sbjct: 823  IRFGLSAVKNVGLNMTMEIVSERERNGKFKSVVDFFERMQDSQLNKKAVESLIKAGAFSS 882

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFE 953
            FG  R QLL   D + +  +    N  N   ++F   + +   +           +    
Sbjct: 883  FGVRRSQLLSVYDKLMENIKKNRNNNLNGQISLFGEVEQSHGVEFEFPDLEEFPKNRLLS 942

Query: 954  NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV---------ATIRGNNIRLAAMVVSK 1004
             E+  LG Y SGHPL+ Y   + K+      +                  + +A ++ +K
Sbjct: 943  MEKETLGLYISGHPLEEYMEDIPKITNATTLDFKVSEEEMFQPKLQDNQEVVIAGVIATK 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + K T+  + + +VT  +     E   FP
Sbjct: 1003 KIKFTKNNNMMAFVTIEDLYGTVEVIVFP 1031


>gi|326390936|ref|ZP_08212486.1| DNA polymerase III, alpha subunit [Thermoanaerobacter ethanolicus JW
            200]
 gi|325992978|gb|EGD51420.1| DNA polymerase III, alpha subunit [Thermoanaerobacter ethanolicus JW
            200]
          Length = 1145

 Score =  844 bits (2179), Expect = 0.0,   Method: Composition-based stats.
 Identities = 385/1049 (36%), Positives = 602/1049 (57%), Gaps = 45/1049 (4%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VHS YSLL+G+  + +++ K       AIAITD   ++  ++F ++A A GI+PI
Sbjct: 2    FVHLHVHSEYSLLDGSCRIKDLIAKTKELNMKAIAITDHGVMYGVIDFYKEAVAQGIKPI 61

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +  +    M ++          +VLL     GY+ L+++V+   + +      R
Sbjct: 62   IGCEIYVAPRS---MQDREYGIDNENYHLVLLAKDMTGYKNLMKIVTVASI-EGFYYKPR 117

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +   +L+E  +EGLI L+   +G +         + A++  L +  +FG    Y+ LQ H
Sbjct: 118  VDREFLKE-HSEGLIALSACLAGEVPSYILRGEYEKAKEAALFYDSIFGRGNFYLELQDH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP-R 247
               ++     ++++L+    +PLVATN+  +L ++D +AH+VL+ +     +  +DR   
Sbjct: 177  GILEQQKVNKELIRLSKETGIPLVATNDVHYLEKKDAKAHEVLLCIQTGKTIDDEDRMSF 236

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM ++FS   EA+ENT +IA  C+   + +   LP++   E  D     
Sbjct: 237  PTDEFYLKSPEEMENLFSCCKEAIENTEKIADMCNVEFEFNKTKLPKYDLPEGVDSY--- 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               LRN    GL  R            ++  +RLD+EL+VI +M +  YFLIV DFI++A
Sbjct: 294  -EYLRNLCYEGLYKRYKNPG-------KEVIERLDYELSVIKQMGYVDYFLIVWDFIKFA 345

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K N I  GPGRGS AGS+ AY L IT+IDP++++LLFERFLNP+R+SMPD D DFC +RR
Sbjct: 346  KDNGIMTGPGRGSAAGSLVAYTLGITNIDPIKYNLLFERFLNPERVSMPDIDSDFCYERR 405

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG + VAQIITFG++ A+A +RDVGRAL  PY++VD + K+IP +    +
Sbjct: 406  QEVIDYVVKKYGKDNVAQIITFGTMAARAVIRDVGRALNYPYAEVDTIAKMIPFELGMTI 465

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                ++ +   +     +  V +L++IS+ LEGL RHASTHAAG+VI   PL   VP+ +
Sbjct: 466  DKA-LSLNPELKARYENEEKVKQLIDISRSLEGLPRHASTHAAGVVISKEPLVNYVPLQK 524

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDDH 606
            +   D  VTQF M  +E+ GL+K DFLGL+TLT+++ +++ + +   V +D   + +DD 
Sbjct: 525  N--EDSIVTQFPMTTLEELGLLKMDFLGLRTLTVIRDTIEMVKKNKGVIIDFDSMEYDDL 582

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            + Y L++   T G+FQLESSGM+Q +  ++P  +EDIIA +SLYRPGP+D I  Y   +N
Sbjct: 583  KVYELISKGETEGVFQLESSGMKQFMAELKPKNLEDIIAGISLYRPGPMDQIPRYLANRN 642

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E IV  HPL+ P+L  T G ++YQEQVMQI + ++GYSL  +D++RRAM KK  + M+
Sbjct: 643  HPESIVYDHPLLKPILDVTYGCMVYQEQVMQIVRDVAGYSLGRSDLVRRAMAKKKMDVME 702

Query: 727  KQKERFISG------------ASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI G            A +NG+ +  A  +F+ +  FA+Y FNKSHAAAYAVI+Y
Sbjct: 703  QERKNFIYGIVDEEGNVIVPGALRNGLDEATANKLFDEMLDFANYAFNKSHAAAYAVIAY 762

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTA++K +YPVEF+AA +   +DN++KI  + Q  ++  I+++PP +N     F V +++
Sbjct: 763  QTAYLKRYYPVEFMAALLNSFVDNLDKIAFYVQVCKKMGIKVLPPDINESDSYFTVVEDK 822

Query: 835  IYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + L+A+K VG      I+     +  F S+ DF  R+   +LN++ +ESL+ AGA   
Sbjct: 823  IRFGLSAVKNVGLNMTMEIVSERERNGKFKSVVDFFERMQDSQLNKKAVESLIKAGAFSS 882

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFE 953
            FG  R QLL   D + +  +    N  N   ++F   + +   +           +    
Sbjct: 883  FGVRRSQLLSVYDKLMENIKKNRNNNLNGQISLFGEVEQSHGVEFEFPDLEEFPKNRLLS 942

Query: 954  NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV---------ATIRGNNIRLAAMVVSK 1004
             E+  LG Y SGHPL+ Y   + K+      +                  + +A ++ +K
Sbjct: 943  MEKETLGLYISGHPLEEYMEDIPKITNATTLDFKVSEEEMFQPKLQDNQEVVIAGVIATK 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + K T+  + + +VT  +     E   FP
Sbjct: 1003 KIKFTKNNNMMAFVTIEDLYGTVEVIVFP 1031


>gi|167037102|ref|YP_001664680.1| DNA polymerase III DnaE [Thermoanaerobacter pseudethanolicus ATCC
            33223]
 gi|320115517|ref|YP_004185676.1| DNA polymerase III subunit alpha [Thermoanaerobacter brockii subsp.
            finnii Ako-1]
 gi|166855936|gb|ABY94344.1| DNA polymerase III, alpha subunit [Thermoanaerobacter
            pseudethanolicus ATCC 33223]
 gi|319928608|gb|ADV79293.1| DNA polymerase III, alpha subunit [Thermoanaerobacter brockii subsp.
            finnii Ako-1]
          Length = 1145

 Score =  843 bits (2178), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/1049 (36%), Positives = 601/1049 (57%), Gaps = 45/1049 (4%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VHS YSLL+G+  + +++ K       AIAITD   ++  ++F ++A A GI+PI
Sbjct: 2    FVHLHVHSEYSLLDGSCRIKDLIAKTKELNMKAIAITDHGVMYGVIDFYKEAVAQGIKPI 61

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +  +    M ++          +VLL     GY+ L+++V+   + +      R
Sbjct: 62   IGCEIYVAPRS---MQDREYGIDNENYHLVLLAKDMTGYKNLMKIVTVASI-EGFYYKPR 117

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +   +L+E  +EGLI L+   +G +         + A++  L +  +FG    Y+ LQ H
Sbjct: 118  VDREFLKE-HSEGLIALSACLAGEVPSYILRGEYEKAKEAALFYDSIFGRGNFYLELQDH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP-R 247
               ++     ++++L+    +PLVATN+  +L ++D +AH+VL+ +     +  +DR   
Sbjct: 177  GILEQQKVNKELIRLSKETGIPLVATNDVHYLEKKDAKAHEVLLCIQTGKTIDDEDRMSF 236

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM ++FS   EA+ENT +IA  C+   + +   LP++   E  D     
Sbjct: 237  PTDEFYLKSPEEMENLFSCCKEAIENTEKIADMCNVEFEFNKTKLPKYDLPEGVDSC--- 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               LRN    GL  R            ++  +RLD+EL+VI +M +  YFLIV DFI++A
Sbjct: 294  -EYLRNLCYEGLYKRYKNPG-------KEVIERLDYELSVIKQMGYVDYFLIVWDFIKFA 345

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K N I  GPGRGS AGS+ AY L IT+IDP++++LLFERFLNP+R+SMPD D DFC +RR
Sbjct: 346  KDNGIMTGPGRGSAAGSLVAYTLGITNIDPIKYNLLFERFLNPERVSMPDIDSDFCYERR 405

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG + VAQIITFG++ A+A +RDVGRAL  PY++VD + K+IP +    +
Sbjct: 406  QEVIDYVVKKYGKDNVAQIITFGTMAARAVIRDVGRALNYPYAEVDTIAKMIPFELGMTI 465

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                ++ +   +     +  V +L++IS+ LEGL RHASTHAAG+VI   PL   VP+ +
Sbjct: 466  DKA-LSLNPELKARYENEEKVKQLIDISRSLEGLPRHASTHAAGVVISKEPLVNYVPLQK 524

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDDH 606
            +   D  VTQF M  +E+ GL+K DFLGL+TLT+++ +++ + +   V +D   + +DD 
Sbjct: 525  N--EDSIVTQFPMTTLEELGLLKMDFLGLRTLTVIRDTIEMVKKNKGVIIDFDSMGYDDL 582

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            + Y L++   T G+FQLES GM+Q +  ++P  +EDIIA +SLYRPGP+D I  Y   +N
Sbjct: 583  KVYELISKGETEGVFQLESPGMKQFMTELKPKNLEDIIAGISLYRPGPMDQIPRYLANRN 642

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E IV  HPL+ P+L  T G ++YQEQVMQI + ++GYSL  +D++RRAM KK  + M+
Sbjct: 643  HPESIVYDHPLLKPILDVTYGCMVYQEQVMQIVRDVAGYSLGRSDLVRRAMAKKKMDVME 702

Query: 727  KQKERFISG------------ASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI G            A +NG+ +  A  +F+ +  FA+Y FNKSHAAAYAVI+Y
Sbjct: 703  QERKNFIYGIVDEEGNVIVPGALRNGLDEVTANKLFDEMLDFANYAFNKSHAAAYAVIAY 762

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTA++K +YPVEF+AA +   +DN++KI  + Q  ++  I+++PP +N     F V +++
Sbjct: 763  QTAYLKRYYPVEFMAALLNSFVDNLDKIAFYVQVCKKMGIKVLPPDINESDSYFTVVEDK 822

Query: 835  IYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + L+A+K VG      I+     +  F S+ DF  R+   +LN++ +ESL+ AGA   
Sbjct: 823  IRFGLSAVKNVGLNMTMEIVSERERNGKFKSVVDFFERMQDSQLNKKAVESLIKAGAFSS 882

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFE 953
            FG  R QLL   D + +  +    N  N   ++F   + +   +           +    
Sbjct: 883  FGVRRSQLLSVYDKLMENIKKNRNNNLNGQISLFGEVEQSHGVEFEFPDLEEFPKNRLLS 942

Query: 954  NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV---------ATIRGNNIRLAAMVVSK 1004
             E+  LG Y SGHPL+ Y   + K+      +                  + +A ++ +K
Sbjct: 943  MEKETLGLYISGHPLEEYMEDIPKITNATTLDFKVSEEEMFQPKLQDNQEVVIAGVIATK 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + K T+  + + +VT  +     E   FP
Sbjct: 1003 KIKFTKNNNMMAFVTIEDLYGTVEVIVFP 1031


>gi|297569370|ref|YP_003690714.1| DNA polymerase III, alpha subunit [Desulfurivibrio alkaliphilus AHT2]
 gi|296925285|gb|ADH86095.1| DNA polymerase III, alpha subunit [Desulfurivibrio alkaliphilus AHT2]
          Length = 1192

 Score =  843 bits (2177), Expect = 0.0,   Method: Composition-based stats.
 Identities = 426/1036 (41%), Positives = 616/1036 (59%), Gaps = 23/1036 (2%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VH+ YS+L+GA+ L+ +L +       A+AITD   +F ALEF  KA  AGI+PI
Sbjct: 15   FVHLHVHTQYSMLDGAIRLDRLLAQCKEYGMEAVAITDHGAMFGALEFYVKAKKAGIKPI 74

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC+  +   D    + +          +VLL    EGYQ L++L S     +      R
Sbjct: 75   IGCEFYVAPADRRDKSAKSAGAAAHH--LVLLAMNNEGYQNLMKLASCAQF-EGFHYKPR 131

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHR 190
            I    L     +GLI LT    G +           A+      +KLF DRLY+ LQ ++
Sbjct: 132  IDYELLSR-HNQGLIALTACLHGQLPMLLTRGDYDGAKAAAGKLQKLFPDRLYLELQENK 190

Query: 191  GYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVT 249
              ++      + +LA   +LPLVATN+  +L+ E+ +AH+VL+ +     ++ + R R +
Sbjct: 191  IAEQQTVNDGLKKLAAELKLPLVATNDCHYLNREEAQAHEVLLCIQTGKTMADQGRFRFS 250

Query: 250  PDHYLKN-RSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEE 308
             D       +EM   FS  PEA+  TV++A RC+  L + +   P F   E +      E
Sbjct: 251  TDELFFKSPAEMKKSFSHCPEAIAETVKVAARCNVELDLSSHHFPHFPIPEGE----TLE 306

Query: 309  NELRNKAVAGLEVRLAQGAIAKGYHA---QDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
            +     A  GLE R  +            ++YR RL+ E++VI +M F GYFLIVADFI 
Sbjct: 307  SVFSKDAREGLEKRFTEIRRLTELTPEQEEEYRARLEHEIDVIIKMGFPGYFLIVADFIN 366

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            WAK + IPVGPGRGSGAGS+ A+A+ ITDIDP+ + L+FERFLN +R SMPDFD+DFCQ+
Sbjct: 367  WAKDHEIPVGPGRGSGAGSLVAWAMRITDIDPMPYGLIFERFLNIERKSMPDFDVDFCQE 426

Query: 426  RRDEVIRYVQNKY-GHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            RR EVI YVQ KY G E VAQI+T+GS++A+A +RDVGRAL MPY +VDR+ KLIP +  
Sbjct: 427  RRGEVIEYVQQKYGGAEHVAQIVTYGSMKARAVVRDVGRALGMPYGEVDRIAKLIPEELG 486

Query: 485  HPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
              +  +AI  + R  +    +P V  LL  ++ LEGL RH STHAAG+VI  +P+ + +P
Sbjct: 487  ITLD-KAIDKEPRLGDLMKREPPVAELLNAARVLEGLQRHTSTHAAGVVISPKPMVEYLP 545

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-QRGVKVDLSLIPF 603
            + +       +TQ++MK  E  GLIKFDFLGLKTLT++ ++   +    G ++D+  I  
Sbjct: 546  LCKGP-KGEVLTQYDMKHTEMTGLIKFDFLGLKTLTVIDRACKLIKGDLGREIDIGAIAT 604

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VY 661
            DD +TY LL     LG+FQLESSGMR  L  M+P+   D+IALV+LYRPGP+++ +   +
Sbjct: 605  DDPKTYDLLCKGDALGVFQLESSGMRSLLMKMKPEQFSDLIALVALYRPGPLESGMVDDF 664

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
             N K+G+       P ++P+L+ET GVI+YQEQVM+IA +L+GYSL +AD LRRAMGKKI
Sbjct: 665  VNTKHGRMVAKYPLPQLEPILQETYGVIVYQEQVMKIANVLAGYSLGDADNLRRAMGKKI 724

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
               MD +K++F++G +KN I    A  IF+L+AKFA YGFNKSH+AAYA+++YQTAW+K 
Sbjct: 725  AAVMDAEKDKFMAGCAKNNIDPKKAEYIFDLMAKFAGYGFNKSHSAAYALVAYQTAWLKA 784

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYP +F+AA ++ +M N +K+ ++  + ++  I+++PP +N    DF V D+RI + LAA
Sbjct: 785  HYPAQFMAALLSCDMGNTDKVVRYINECKEHEIEVLPPDINESFRDFTVIDDRIRFGLAA 844

Query: 842  IKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQ 900
            +K VG      I+E   AD P+ SL DFC RVD +K+NRRV+ESL+ AGA D  G  R Q
Sbjct: 845  VKNVGGAALESIIEIREADGPYKSLVDFCQRVDGRKVNRRVIESLIRAGAFDSLGAKRSQ 904

Query: 901  LLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD---KITLEKFSVENSSVRFENEQR 957
            L   LD     AQ  ++++ +   ++FA      ++   +I L +        +   E+ 
Sbjct: 905  LEAILDRALDQAQAAQRDKLSGQISLFAAMPTDQAERATEIELPEMPEWEEKQKLLFEKE 964

Query: 958  VLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGW 1017
             +GFY +GHPLD ++  L  +                 R+  ++   +  +++KG  + +
Sbjct: 965  TVGFYLTGHPLDKHRRELAALTDTDLHGLAEWPDNQPARIGGLIRQFKNHRSKKGDAMAF 1024

Query: 1018 VTFSEPAKEYEANFFP 1033
            VT  +     E   FP
Sbjct: 1025 VTLEDTVDSVEVVVFP 1040


>gi|261408717|ref|YP_003244958.1| DNA polymerase III subunit alpha [Paenibacillus sp. Y412MC10]
 gi|261285180|gb|ACX67151.1| DNA polymerase III, alpha subunit [Paenibacillus sp. Y412MC10]
          Length = 1241

 Score =  842 bits (2175), Expect = 0.0,   Method: Composition-based stats.
 Identities = 397/1046 (37%), Positives = 612/1046 (58%), Gaps = 32/1046 (3%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
             SFVHL VHS YSLL+GA  + +++ + AA    ++A+TD   ++ A+ F +   A GI+
Sbjct: 2    SSFVHLHVHSEYSLLDGAARIGDLVREAAALGMKSLALTDHGVMYGAVPFYKACLAQGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC+  I      +   +G      +  ++LL     GY+ L++L S  +L +     
Sbjct: 62   PIIGCEAYITAGSRKE---RGSRKDQPIYHLILLAKNETGYRNLMKLCSIGHL-EGYHYR 117

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             RI +  L     EG+I L+    G + +         A+   L ++ +FG+  Y+ LQ 
Sbjct: 118  PRIDMEALAA-HHEGIICLSACLGGEVPQHLLHGREAEAKAAALRYQAIFGEDYYLELQD 176

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++ R   Q++QL+    +PLVATN+  +L+E D E  DVL+ +     V  +DR +
Sbjct: 177  HGMPEQKRVNPQLIQLSRETGIPLVATNDVHYLTENDAEVQDVLICIGTGKTVEDEDRLQ 236

Query: 248  -VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T   YLK+ S+M  ++  +PEA+ NT +IA +C   L+    ILP +         K 
Sbjct: 237  IQTNQLYLKSGSDMERLYPHVPEAILNTAKIADQCHLELEFGKSILPEYSS---LPEGKN 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGY-HAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
                LR+  ++GL  R  +    +      +  QRLD+EL VI  M FS YFLIV DFI 
Sbjct: 294  AAEYLRDLCLSGLRERYEETERWQDEVQRSELEQRLDYELGVIESMGFSDYFLIVWDFIA 353

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            +A +  I VGPGRGS AGS+ AY L IT++DP+++ LLFERFLNP+R++MPD DIDF  +
Sbjct: 354  YAHRKGIAVGPGRGSSAGSLVAYTLQITNVDPMKYKLLFERFLNPERITMPDIDIDFSDE 413

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RRDEVI YV +KYG E VAQIITFG++ A+AA+RDVGRAL +P+  VD+  KLIPN    
Sbjct: 414  RRDEVIDYVVDKYGKEHVAQIITFGTMAARAAVRDVGRALNVPFGDVDKAAKLIPNHLGI 473

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
             +  +A+    + +E     P V  L++++ K+EG+ RHASTHAAGIVI   PL+  VP+
Sbjct: 474  SIE-RAMEQSPQLKEQYETKPKVRELIDMAMKVEGMPRHASTHAAGIVISREPLTDAVPL 532

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFD 604
              +      +TQ++M+ +E  GL+K DFLGL+TL++++++L ++ +  G ++D   +P D
Sbjct: 533  Q-EGSEKTALTQYSMENLESVGLLKMDFLGLRTLSIIERTLKWIQELTGSELDFEQVPDD 591

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNR 664
            D  TY +L    T G+FQLES+G+R+ L+ ++P   EDI+++ +LYRPGP++ I  +   
Sbjct: 592  DQATYEMLGRGETAGVFQLESAGIRRVLKDLKPSVFEDIVSVNALYRPGPMEFIPKFIQA 651

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G+ +    HP + P+L +T G+I+YQEQ+MQIA  ++G+SL EAD+LRRA+ KK +E 
Sbjct: 652  KHGRIEPEYPHPDLIPILGDTYGIIVYQEQIMQIASTMAGFSLGEADLLRRAVSKKKREV 711

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            +D+++  F+SG+ K G ++  A  +++++ +FA+YGF ++HAAAY V+++QTA++K HYP
Sbjct: 712  LDRERSHFVSGSLKLGYTEDEANRVYDMIVRFANYGFPRAHAAAYGVLAFQTAYLKAHYP 771

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVG------------- 831
            V F+A+ +T  M +  K+ ++  +AR+ +I++MPP VN     F                
Sbjct: 772  VPFMASMLTAVMGSHRKVAEYVLEARRIDIEVMPPDVNESGTYFTPVMSRTAAEGSDKQA 831

Query: 832  ----DNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVF 887
                   I + LAAIK VGT    +I+E   +KPF+SL DFC RVD +  N+RV+ESL+ 
Sbjct: 832  DSPAGGGIRFGLAAIKNVGTQAVENIVEIRREKPFESLLDFCRRVDLRVCNKRVIESLIQ 891

Query: 888  AGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVEN 947
            AGA D     R QL+  LD   + A    K R +    +F   +    D I         
Sbjct: 892  AGAFDSLQGHRSQLVAMLDETVEAAVKWRKERDDLQIQLFDFVETANWD-IEYPDIPPYT 950

Query: 948  SSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQK 1007
            +S + E E+ +LG Y SGHPLD ++  L + G     +       +   +A MVVS +  
Sbjct: 951  ASQQLEFERELLGMYLSGHPLDGFEETLTESGADRLMDLHEAEDESMATVAGMVVSLKTI 1010

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             T++G  + ++   +  +  E   FP
Sbjct: 1011 TTKQGKSMAFMECEDQIERCEVVLFP 1036


>gi|256752386|ref|ZP_05493246.1| DNA polymerase III, alpha subunit [Thermoanaerobacter ethanolicus
            CCSD1]
 gi|256748721|gb|EEU61765.1| DNA polymerase III, alpha subunit [Thermoanaerobacter ethanolicus
            CCSD1]
          Length = 1101

 Score =  842 bits (2174), Expect = 0.0,   Method: Composition-based stats.
 Identities = 390/1049 (37%), Positives = 603/1049 (57%), Gaps = 45/1049 (4%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VHS YSLL+G+  + +++ K       AIAITD   ++  ++F ++A A GI+PI
Sbjct: 2    FVHLHVHSEYSLLDGSCRIKDLIAKTKELNMKAIAITDHGVMYGVIDFYKEAVAQGIKPI 61

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +  +    M ++          +VLL     GY+ L+++V+   + +      R
Sbjct: 62   IGCEIYVAPRS---MQDREYGIDNENYHLVLLAKDMTGYKNLMKIVTVASI-EGFYYKPR 117

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +   +L+E  +EGLI L+   +G +         + A++  L +  +FG    Y+ LQ H
Sbjct: 118  VDREFLKE-HSEGLIALSACLAGEVPSYILRGEYEKAKEAALFYDSIFGRGNFYLELQDH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP-R 247
               ++     ++++L+    +PLVATN+  +L ++D +AH+VL+ +     +  +DR   
Sbjct: 177  GILEQQKVNKELIRLSKETGIPLVATNDVHYLEKKDAKAHEVLLCIQTGKTIDDEDRMSF 236

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM ++FS   EA+ENT +IA  C+   + +   LP++   E  D     
Sbjct: 237  PTDEFYLKSPEEMENLFSCCKEAIENTEKIADMCNVEFEFNKTKLPKYDLPEGVDSC--- 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               LRN    GL  R           +++  +RLD+EL+VI +M +  YFLIV DFI++A
Sbjct: 294  -EYLRNLCYEGLYKRYKN-------PSKEVIERLDYELSVIEQMGYVDYFLIVWDFIKFA 345

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K N I  GPGRGS AGS+ AY L IT+IDP++++LLFERFLNP+R+SMPD D DFC +RR
Sbjct: 346  KDNGIMTGPGRGSAAGSLVAYTLGITNIDPIKYNLLFERFLNPERVSMPDIDSDFCYERR 405

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG + VAQIITFG++ A+A +RDVGRAL  PY++VD + K+IP +    +
Sbjct: 406  QEVIDYVVKKYGKDNVAQIITFGTMAARAVIRDVGRALNYPYAEVDVIAKMIPFELGMTI 465

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                ++ +   +     +  V +L++IS+ LEGL RHASTHAAG+VI   PL   VP+ +
Sbjct: 466  DKA-LSLNPELKARYENEEKVKQLIDISRSLEGLPRHASTHAAGVVISKEPLVNYVPLQK 524

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSLIPFDDH 606
            +   D  VTQF M  +E+ GL+K DFLGL+TLT+++ +++     RGV +D   + +DD 
Sbjct: 525  N--EDSIVTQFPMTTLEELGLLKMDFLGLRTLTVIRDTIEMVEKNRGVTIDFDSMEYDDP 582

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            + Y L++   T G+FQLESSGM+Q +  ++P  +EDIIA +SLYRPGP+D I  Y   KN
Sbjct: 583  KVYELISKGETEGVFQLESSGMKQFMAELKPKNLEDIIAGISLYRPGPMDQIPRYLANKN 642

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E IV  HPL+ P+L  T G ++YQEQVMQI + ++GYSL  +D++RRAM KK  + M+
Sbjct: 643  HPESIVYDHPLLKPILDVTYGCMVYQEQVMQIVRDVAGYSLGRSDLVRRAMAKKKMDVME 702

Query: 727  KQKERFISG------------ASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI G            A +NG+ +  A  +F+ +  FA+Y FNKSHAAAYAVI+Y
Sbjct: 703  QERKNFIYGIVDEEGNVIVPGALRNGLDEATANKLFDEMLDFANYAFNKSHAAAYAVIAY 762

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTA++K +YPVEF+AA +   +DN++K+  + Q  R+  I+++PP +N     F V +++
Sbjct: 763  QTAYLKRYYPVEFMAALLNSFVDNLDKVAFYVQVCRKMGIKVLPPDINESDSYFTVVEDK 822

Query: 835  IYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + L+A+K VG      I+     +  F S+ DF  R+   +LN++ +ESL+ AGA   
Sbjct: 823  IRFGLSAVKNVGLNMTMEIVSERERNGKFKSVVDFFERMQDSQLNKKAVESLIKAGAFSS 882

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFE 953
            FG  R QLL + D + +  +    N  N   ++F   + T               S    
Sbjct: 883  FGVRRSQLLSAYDKLMENIKKNRNNNLNGQISLFGEVEQTHGVGFEFPDLEEFPKSRLLS 942

Query: 954  NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV---------ATIRGNNIRLAAMVVSK 1004
             E+  LG Y SGHPL+ Y   + K+      +                  + +A ++ +K
Sbjct: 943  MEKETLGLYISGHPLEEYMEDIPKITNATTLDFKVSEEEMFQPKLQDNQEVVIAGVIATK 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + K T+  + + +VT  +     E   FP
Sbjct: 1003 KIKFTKNNNIMAFVTIEDLYGTVEVIVFP 1031


>gi|189425779|ref|YP_001952956.1| DNA polymerase III subunit alpha [Geobacter lovleyi SZ]
 gi|189422038|gb|ACD96436.1| DNA polymerase III, alpha subunit [Geobacter lovleyi SZ]
          Length = 1179

 Score =  840 bits (2169), Expect = 0.0,   Method: Composition-based stats.
 Identities = 429/1042 (41%), Positives = 627/1042 (60%), Gaps = 22/1042 (2%)

Query: 5    LE-KSP--SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQK 61
            +   SP   FVHL +HS YSLL+GA+ + +++ K    Q PA+AITD  N+F A+EF  K
Sbjct: 3    MPENSPVTPFVHLHLHSQYSLLDGAIRIEDLVSKAKQYQMPALAITDHGNMFGAVEFYLK 62

Query: 62   ACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYL 121
               AGI+PIIGC+L I         ++G +       ++LL    EGY+ L  L S  Y 
Sbjct: 63   CKKAGIKPIIGCELYIAPDSRFSKDSKGIS--DAAYHLILLCQNLEGYKNLSYLTSAGY- 119

Query: 122  LDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDR 181
             +      R+  + L++  +EGLI L+    G +         + A +    + +LF DR
Sbjct: 120  KEGFYYRPRVDRALLEQ-HSEGLIALSACLKGEVAMQCGRGKMEDALETARWYSQLFPDR 178

Query: 182  LYVNLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVV 240
             Y+ +Q +   ++     +++++A    LPLVATN+  +L+ ED +AH+VL+ +     +
Sbjct: 179  YYIEIQENTLPEQDVVNQRLLEVARELNLPLVATNDCHYLNREDAKAHEVLLCIQTGKTM 238

Query: 241  SQKDRPRVT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKE 299
            S     R +  + Y+K   EM + F   PEA+ NTV IA RC+  L +         E  
Sbjct: 239  SDPTHMRFSADEFYVKTPEEMAAAFHYAPEAIANTVAIAERCNLELPLEKEYYFPHFEP- 297

Query: 300  CDDIQKEEENELRNKAVAGLEVR----LAQGAIAKGYHAQDYRQRLDFELNVIARMKFSG 355
                 K  ++ L  +AV+GLE R     A+     G   Q Y  RL  EL+ I +MKF  
Sbjct: 298  --PEGKTHDDMLEEQAVSGLEERLITIRAKYPDMTGEQVQAYHDRLRTELDCIRQMKFPA 355

Query: 356  YFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSM 415
            YFLIVADFI WAK+  IPVGPGRGS AGS+ AYA+ ITD+DPL ++LLFERFLNP+R+SM
Sbjct: 356  YFLIVADFINWAKRQGIPVGPGRGSAAGSLVAYAIKITDLDPLPYNLLFERFLNPERISM 415

Query: 416  PDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRL 475
            PD D+DFCQD+R++VI YV  KYG ERV QIITFG+++AKA +RDVGRAL M Y  VD++
Sbjct: 416  PDIDVDFCQDQREKVIEYVVQKYGRERVCQIITFGTMKAKAVVRDVGRALDMAYGDVDKI 475

Query: 476  CKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIG 535
             KLIP+D    +  +AI  + + +E   ADP V +LLE +  LEGL RHA THAAG+V+ 
Sbjct: 476  AKLIPDDLKMTIE-KAIKQEPQLKEMAAADPKVAQLLETANCLEGLARHAGTHAAGVVVA 534

Query: 536  DRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGV 594
               L + +P+Y+D ++    TQ++MK++E  GL+KFDFLGLK LT++Q ++  + + +  
Sbjct: 535  PNQLEEYLPVYKDQKTGGINTQYSMKYVEMVGLVKFDFLGLKNLTVIQNAVRMIREGQNP 594

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
              D++ +  DD  +Y L+T   T GIFQLESSGM++ L  ++P C ED+IA  +LYRPGP
Sbjct: 595  DFDITRLRDDDQASYDLITAGNTTGIFQLESSGMKEMLVKLKPSCFEDVIAACALYRPGP 654

Query: 655  IDNIVV--YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADV 712
            +   +V  +  RK+G++K+V   P ++P+LK+T GVI+YQEQVMQI++ L+GYSL  AD+
Sbjct: 655  LGCGMVDEFIERKHGRQKVVYDLPQLEPILKDTYGVIVYQEQVMQISRSLAGYSLGRADL 714

Query: 713  LRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVI 772
            LRRAMGKK    M K+KE F+ GA   G+    A  IF+ +AKFA+YGFNKSH+AAYA+I
Sbjct: 715  LRRAMGKKDPAVMAKEKEPFLEGAKAQGLDIKKAEAIFDQMAKFAEYGFNKSHSAAYALI 774

Query: 773  SYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGD 832
            +YQTA++K HYPVEF+AA ++ +MD+ +K+ K   D R+  I+++PP +NT    F V  
Sbjct: 775  AYQTAYLKAHYPVEFMAALLSCDMDSTDKVLKSISDCREQGIEVLPPDINTSGQSFTVSG 834

Query: 833  NRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALD 892
              + + L A+KGVG      I+EA AD PF  + DFC RVD +++N+RV+E+LV  GA D
Sbjct: 835  KSMRFGLGAVKGVGGGAVESIIEARADGPFTDIYDFCERVDLRRVNKRVMEALVKCGAFD 894

Query: 893  CFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKI--TLEKFSVENSSV 950
                 R  L+ +LD+     Q  ++ R +   ++F       + +    L      +   
Sbjct: 895  SLHKHRAPLMAALDDATTAGQRFQEERDSAQVSLFGDMPTATATRSGRKLPDIEEWHDKE 954

Query: 951  RFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTR 1010
            +   E+  LGF  +GHPLD Y   ++++                +R+  +V S ++  T+
Sbjct: 955  KLGYEKEALGFLITGHPLDRYASDIKRLASAEIARLPEFPDNCEVRVCGIVTSLKEIITK 1014

Query: 1011 KGSRIGWVTFSEPAKEYEANFF 1032
            KG R+G+VT  +   + E   F
Sbjct: 1015 KGDRMGFVTIEDLTGQIEITVF 1036


>gi|315122785|ref|YP_004063274.1| DNA polymerase III subunit alpha [Candidatus Liberibacter
            solanacearum CLso-ZC1]
 gi|313496187|gb|ADR52786.1| DNA polymerase III subunit alpha [Candidatus Liberibacter
            solanacearum CLso-ZC1]
          Length = 1226

 Score =  840 bits (2169), Expect = 0.0,   Method: Composition-based stats.
 Identities = 895/1034 (86%), Positives = 968/1034 (93%), Gaps = 1/1034 (0%)

Query: 1    LTQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQ 60
            L Q +E+SP FVHLQVHSSYSLLEGALSLNNILDK  ADQQPAIAITDTNNLF ALEFSQ
Sbjct: 15   LNQQVERSPGFVHLQVHSSYSLLEGALSLNNILDKAIADQQPAIAITDTNNLFGALEFSQ 74

Query: 61   KACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMY 120
            KAC AGIQPIIGCQ++IDMQD L++T++GK+ FP +PSIVLLVS AEGYQRLIELVSRMY
Sbjct: 75   KACLAGIQPIIGCQIEIDMQDGLEVTHKGKSFFPELPSIVLLVSKAEGYQRLIELVSRMY 134

Query: 121  LLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD 180
            LL+QG +SVRI  SWLQEIGTEGLIMLTGGSSG IDRAF FN+ Q+AEKRLL+FK +FG+
Sbjct: 135  LLNQGHKSVRIYFSWLQEIGTEGLIMLTGGSSGSIDRAFLFNNPQIAEKRLLSFKNIFGN 194

Query: 181  RLYVNLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVV 240
            RLYVNLQRHRGYDRYRESQV+QLAY HELPLVATNN+LFLS+EDY+AHDVLMAVAHSTV+
Sbjct: 195  RLYVNLQRHRGYDRYRESQVIQLAYKHELPLVATNNALFLSQEDYDAHDVLMAVAHSTVI 254

Query: 241  SQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKEC 300
            SQ+DRPRVTPDHYLKNR+EM+S+F+DLPEAL+NTVEIARRCSFILQVH PILPRFI+KEC
Sbjct: 255  SQEDRPRVTPDHYLKNRAEMLSMFADLPEALDNTVEIARRCSFILQVHKPILPRFIDKEC 314

Query: 301  DDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIV 360
            DD +K EENELR KA+ GLE RL+QG IAKGY AQDYR+RLDFEL+VIARMKFSGYFLIV
Sbjct: 315  DDFEKIEENELRTKAIEGLETRLSQGIIAKGYSAQDYRKRLDFELDVIARMKFSGYFLIV 374

Query: 361  ADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDI 420
            ADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDI
Sbjct: 375  ADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDI 434

Query: 421  DFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIP 480
            DFCQDRRDEVI+YVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIP
Sbjct: 435  DFCQDRRDEVIQYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIP 494

Query: 481  NDPAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            N+PAHPVS  QAIADDSRF+EA L DP VDRLLEIS KLEGLYRHASTHAAGIVIGDRPL
Sbjct: 495  NNPAHPVSLKQAIADDSRFQEAILDDPFVDRLLEISLKLEGLYRHASTHAAGIVIGDRPL 554

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLS 599
            SQL+PMYRDVRSD+PVTQFNMKW+EKAGL+KFDFLGLKTLT+LQKSLD L QRG+KVDLS
Sbjct: 555  SQLIPMYRDVRSDIPVTQFNMKWVEKAGLVKFDFLGLKTLTVLQKSLDLLEQRGIKVDLS 614

Query: 600  LIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV 659
            LIPFDDHETYHLLT KGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPI+NI 
Sbjct: 615  LIPFDDHETYHLLTKKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIENIT 674

Query: 660  VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGK 719
            +YNNRKNGKEKIVSIHPLID +LKETQGVI+YQEQVMQIAQLLSGYSLSEADVLRRAMGK
Sbjct: 675  IYNNRKNGKEKIVSIHPLIDSILKETQGVIVYQEQVMQIAQLLSGYSLSEADVLRRAMGK 734

Query: 720  KIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWM 779
            KIKEEMDKQKERF+SGASKNG+S  +AVNIFELLAKFADYGFNKSHAAAYAVISY+TAWM
Sbjct: 735  KIKEEMDKQKERFVSGASKNGLSNIMAVNIFELLAKFADYGFNKSHAAAYAVISYRTAWM 794

Query: 780  KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSL 839
            KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQI+ PSV T CVDF+VG+  IYYSL
Sbjct: 795  KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIILPSVQTSCVDFEVGEKCIYYSL 854

Query: 840  AAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRM 899
            AAIKGVGT TA HIM   ADKPF+SLEDFCSRVDSK+LNRRVLESL+FAGALDCFGYSR 
Sbjct: 855  AAIKGVGTITAHHIMTVRADKPFESLEDFCSRVDSKQLNRRVLESLIFAGALDCFGYSRE 914

Query: 900  QLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVL 959
            QL QSLDNIQKYAQW+EKNRTN   NIF  E+G+FS+KI+LE+FSVENSS RFE+E+RVL
Sbjct: 915  QLYQSLDNIQKYAQWIEKNRTNDQANIFVDEEGSFSEKISLEEFSVENSSARFEHERRVL 974

Query: 960  GFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVT 1019
            GFYFSGHPLDVYK IL+KMGIK YEES+A+++ + IRLA MV+SK+QKKTRKGSRIGWVT
Sbjct: 975  GFYFSGHPLDVYKAILQKMGIKSYEESIASVKESIIRLAVMVMSKEQKKTRKGSRIGWVT 1034

Query: 1020 FSEPAKEYEANFFP 1033
            FSEP KEYE  FFP
Sbjct: 1035 FSEPDKEYEGIFFP 1048


>gi|297545038|ref|YP_003677340.1| DNA polymerase III, alpha subunit [Thermoanaerobacter mathranii
            subsp. mathranii str. A3]
 gi|296842813|gb|ADH61329.1| DNA polymerase III, alpha subunit [Thermoanaerobacter mathranii
            subsp. mathranii str. A3]
          Length = 1145

 Score =  839 bits (2168), Expect = 0.0,   Method: Composition-based stats.
 Identities = 385/1049 (36%), Positives = 599/1049 (57%), Gaps = 45/1049 (4%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL VHS YSLL+G+  + +++ K       AIAITD   ++  ++F ++A A GI+PI
Sbjct: 2    FAHLHVHSEYSLLDGSCRIKDLIAKTKELNMKAIAITDHGVMYGVIDFYKEAVAHGIKPI 61

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +  +    M ++          +VLL     GY+ L+++V+   + +      R
Sbjct: 62   IGCEIYVAPRS---MRDREYGIDNENYHLVLLAKDMVGYKNLMKIVTMASI-EGFYYKPR 117

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +   +L+E  ++GLI L+   +G +         + A++  L +  +FG    Y+ LQ H
Sbjct: 118  VDKEFLKE-HSKGLIALSACLAGEVPSYILRGEYEKAKEAALFYDSIFGRGNFYLELQDH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP-R 247
               ++     ++++L+    +PLVATN+  +L ++D +AH+VL+ +     +  +DR   
Sbjct: 177  GILEQQKVNKELIRLSKETGIPLVATNDVHYLDKKDAKAHEVLLCIQTGKTIDDEDRMSF 236

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM ++FS   EA+ENT +IA  C+   + +   LP++   E  D     
Sbjct: 237  PTDEFYLKSPEEMENLFSYCKEAIENTEKIASMCNVEFEFNKTKLPKYDLPEGVDSY--- 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               LRN    GL  R            ++  +RLD+EL+VI +M +  YFLIV DFI++A
Sbjct: 294  -EYLRNLCYEGLYKRYKN-------PNKEVIERLDYELSVIKQMGYVDYFLIVWDFIKFA 345

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K N I  GPGRGS AGS+ AY L IT+IDP++++LLFERFLNP+R+SMPD D DFC +RR
Sbjct: 346  KDNGIMTGPGRGSAAGSLVAYTLGITNIDPIKYNLLFERFLNPERVSMPDIDSDFCYERR 405

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG + VAQIITFG++ A+A +RDVGRAL  PY++VD + K+IP +    +
Sbjct: 406  QEVIDYVVKKYGKDNVAQIITFGTMAARAVIRDVGRALNYPYAEVDVIAKMIPFELGMTI 465

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                ++ +   +     D  V +L++IS+ LEGL RHASTHAAG+VI   PL   VP+ +
Sbjct: 466  DKA-LSLNPELKVRYENDERVKQLIDISRSLEGLPRHASTHAAGVVISKEPLVNYVPLQK 524

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDDH 606
            +   D  VTQF M  +E+ GL+K DFLGL+TLT+++ +++ + +   V +D   + +DD 
Sbjct: 525  N--EDSIVTQFPMTTLEELGLLKMDFLGLRTLTVIRDTIEMVKKNKGVTIDFDSMEYDDP 582

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            + Y L++   T G+FQLESSGM+Q +  ++P  +EDIIA +SLYRPGP+D I  Y   KN
Sbjct: 583  KVYELISKGETEGVFQLESSGMKQFMTELKPKNLEDIIAGISLYRPGPMDQIPRYLANKN 642

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E IV  HPL+ P+L  T G ++YQEQVMQI + ++GYSL  AD++RRAM KK  + M+
Sbjct: 643  HPESIVYDHPLLKPILDVTYGCMVYQEQVMQIVRDVAGYSLGRADLVRRAMAKKKMDVME 702

Query: 727  KQKERFISGAS------------KNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI G              +NG+ ++ A  +F+ +  FA+Y FNKSHAAAYAVI+Y
Sbjct: 703  QERKNFIYGMVDDEGNVIVPGALRNGLDESTANKLFDEMLDFANYAFNKSHAAAYAVIAY 762

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTA++K +YPVEF+AA +   +DN++KI  +    ++  I+++PP +N     F V +++
Sbjct: 763  QTAYLKRYYPVEFMAALLNSFVDNLDKIAFYVHVCKKMGIKVLPPDINESDSYFTVVEDK 822

Query: 835  IYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + L+A+K VG      I+     +  F S+ DF  R+   +LN++ +ESL+ AGA   
Sbjct: 823  IRFGLSAVKNVGLNMTMEIVSERERNGKFKSVVDFFERMQDSQLNKKAVESLIKAGAFSS 882

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFE 953
            FG  R QLL   D + +  +    N  N   ++F   +     +           S    
Sbjct: 883  FGVRRSQLLSVYDKLMENIKKNRNNNINGQISLFGEIEQKHGVEFEFPDLEEFPKSRLLS 942

Query: 954  NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV---------ATIRGNNIRLAAMVVSK 1004
             E+  LG Y SGHPL+ Y   + K+      +                  + +A ++ +K
Sbjct: 943  MEKETLGLYISGHPLEEYVEDIPKITNATTLDFKVSEEEMFQPKLRDNQEVVIAGVISTK 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + K T+  + + +VT  +     E   FP
Sbjct: 1003 KIKFTKSNNMMAFVTIEDLYGTVEVIVFP 1031


>gi|289578818|ref|YP_003477445.1| DNA polymerase III subunit alpha [Thermoanaerobacter italicus Ab9]
 gi|289528531|gb|ADD02883.1| DNA polymerase III, alpha subunit [Thermoanaerobacter italicus Ab9]
          Length = 1145

 Score =  839 bits (2168), Expect = 0.0,   Method: Composition-based stats.
 Identities = 385/1049 (36%), Positives = 599/1049 (57%), Gaps = 45/1049 (4%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL VHS YSLL+G+  + +++ K       AIAITD   ++  ++F ++A A GI+PI
Sbjct: 2    FAHLHVHSEYSLLDGSCRIKDLIAKTKELNMKAIAITDHGVMYGVIDFYKEAVAHGIKPI 61

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +  +    M ++          +VLL     GY+ L+++V+   + +      R
Sbjct: 62   IGCEIYVAPRS---MRDREYGIDNENYHLVLLAKDMVGYKNLMKIVTMASI-EGFYYKPR 117

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +   +L+E  ++GLI L+   +G +         + A++  L +  +FG    Y+ LQ H
Sbjct: 118  VDKEFLKE-HSKGLIALSACLAGEVPSYILRGEYEKAKEAALFYDSIFGRGNFYLELQDH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP-R 247
               ++     ++++L+    +PLVATN+  +L ++D +AH+VL+ +     +  +DR   
Sbjct: 177  GILEQQKVNKELIRLSKETGIPLVATNDVHYLDKKDAKAHEVLLCIQTGKTIDDEDRMSF 236

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM ++FS   EA+ENT +IA  C+   + +   LP++   E  D     
Sbjct: 237  PTDEFYLKSPEEMENLFSYCKEAIENTEKIASMCNVEFEFNKTKLPKYDLPEGVDSY--- 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               LRN    GL  R            ++  +RLD+EL+VI +M +  YFLIV DFI++A
Sbjct: 294  -EYLRNLCYEGLYKRYKN-------PNKEVIERLDYELSVIKQMGYVDYFLIVWDFIKFA 345

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K N I  GPGRGS AGS+ AY L IT+IDP++++LLFERFLNP+R+SMPD D DFC +RR
Sbjct: 346  KDNGIMTGPGRGSAAGSLVAYTLGITNIDPIKYNLLFERFLNPERVSMPDIDSDFCYERR 405

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG + VAQIITFG++ A+A +RDVGRAL  PY++VD + K+IP +    +
Sbjct: 406  QEVIDYVVKKYGKDNVAQIITFGTMAARAVIRDVGRALNYPYAEVDVIAKMIPFELGMTI 465

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                ++ +   +     D  V +L++IS+ LEGL RHASTHAAG+VI   PL   VP+ +
Sbjct: 466  DKA-LSLNPELKVRYENDERVKQLIDISRSLEGLPRHASTHAAGVVISKEPLVNYVPLQK 524

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDDH 606
            +   D  VTQF M  +E+ GL+K DFLGL+TLT+++ +++ + +   V +D   + +DD 
Sbjct: 525  N--EDSIVTQFPMTTLEELGLLKMDFLGLRTLTVIRDTIEMVKKNKGVTIDFDSMEYDDP 582

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            + Y L++   T G+FQLESSGM+Q +  ++P  +EDIIA +SLYRPGP+D I  Y   KN
Sbjct: 583  KVYELISKGETEGVFQLESSGMKQFMTELKPKNLEDIIAGISLYRPGPMDQIPRYLANKN 642

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E IV  HPL+ P+L  T G ++YQEQVMQI + ++GYSL  AD++RRAM KK  + M+
Sbjct: 643  HPESIVYDHPLLKPILDVTYGCMVYQEQVMQIVRDVAGYSLGRADLVRRAMAKKKMDVME 702

Query: 727  KQKERFISGAS------------KNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI G              +NG+ ++ A  +F+ +  FA+Y FNKSHAAAYAVI+Y
Sbjct: 703  QERKNFIYGMVDDEGNVIVPGALRNGLDESTANKLFDEMLDFANYAFNKSHAAAYAVIAY 762

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTA++K +YPVEF+AA +   +DN++KI  +    ++  I+++PP +N     F V +++
Sbjct: 763  QTAYLKRYYPVEFMAALLNSFVDNLDKIAFYVHVCKKMGIKVLPPDINESDSYFTVVEDK 822

Query: 835  IYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + L+A+K VG      I+     +  F S+ DF  R+   +LN++ +ESL+ AGA   
Sbjct: 823  IRFGLSAVKNVGLNMTMEIVSERERNGKFKSVVDFFERMQDSQLNKKAVESLIKAGAFSS 882

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFE 953
            FG  R QLL   D + +  +    N  N   ++F   +     +           S    
Sbjct: 883  FGVRRSQLLSVYDKLMENIKKNRNNNINGQISLFGEIEQKHGVEFEFPDLEEFPKSRLLS 942

Query: 954  NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV---------ATIRGNNIRLAAMVVSK 1004
             E+  LG Y SGHPL+ Y   + K+      +                  + +A ++ +K
Sbjct: 943  MEKETLGLYISGHPLEEYVEDIPKITNATTLDFKVSEEEMFQPKLRDNQEVVIAGVISTK 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + K T+  + + +VT  +     E   FP
Sbjct: 1003 KIKFTKSNNMMAFVTIEDLYGTVEVIVFP 1031


>gi|167039837|ref|YP_001662822.1| DNA polymerase III DnaE [Thermoanaerobacter sp. X514]
 gi|300915388|ref|ZP_07132702.1| DNA polymerase III, alpha subunit [Thermoanaerobacter sp. X561]
 gi|307724839|ref|YP_003904590.1| DNA polymerase III subunit alpha [Thermoanaerobacter sp. X513]
 gi|166854077|gb|ABY92486.1| DNA polymerase III, alpha subunit [Thermoanaerobacter sp. X514]
 gi|300888664|gb|EFK83812.1| DNA polymerase III, alpha subunit [Thermoanaerobacter sp. X561]
 gi|307581900|gb|ADN55299.1| DNA polymerase III, alpha subunit [Thermoanaerobacter sp. X513]
          Length = 1145

 Score =  839 bits (2167), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/1049 (36%), Positives = 602/1049 (57%), Gaps = 45/1049 (4%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VHS YSLL+G+  + +++ K       AIAITD   ++  ++F ++A A GI+PI
Sbjct: 2    FVHLHVHSEYSLLDGSCRIKDLIAKTKELNMKAIAITDHGVMYGVIDFYKEAVAQGIKPI 61

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +  +    M ++          +VLL     GY+ L+++V+   + +      R
Sbjct: 62   IGCEIYVAPRS---MQDREYGIDNENYHLVLLAKDMTGYKNLMKIVTVASI-EGFYYKPR 117

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +   +L+E  +EGLI L+   +G +         + A++  L +  +FG    Y+ LQ H
Sbjct: 118  VDREFLKE-HSEGLIALSACLAGEVPSYILRGEYEKAKEAALFYDSIFGRGNFYLELQDH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP-R 247
               ++     ++++L+    +PLVATN+  +L ++D +AH+VL+ +     +  +DR   
Sbjct: 177  GILEQQKVNKELIRLSKETGIPLVATNDVHYLEKKDAKAHEVLLCIQTGKTIDDEDRMSF 236

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM ++FS   EA+ENT +IA  C+   + +   LP++   E  D     
Sbjct: 237  PTDEFYLKSPEEMENLFSCCKEAIENTEKIADMCNVEFEFNKTKLPKYDLPEGVDSC--- 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               LRN    GL  R           +++  +RLD+EL+VI +M +  YFLIV DFI++A
Sbjct: 294  -EYLRNLCYEGLYKRYKN-------PSKEVIERLDYELSVIEQMGYVDYFLIVWDFIKFA 345

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K N I  GPGRGS AGS+ AY L IT+IDP++++LLFERFLNP+R+SMPD D DFC +RR
Sbjct: 346  KDNGIMTGPGRGSAAGSLVAYTLGITNIDPIKYNLLFERFLNPERVSMPDIDSDFCYERR 405

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG + VAQIITFG++ A+A +RDVGRAL   Y++VD + K+IP +    +
Sbjct: 406  QEVIDYVVKKYGKDNVAQIITFGTMAARAVIRDVGRALNYLYAEVDVIAKMIPFELGMTI 465

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                ++ +   +     +  V +L++IS+ LEGL RHASTHAAG+VI   PL   VP+ +
Sbjct: 466  DKA-LSLNPELKARYENEEKVKQLIDISRSLEGLPRHASTHAAGVVISKEPLVNYVPLQK 524

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSLIPFDDH 606
            +   D  VTQF M  +E+ GL+K DFLGL+TLT+++ +++     RGV +D   + +DD 
Sbjct: 525  N--EDSIVTQFPMTTLEELGLLKMDFLGLRTLTVIRDTIEMVEKNRGVTIDFDSMEYDDP 582

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            + Y L++   T G+FQLESSGM+Q +  ++P  +EDIIA +SLYRPGP+D I  Y   +N
Sbjct: 583  KVYELISKGETEGVFQLESSGMKQFMAELKPKNLEDIIAGISLYRPGPMDQIPRYLANRN 642

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E IV  HPL+ P+L  T G ++YQEQVMQI + ++GYSL  +D++RRAM KK  + M+
Sbjct: 643  HPESIVYDHPLLKPILDVTYGCMVYQEQVMQIVRDVAGYSLGRSDLVRRAMAKKKMDVME 702

Query: 727  KQKERFISG------------ASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI G            A +NG+ +  A  +F+ +  FA+Y FNKSHAAAYAVI+Y
Sbjct: 703  QERKNFIYGIVDEEGNVIVPGALRNGLDEATANKLFDEMLDFANYAFNKSHAAAYAVIAY 762

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTA++K +YPVEF+AA +   +DN++K+  + Q  R+  I+++PP +N     F V +++
Sbjct: 763  QTAYLKRYYPVEFMAALLNSFVDNLDKVAFYVQVCRKMGIKVLPPDINESDSYFTVVEDK 822

Query: 835  IYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + L+A+K VG      I+     +  F S+ DF  R+   +LN++ +ESL+ AGA   
Sbjct: 823  IRFGLSAVKNVGLNMTMEIVSERERNGKFKSVVDFFERMQDSQLNKKAVESLIKAGAFSS 882

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFE 953
            FG  R QLL + D + +  +    N  N   ++F   + T               S    
Sbjct: 883  FGVRRSQLLSAYDKLMENIKKNRNNNLNGQISLFGEVEQTHGVGFEFPDLEEFPKSRLLS 942

Query: 954  NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV---------ATIRGNNIRLAAMVVSK 1004
             E+  LG Y SGHPL+ Y   + K+      +                  + +A ++ +K
Sbjct: 943  MEKETLGLYISGHPLEEYMEDIPKITNATTLDFKVSEEEMFQPKLQDNQEVVIAGVIATK 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + K T+  + + +VT  +     E   FP
Sbjct: 1003 KIKFTKNNNIMAFVTIEDLYGTVEVIVFP 1031


>gi|83590706|ref|YP_430715.1| DNA polymerase III DnaE [Moorella thermoacetica ATCC 39073]
 gi|83573620|gb|ABC20172.1| DNA polymerase III catalytic subunit, DnaE type [Moorella
            thermoacetica ATCC 39073]
          Length = 1156

 Score =  839 bits (2167), Expect = 0.0,   Method: Composition-based stats.
 Identities = 399/1031 (38%), Positives = 604/1031 (58%), Gaps = 27/1031 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL VHS YSLL+GA  + +++        PA+A+TD   ++ A+EF + A   GI+P
Sbjct: 3    SFVHLHVHSEYSLLDGAGRIKDLVRAAGEMGMPALALTDHGVMYGAVEFYKAAREQGIKP 62

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +                  +VLL + A GY+ L  LVS  +L +      
Sbjct: 63   IIGCEVYVAPRSRHDREPH---RDDYQYHLVLLATDATGYRNLTALVSAAFL-EGFYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L    ++GLI L+   +G +      N    A +     +++FG +  Y+ LQ 
Sbjct: 119  RVDRELLSR-HSQGLIALSACLAGEVPAHLLKNREDAAYEAATWLREVFGPENFYLELQD 177

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
                ++     ++V LA   ++PLVATN+  ++ ++   AHDVL+ +     +   +R R
Sbjct: 178  QGLPEQRQLNRRLVDLAARLKIPLVATNDVHYIRQDQARAHDVLLCIQTGKTLDDPNRLR 237

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T   YLK+ +EM ++F ++P AL NT+ IA RC F        LP +     +D    
Sbjct: 238  FPTAQFYLKSPAEMDNLFREVPSALANTLAIAERCHFDFTFGRLHLPAYQVPAGED---- 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
              + LR  +  GL+ R               RQRL++EL +I +M + GYFLIV D + +
Sbjct: 294  AASYLRRLSYEGLKRRYPHDDGTA-------RQRLEYELGIIEQMGYPGYFLIVWDMVNF 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A++  IPVGPGRGS AGS+ AY L IT IDPLR++LLFERFLNP+R+SMPD D+DFC +R
Sbjct: 347  ARRRGIPVGPGRGSAAGSLVAYCLGITSIDPLRYNLLFERFLNPERVSMPDIDMDFCFER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            RDEVI+YV  KYG + VAQIITFG++ A+AA+RDVGR L +P  +VDR+ K++P +    
Sbjct: 407  RDEVIQYVLEKYGRDHVAQIITFGTMAARAAVRDVGRVLGLPLGEVDRIAKMVPMELGIT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+A     +E+   +  V  LL+ ++ +EG+ RHAS HAAGIVI   PL   +P+ 
Sbjct: 467  LE-RALATSPDLKESYEGNREVRELLDTARAIEGMPRHASIHAAGIVITREPLIHYLPLQ 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLL-QKSLDFLAQRGVKVDLSLIPFDD 605
            +    D   TQ+ M+ +E+ GL+K D LGL+TLT++           G ++DL  +P DD
Sbjct: 526  K--TGDAVTTQYPMQAVEELGLLKMDLLGLRTLTVIGHAREAIRRNHGRELDLESLPLDD 583

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNN 663
              TY LL +  T GIFQLESSGMR  L+ ++P+  EDIIALV+LYRPGP+ + +   +  
Sbjct: 584  RPTYQLLASGETSGIFQLESSGMRAILKELKPERFEDIIALVALYRPGPLGSGMVEDFIK 643

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G   I  +HP ++P+LK+T GVI+YQEQVM+IA  L+G++L +AD+LRRAMGKK  E
Sbjct: 644  RKHGVTPISYLHPALEPILKDTYGVILYQEQVMRIASELAGFTLGQADLLRRAMGKKKPE 703

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             +  Q++RF++GA    I + +A  IFEL+  FA YGFN SH+AAYA+++YQTA++K HY
Sbjct: 704  VLAAQRDRFLAGAEAKAIPRDVAQKIFELMEYFAGYGFNASHSAAYALVAYQTAYLKAHY 763

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            P E + A ++   ++++K++ +  + ++  I ++PP VN   VDF V   +I + LAA+K
Sbjct: 764  PAELMGALLSSVAEHLDKMEPYLAECQRLGIAVLPPDVNESGVDFTVTGRQIRFGLAAVK 823

Query: 844  G-VGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
                      I    A  PF SL DFC RVDS++ N+RV+ESL+  GA +    +R QLL
Sbjct: 824  NAGRAAALAIIAAREAGGPFTSLLDFCRRVDSRQANKRVVESLIRCGAFNSINPNRRQLL 883

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFY 962
              LD   + A   +++R +   ++        +D   L + +  + +     E+ +LGFY
Sbjct: 884  AGLDECLEVAARRQEDRRSGQVSLMDLVPEEVND-PPLPQVTDFSRADILAMEKELLGFY 942

Query: 963  FSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSE 1022
             SGHPL+ Y P+L+K+      +      G+ + +  +V   ++  TRKG  +  +T  +
Sbjct: 943  LSGHPLEPYAPVLKKLTSHSLADLAEIADGSQVTIGGLVSGLRRLVTRKGDPMAVLTLED 1002

Query: 1023 PAKEYEANFFP 1033
             + + EA  FP
Sbjct: 1003 FSGQVEAVLFP 1013


>gi|329929691|ref|ZP_08283383.1| putative DNA polymerase III subunit alpha [Paenibacillus sp. HGF5]
 gi|328935954|gb|EGG32411.1| putative DNA polymerase III subunit alpha [Paenibacillus sp. HGF5]
          Length = 1242

 Score =  839 bits (2166), Expect = 0.0,   Method: Composition-based stats.
 Identities = 397/1046 (37%), Positives = 612/1046 (58%), Gaps = 32/1046 (3%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
             SFVHL VHS YSLL+GA  + +++ + AA    ++A+TD   ++ A+ F +   A GI+
Sbjct: 2    SSFVHLHVHSEYSLLDGAARIGDLVREAAALGMKSLALTDHGVMYGAVPFYKACLAQGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC+  I      +   +G      +  ++LL     GY+ L++L S  +L +     
Sbjct: 62   PIIGCEAYITAGSRKE---RGSRKDQPIYHLILLAKNETGYRNLMKLCSIGHL-EGYHYR 117

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             RI +  L     EG+I L+    G + +         A+   L ++ +FG+  Y+ LQ 
Sbjct: 118  PRIDMEALAA-HHEGIICLSACLGGEVPQHLLHGREAEAKAAALRYQAIFGEDYYLELQD 176

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++ R   Q++QL+    +PLVATN+  +L+E D E  DVL+ +     V  +DR +
Sbjct: 177  HGIPEQKRVNPQLIQLSRETGIPLVATNDVHYLTENDAEVQDVLICIGTGKTVEDEDRLQ 236

Query: 248  -VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T   YLK+ S+M  ++  +PEA+ NT +IA +C   L+    ILP +         K+
Sbjct: 237  IQTNQLYLKSGSDMERLYPHVPEAILNTAKIADQCRLELEFGKSILPEYSS---LPEGKD 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGY-HAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
                LR+  ++GL  R       +      +  QRLD+EL VI  M FS YFLIV DFI 
Sbjct: 294  AAEYLRDLCLSGLRERYEGTERWQDEGQRSELEQRLDYELGVIESMGFSDYFLIVWDFIA 353

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            +A +  I VGPGRGS AGS+ AY L IT++DP+++ LLFERFLNP+R++MPD DIDF  +
Sbjct: 354  YAHRKGIAVGPGRGSSAGSLVAYTLQITNVDPMKYKLLFERFLNPERITMPDIDIDFSDE 413

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RRDEVI YV +KYG E VAQIITFG++ A+AA+RDVGRAL +P+  VD+  KLIPN    
Sbjct: 414  RRDEVIDYVVDKYGKEHVAQIITFGTMAARAAVRDVGRALNVPFGDVDKAAKLIPNHLGI 473

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
             +  +A+    + +E     P V  L++++ K+EG+ RHASTHAAGIVI   PL+  VP+
Sbjct: 474  SIE-RAMEQSPQLKEQYETKPKVRELIDMAMKVEGMPRHASTHAAGIVISREPLTDAVPL 532

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFD 604
              +      +TQ++M+ +E  GL+K DFLGL+TL++++++L ++ +  G ++D   +P D
Sbjct: 533  Q-EGSEKTALTQYSMENLESVGLLKMDFLGLRTLSIIERTLRWIQELTGRELDFDQVPDD 591

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNR 664
            D  TY +L    T G+FQLES+G+R+ L+ ++P   EDI+++ +LYRPGP++ I  +   
Sbjct: 592  DQATYEMLGRGETAGVFQLESAGIRRVLKDLKPSVFEDIVSVNALYRPGPMEFIPKFIQA 651

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G+ +    HP + P+L +T G+I+YQEQ+MQIA  ++G+SL EAD+LRRA+ KK +E 
Sbjct: 652  KHGRIEPEYPHPDLIPILGDTYGIIVYQEQIMQIASTMAGFSLGEADLLRRAVSKKKREV 711

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            +D+++  F+SG+ K G ++  A  +++++ +FA+YGF ++HAAAY V+++QTA++K HYP
Sbjct: 712  LDRERSHFVSGSLKLGYTEDEANRVYDMIVRFANYGFPRAHAAAYGVLAFQTAYLKAHYP 771

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVG------------- 831
            V F+A+ +T  M +  K+ ++  +AR+ +I++MPP VN     F                
Sbjct: 772  VPFMASMLTAVMGSHRKVAEYVLEARRIDIEVMPPDVNESGTYFTPVMSRSAAEGSELQA 831

Query: 832  ----DNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVF 887
                   I + LAAIK VGT    +I+E   +KPF+SL DFC RVD +  N+RV+ESL+ 
Sbjct: 832  DSPAGGGIRFGLAAIKNVGTQAVENIVEIRREKPFESLLDFCRRVDLRVCNKRVIESLIQ 891

Query: 888  AGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVEN 947
            AGA D     R QL+  LD   + A    K R +    +F   +    D I         
Sbjct: 892  AGAFDSLQGHRSQLVAMLDETVEAAVKWRKERDDLQIQLFDFVETANWD-IEYPDIPSYT 950

Query: 948  SSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQK 1007
            +S + E E+ +LG Y SGHPLD ++  L + G     +       +   +A MVVS +  
Sbjct: 951  ASQQLEFERELLGMYLSGHPLDGFEETLTESGADRLMDLHEAEDESMATVAGMVVSLKTI 1010

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             T++G  + ++   +  +  E   FP
Sbjct: 1011 TTKQGKAMAFMECEDQIERCEVVLFP 1036


>gi|39996502|ref|NP_952453.1| DNA polymerase III subunit alpha [Geobacter sulfurreducens PCA]
 gi|39983383|gb|AAR34776.1| DNA polymerase III, alpha subunit [Geobacter sulfurreducens PCA]
 gi|298505519|gb|ADI84242.1| DNA polymerase III, alpha subunit [Geobacter sulfurreducens KN400]
          Length = 1155

 Score =  839 bits (2166), Expect = 0.0,   Method: Composition-based stats.
 Identities = 419/1027 (40%), Positives = 612/1027 (59%), Gaps = 14/1027 (1%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL +H+ YSLL+GA+ L +++ K+ +   PA+AITD   +F A+EF  K     ++P
Sbjct: 2    SFVHLHLHTQYSLLDGAIRLGDLVKKVKSHDMPAVAITDHGAMFGAMEFYLKCKDKDVKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            +IG ++ I          +G         ++LL     GY+ L +LVS  +  +      
Sbjct: 62   VIGAEVYIAPGSRFVKEARGGEA-GAGYHLLLLCENMTGYRNLSKLVSIGF-KEGFYYKP 119

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            RI    L E   EGLI L+    G +      +    A      +  LF DR Y+ LQ +
Sbjct: 120  RIDKEVLAE-NAEGLICLSACLKGEVAYLCERDRVAEAVDVARWYADLFPDRYYIELQEN 178

Query: 190  RGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++ +    ++++A    LPLVATN+  +L+ ED  AH+VL+ +     ++   R R 
Sbjct: 179  GLVEQDKANRGLLEVAREVGLPLVATNDCHYLNREDARAHEVLLCIQTGKTMNDPSRMRF 238

Query: 249  T-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
            +  + Y+K   EM + F   PEA+ NTV+IA RC           PRF       + +  
Sbjct: 239  SVDEFYVKTPEEMAAAFHYAPEAISNTVKIAERCDLSFDFKTYHFPRFEPPVGLSLDQML 298

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            E   R    + L    A+ +       Q Y  RL  EL  I +M F GYFLIVADFI WA
Sbjct: 299  EEAARTGLESRLTAIRAKHSSMTAEQEQAYWDRLAIELACIKQMGFPGYFLIVADFINWA 358

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K + IPVGPGRGS AGS+ AYA+ ITD+DP+ ++LLFERFLNP+R+SMPD D+DFCQDRR
Sbjct: 359  KDHGIPVGPGRGSAAGSLVAYAIRITDLDPIPYNLLFERFLNPERISMPDIDVDFCQDRR 418

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
            +EVI+YV  KYG ++V QIITFG++ A+A +RDVGRAL M Y +VDR+ KL+P      +
Sbjct: 419  EEVIQYVTEKYGRDKVCQIITFGTMSARAVIRDVGRALDMTYGEVDRIAKLVPEVLGITL 478

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                IA + +  EA  ADP V  LLE++ +LEGL RHASTHAAG+V+    L Q  P+Y+
Sbjct: 479  EKA-IAQEPKLNEAAEADPRVKELLEVALRLEGLARHASTHAAGVVVAPDVLEQFCPVYK 537

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSL-DFLAQRGVKVDLSLIPFDDH 606
            D +S    TQ++MK++EK GL+KFDFLGLK LT++  ++    A +    D++ +  DD 
Sbjct: 538  DQKSGSLTTQYSMKYVEKIGLVKFDFLGLKNLTVIFNAVRHIRADKKPDFDIAALRDDDE 597

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNNR 664
            E+Y LL    T G+FQLESSGMR+ L  ++P C EDIIA+ +LYRPGP+ + +   + +R
Sbjct: 598  ESYKLLQAGNTTGVFQLESSGMRELLRKLKPSCFEDIIAVCALYRPGPLGSGMVDDFIDR 657

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G++K+V   P ++P+LK+T GVI+YQEQVMQIA+ L+GYSL  AD+LRRAMGKK   E
Sbjct: 658  KHGRKKVVYDLPQLEPILKDTYGVIVYQEQVMQIARSLAGYSLGGADLLRRAMGKKDPAE 717

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            M KQ++ F+ GA  NGI    A  IF+L+AKFA+YGFNKSH+AAYA+++YQTA++K HYP
Sbjct: 718  MAKQRDIFLEGAKNNGIDLQKAGAIFDLMAKFAEYGFNKSHSAAYALVAYQTAYLKAHYP 777

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKG 844
            VEF+AA +T +M N +K+ K   D R+  I+++PP +N   + F+V  N I + L A+K 
Sbjct: 778  VEFMAALLTEDMANTDKVVKNIADCREMGIEVLPPDINASDLSFRVLGNSIRFGLGAVKN 837

Query: 845  VGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQS 904
            VG +    I+EA  D PF  + +FC RVD +K+N+RV+ESL+  GA D  G  R QL  +
Sbjct: 838  VGESAIEAIIEARGDGPFKDIFEFCERVDLRKVNKRVVESLIKCGAFDSTGGRRSQLTAA 897

Query: 905  LDNIQKYAQWVEKNRTNKHENIFAHEK-----GTFSDKITLEKFSVENSSVRFENEQRVL 959
            L++     Q +++ + +   ++F  E+     G    K+ L      +       E+  L
Sbjct: 898  LEDAMSLGQKIQQEKESAQVSLFGAEEIVRTNGNGKGKVQLPDLPEWDDKFLLAQEKEAL 957

Query: 960  GFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVT 1019
            GF+ +GHPL  ++  +R+               + +++  +V + ++  T+KG R+ + T
Sbjct: 958  GFFITGHPLGRHEKDIRRFTTADTATLEERADKSEVKICGIVATMKELMTKKGDRMAFAT 1017

Query: 1020 FSEPAKE 1026
              +    
Sbjct: 1018 LEDLVGS 1024


>gi|297617868|ref|YP_003703027.1| DNA polymerase III subunit alpha [Syntrophothermus lipocalidus DSM
            12680]
 gi|297145705|gb|ADI02462.1| DNA polymerase III, alpha subunit [Syntrophothermus lipocalidus DSM
            12680]
          Length = 1131

 Score =  838 bits (2165), Expect = 0.0,   Method: Composition-based stats.
 Identities = 400/1030 (38%), Positives = 611/1030 (59%), Gaps = 25/1030 (2%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL  HS YSLL+GA+ +++++ +      PA+AITD   L+  ++F ++A  AGI+PI
Sbjct: 4    FVHLHTHSEYSLLDGAVRVSSLVKRAKELGMPALAITDHGVLYGVIDFYKQARKAGIKPI 63

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +  +     T +       +  + LL    +GY+ L+++VS+ +L +      R
Sbjct: 64   IGCEVYVAPRHRFDRTPK---VDDALYHLTLLCENQDGYRNLVQMVSKAFL-EGFYYKPR 119

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDR-LYVNLQRH 189
            +    L++ G  GLI L+G  +G +       + + A      F+++FG+   ++ +Q H
Sbjct: 120  VDKELLEQHGR-GLIALSGCIAGEVPELLLAGNYEEARAVAGYFREVFGENNFFLEVQDH 178

Query: 190  RGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++      +  L+   ++PLVATN+  +L+ +D   HDVL+ +    V++ + R R 
Sbjct: 179  GLSEQRVVNEAMCHLSRELDVPLVATNDVHYLNRDDAFIHDVLLCIQTGKVLTDESRMRF 238

Query: 249  TPDHYLKNR-SEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
                +      EM S+F+ +PEA+ NTV IA RCS      +  LP F   E        
Sbjct: 239  PCPEFYFKSGEEMSSLFAHIPEAVTNTVTIAERCSVDFGFDSFCLPEFPLPEG----ATA 294

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            E+ L + A   L  R A               RL  EL+VI RM F+GYFLIV D + WA
Sbjct: 295  ESYLEDLAWKKLRERFAHPGT-------KVIDRLRLELDVINRMGFAGYFLIVQDLVHWA 347

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K   I VGPGRGS AGS+ +Y L ITDI+PL + LLFERFLNP+R++MPD DIDFC ++R
Sbjct: 348  KNRGIRVGPGRGSAAGSLVSYVLGITDINPLEYGLLFERFLNPERITMPDIDIDFCFEKR 407

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
            D+VI YV  KYG +RVAQIITFG++ A+AA+RDVGR L+ PYS+VDR+ K++P +    +
Sbjct: 408  DQVINYVIEKYGSDRVAQIITFGTMAARAAIRDVGRVLEYPYSEVDRIAKMVPAELGISL 467

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                +       EA   D  V RL++ ++ LEG  RHAS HAAG+VIG   LS+++P+ R
Sbjct: 468  DRA-LEVSGDLAEAYKNDFRVRRLVDTARALEGFPRHASVHAAGVVIGRESLSRVLPLQR 526

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
                   VTQF  + +E+ GL+K D LGL+TLT++ + LD + + RG ++D+  I  DD 
Sbjct: 527  TA-DGHVVTQFTKETVEEIGLLKMDILGLRTLTVIDRCLDIIRKTRGYEIDIDHISLDDP 585

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNNR 664
            +TY LL+   T+G+FQLES G+R+ L+ ++P   ED+IA+++LYRPGP+ + +   + NR
Sbjct: 586  DTYRLLSEGDTVGVFQLESEGLRRLLQEVRPSSFEDLIAIIALYRPGPLGSGMVEDFVNR 645

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G++ I  +HP ++P+L+ET GVI+YQEQVM+IA  L+ +S+ EADVLRRAMGKK  +E
Sbjct: 646  KHGRQPIEYLHPKLEPILRETYGVILYQEQVMRIASELADFSMGEADVLRRAMGKKKPDE 705

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            +  Q+ +F+ GA +NGI +  A ++FEL+  FA YGFNKSH+AAYA++SYQTA++K HYP
Sbjct: 706  LAAQRNKFVEGAYRNGIDRETASSLFELMEHFAGYGFNKSHSAAYALVSYQTAYLKAHYP 765

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKG 844
            VE++ A +T  +DN +++  + ++ R+  + I+PP +N    +F V   RI + L AIK 
Sbjct: 766  VEYMCAFLTSVIDNQDRVVYYLKECRRMGMDILPPDINESFENFTVAGGRIRFGLGAIKN 825

Query: 845  VGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQS 904
            VG    R I+EA  +  F SL +FC RVD ++LN+RV+E+L+ AGA D  G  R + L  
Sbjct: 826  VGINAVRSIIEARKEGRFSSLLEFCLRVDLRQLNKRVMENLILAGAFDSLGLKRKEALSL 885

Query: 905  LDNIQKYAQWVEKNRTNKHENIF-AHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
            LD     A  V     +   ++F      T             +   + + E+ VLGFY 
Sbjct: 886  LDECLALAVEVRAAMDSAQPSLFVDDAAATVVQDPVPRSKGEFSVQEKLKKEKEVLGFYV 945

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEP 1023
            S +PL+ Y+ ++  +      E      G  +R+ A V + ++ +++KG     +   + 
Sbjct: 946  SQNPLEEYREVIPYLMSHEISELSKLDEGQVVRIVATVTAMKRSRSKKGEPWARLVLEDF 1005

Query: 1024 AKEYEANFFP 1033
              + EA  FP
Sbjct: 1006 TGKVEAVVFP 1015


>gi|295100819|emb|CBK98364.1| DNA polymerase III catalytic subunit, DnaE type [Faecalibacterium
            prausnitzii L2-6]
          Length = 1170

 Score =  837 bits (2162), Expect = 0.0,   Method: Composition-based stats.
 Identities = 374/1045 (35%), Positives = 585/1045 (55%), Gaps = 40/1045 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
             FVHL +H+ YSLL+GA  ++ ++D++    Q AIAITD   ++  ++F + A  AGI+P
Sbjct: 13   DFVHLHIHTEYSLLDGACRIDQLMDRVKECGQSAIAITDHGVMYGCVQFYKAAKKAGIKP 72

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            +IGC++ +  +      N+          ++LL     GY+ LI++VS  + ++      
Sbjct: 73   VIGCEVYVATRTRFDKVNK----IDGNNHLILLCKNETGYKNLIKMVSAAF-VEGFYSKP 127

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L++   EGLI L+   +G I +A      + A+   L ++ LFG    Y+ LQ 
Sbjct: 128  RVDKQLLEQYH-EGLICLSACLAGEIPQAILAGDYERAKSTALWYQDLFGKGNYYIELQD 186

Query: 189  HR-GYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H    D     Q+++LA    +P+ ATN+S +L ++D +   +L+ +     +   DR  
Sbjct: 187  HGLEEDTIVLPQLIKLARETGIPMAATNDSHYLRKDDAKMQSILLCIQTGKTIQDADRME 246

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T + Y+K   EM  +F+ +PEA  NT +IA +C+F        +P +      D Q  
Sbjct: 247  FRTDEFYVKTTDEMYELFAMVPEACANTQKIADQCNFDFDFGHTKIPYYKAPNGMDNQ-- 304

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                       GLE R            Q  + RL +E+ V+  M ++ Y+LIV D+I +
Sbjct: 305  --EFFEKLCWDGLERRYGSDV------PQSNKDRLTYEIGVVKSMGYTNYYLIVWDYINY 356

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK   IPVGPGRGSGAGS+ AY + ITDIDP+R++L+FERFLNP+R+SMPDFD+DFC +R
Sbjct: 357  AKSQGIPVGPGRGSGAGSIAAYCVGITDIDPIRYNLIFERFLNPERVSMPDFDVDFCYER 416

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG + VAQI+TFG++ A+ A+RDVGR + MPY  VD + K +P +    
Sbjct: 417  RQEVIDYVNRKYGADHVAQIVTFGTMAARNAIRDVGRVMGMPYQSVDVVAKQVPMELKMT 476

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +    +      +    +DP V  L++ + K+EG+ RHASTHAAG+VI   P    +P+ 
Sbjct: 477  LKRA-LEVSPELKRMYDSDPQVTELIDTALKVEGMPRHASTHAAGVVITPEPTDYYLPL- 534

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
                  LPVTQFNM  IE+ GL+K DFLGL+TLT+++ +   + ++     +  + +DD 
Sbjct: 535  -ATNDGLPVTQFNMTEIEELGLLKMDFLGLRTLTVIRDAEAAVQKKDPSFSIQKLDYDDA 593

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
             TY +L    T G+FQLESSGM+Q L G+QP  +ED+IAL+SLYRPGP+D+I  Y   ++
Sbjct: 594  ATYKMLGQGETEGVFQLESSGMKQVLVGLQPQNLEDVIALISLYRPGPMDSIPTYLRNRH 653

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              +KI    P +  +L  T G I+YQEQVMQI + L+G+S  +AD +RRAM KK    M+
Sbjct: 654  EPDKISYKTPQLAHILDVTNGCIVYQEQVMQIFRELAGFSFGQADNVRRAMSKKKHAVME 713

Query: 727  KQKERFISGASKNGI----------SKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQT 776
             ++E F+ G ++ G           S+ +A  I++ ++ FA Y FNKSHAA YA +++QT
Sbjct: 714  AEREHFVHGCTEPGHECPGCVANGISEEVANEIYDEMSSFASYAFNKSHAACYAYVAFQT 773

Query: 777  AWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIY 836
            A++K HYP EF+AA +T  +DN +K+ ++  +  +  ++++PP VN     F   + +I 
Sbjct: 774  AYLKCHYPSEFMAALLTSVLDNTDKVIEYSGECARLGLKVLPPDVNISNGGFTADNGKIR 833

Query: 837  YSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
            + L A+K VG      ++E   +KP+ SL DFC R+   +LNRR +E L+ AGA D  G 
Sbjct: 834  FGLNAVKNVGRNLIERVVEERKEKPYSSLYDFCKRMHGTELNRRAVECLIKAGAFDSMGV 893

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIF----AHEKGTFSDKITLEKFSVENSSVRF 952
            +R  L++++D I K  +   +       ++F       +   +D   ++ F   + +   
Sbjct: 894  NRHSLVEAVDGIIKSVESDSRRNLEGQLDLFSVMSGESQTADTDSYEIKPFPEYSHTELL 953

Query: 953  ENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEES----VATIRGNNIRLAAMVVSKQQKK 1008
            + E+ V G Y SGHPLD Y+    +      +E        + GN++R+   VV  +   
Sbjct: 954  QQEKEVSGLYLSGHPLDAYREQSARFASNSIKELTGEDAHKLDGNHVRIVCTVVKNRMMT 1013

Query: 1009 TRKGSRIGWVTFSEPAKEYEANFFP 1033
            T+  + + + +  +     E   FP
Sbjct: 1014 TKSNTMMAFTSVEDLTGTMEVIVFP 1038


>gi|134300158|ref|YP_001113654.1| DNA polymerase III DnaE [Desulfotomaculum reducens MI-1]
 gi|134052858|gb|ABO50829.1| DNA polymerase III catalytic subunit, DnaE type [Desulfotomaculum
            reducens MI-1]
          Length = 1225

 Score =  836 bits (2160), Expect = 0.0,   Method: Composition-based stats.
 Identities = 399/1048 (38%), Positives = 613/1048 (58%), Gaps = 44/1048 (4%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VH+ YSLL+GA  +N +  +       ++AITD   +F  ++F +     G++PI
Sbjct: 12   FVHLHVHTEYSLLDGASRINQMAKQAKESGMNSLAITDHGCMFGVVDFYKVCHKEGVKPI 71

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +  +  +  T +          +VLL    EGY+ L++LVS  Y  +      R
Sbjct: 72   LGCEVYVAPRRRIDRTPK---LDDQPNHLVLLAENQEGYKNLLKLVSLGYT-EGFYYKPR 127

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +    LQ    +GLI L+   +G +      +  + A +    +  +FG D  ++ LQ H
Sbjct: 128  VDKELLQRYH-KGLIALSACLAGEVADKILGSQPEKARQAAREYVDIFGKDNFFLELQDH 186

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++     +++++A   ++PLVATN+  +L  E  E  DVL+ +     ++   R + 
Sbjct: 187  GYQEQRTVNRELLKIAKELQIPLVATNDVHYLKREHAEIQDVLLCIQTGKSINTPGRMKF 246

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             + + YLK+  EM  +F+++P+AL NT+ IA RC   L+     LP F   E    +   
Sbjct: 247  ESQEMYLKSPHEMNLLFAEIPDALSNTLRIAERCQVDLEFGKYHLPYFTVPE----ESSP 302

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               LR K + G   R    +          ++RL++ELNVI +M +  YFLIV DFI +A
Sbjct: 303  AQYLREKCLEGAIKRYGHCSGP-------VQERLEYELNVIGKMGYDEYFLIVWDFIHYA 355

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            ++  I VGPGRGS AGS+ +YAL IT+IDPL++ LLFERFLNP+R+SMPD DIDF  +RR
Sbjct: 356  RQKGIAVGPGRGSAAGSIVSYALGITNIDPLKYGLLFERFLNPERISMPDIDIDFDYERR 415

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI Y+  KYG +RVAQIITFG++ A+AA+RDVGRAL MPY  VDR+ KL+P +    +
Sbjct: 416  GEVIEYIVQKYGTDRVAQIITFGTMAARAAIRDVGRALDMPYGDVDRVAKLVPTELNITI 475

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+      + A   DP V RL++ +  LEG+ RHASTHAAG+VI   PL + +P+ +
Sbjct: 476  -AKALTSSPDLKAAYDQDPEVKRLVDTAAALEGMPRHASTHAAGVVISREPLVEYLPLSK 534

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
                 L  TQF M  +E+ GL+K D LGL+ LT++ ++++ + Q +  K+D++ IP DD 
Sbjct: 535  TS-DGLVTTQFPMTTVEELGLLKMDLLGLRNLTVISETVNLIEQIKETKLDINTIPLDDQ 593

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNNR 664
             T+ +LT    +G+FQLESSGMR  L  ++P+  EDI+ALV+LYRPGP+ + +   +  R
Sbjct: 594  ATFDMLTRGEGVGVFQLESSGMRNILRELKPNAFEDIVALVALYRPGPLGSGMVEDFIQR 653

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G+ K+   HP ++P+LKET GVI+YQEQVM IA++++GYSL +AD LR+AMGKKI + 
Sbjct: 654  KHGQNKVDYFHPDLEPILKETYGVILYQEQVMMIARIMAGYSLGQADALRKAMGKKIAKI 713

Query: 725  MDKQKERF----------------ISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAA 768
            M   ++ F                I GA   G S+ +A  +F+L+  FA YGFNKSH+AA
Sbjct: 714  MGMHRDWFINGSTLDDKGKPLKNPIPGAVARGYSRQLAEKMFDLMEYFAGYGFNKSHSAA 773

Query: 769  YAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDF 828
            YA++SYQTA++K +YPVE++AA +T   DN +K+  +  + R+  IQ++PP +N    +F
Sbjct: 774  YALVSYQTAYLKANYPVEYMAALLTSVRDNTDKVVLYIDECRRMGIQVLPPDINLSRENF 833

Query: 829  KVGDNRIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVF 887
               +  I + +AA+K VG    + I++      PF    D C R+D++  NRRVLESL+ 
Sbjct: 834  TAANGAIRFGMAAVKNVGWGAVQEIIQIREKKGPFTGFYDLCGRLDTRIANRRVLESLIK 893

Query: 888  AGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD--KITLEKFSV 945
            AGALD FGY R QLL  LD   ++A   +++R     ++F     + +   ++ L     
Sbjct: 894  AGALDAFGY-RSQLLAGLDTGLEHAARSQRDREQGQVSLFDLMSESPAQVMELKLPHVPR 952

Query: 946  ENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQ 1005
              S  + E E+  LG Y SGHPL  +  +L ++ ++          GNN+ +A ++ + +
Sbjct: 953  LTSRQQLEMEKEALGLYISGHPLSEFGWLLDQLEVQRVVHLAELPDGNNLLVAGIISTIK 1012

Query: 1006 QKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            +  +RKG  + ++T  +     E   FP
Sbjct: 1013 RITSRKGDPMAFLTLEDLTGSCEVVVFP 1040


>gi|304316261|ref|YP_003851406.1| DNA polymerase III subunit alpha [Thermoanaerobacterium
            thermosaccharolyticum DSM 571]
 gi|302777763|gb|ADL68322.1| DNA polymerase III, alpha subunit [Thermoanaerobacterium
            thermosaccharolyticum DSM 571]
          Length = 1144

 Score =  836 bits (2160), Expect = 0.0,   Method: Composition-based stats.
 Identities = 387/1049 (36%), Positives = 603/1049 (57%), Gaps = 45/1049 (4%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VHS YSLL+G+  +  ++ +       +IAITD   ++ A+EF ++A + GI+PI
Sbjct: 2    FVHLHVHSEYSLLDGSCRIKELVKRAKELDMDSIAITDHGVMYGAIEFYKEAKSQGIKPI 61

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +  +                  ++LL     GY+ L+++VS+  + D      R
Sbjct: 62   IGCEIYVAPRSLYDKEYGIDNL---NYHLILLCKNMTGYENLMKIVSKASI-DGFYYKPR 117

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +   +L +  +EGLI L+    G I      +  + A+   + +  +FG    Y+ LQ H
Sbjct: 118  VDHEYL-KNHSEGLIALSSCLGGEIPSYLLSDDYEKAKDTAILYNSIFGKGNFYLELQYH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP-R 247
               ++    S++++L+   ++P+VATN+  +L  +D+ AH+VL+ +     +   DR   
Sbjct: 177  GLSEQEKVNSELIKLSKELDIPIVATNDVHYLDRDDHMAHEVLLCIQTGKNMDDADRMSF 236

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM  +FS   EALENT +IA  C+   + +   LP++            
Sbjct: 237  PTDEFYLKSSDEMYEMFSYCREALENTEKIAEMCNLEFEFNKTKLPKYDVPNGM----TS 292

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               LR   + G+  R A         +++  +RL++EL+VI +M +  YFLIV DFI++A
Sbjct: 293  AEYLRKLCIEGVNKRYAN-------PSKEVIERLNYELSVIEKMGYVDYFLIVWDFIKFA 345

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            + N I  GPGRGS AGS+ AY L IT IDP++++LLFERFLNP+R+SMPD D DFC +RR
Sbjct: 346  RDNGIMTGPGRGSAAGSLVAYCLGITKIDPIKYNLLFERFLNPERVSMPDIDSDFCYERR 405

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG ++VAQIITFG++ A+AA+RDVGRAL  PY++VD + K+IP +P   +
Sbjct: 406  QEVIDYVVKKYGEDKVAQIITFGTMAARAAIRDVGRALNFPYAEVDAIAKMIPFEPGMTI 465

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +AI  +   +E    D  + +L+EIS+ LEGL RHASTHAAG+VI   PL + VP+ +
Sbjct: 466  D-KAIGLNPELKEKYENDEKIRQLIEISRSLEGLPRHASTHAAGVVISSEPLVKYVPLQK 524

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
            +      VTQF M  +E+ GL+K DFLGL+TLT+++ +L+ + + R + VD+  I F+D 
Sbjct: 525  N--EGSIVTQFTMTTLEELGLLKMDFLGLRTLTVIRDTLNIIKETRSIDVDIDNIDFEDK 582

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            E Y L++   T G+FQLESSGM+Q +  ++P+ +EDIIA +SLYRPGP+D I  Y   KN
Sbjct: 583  EVYALISKGDTEGVFQLESSGMKQFMTELKPEKLEDIIAGISLYRPGPMDQIPRYIENKN 642

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E I   HPL+ P+L  T G ++YQEQVMQI + L+GYSL  +D++RRAM KK  + M+
Sbjct: 643  HPENIKYEHPLLKPILDVTYGCMVYQEQVMQIVRDLAGYSLGRSDLVRRAMAKKKMKVME 702

Query: 727  KQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI             GA   G+ +  A  +F+ +  FA+Y FNKSHAAAYAV+++
Sbjct: 703  EERKNFIYGIKDESGNYVVPGAINKGVDEATANRLFDEMIDFANYAFNKSHAAAYAVVAF 762

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTA++K +YPVEF+AA +   +DN +K+  + Q  ++  IQ++PP +N     F V + +
Sbjct: 763  QTAYLKRYYPVEFMAALLNSFVDNTDKVAFYVQVLKKMGIQVLPPDINESYSHFSVVNGK 822

Query: 835  IYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + LAA+K VG      I+E    +  + S+ DF  R+D  +LN++ +ESL+ AGA D 
Sbjct: 823  IRFGLAAVKNVGLNATLEIVEDRKKNGRYISIVDFFERIDDMQLNKKAVESLIKAGAFDS 882

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFE 953
            FG  R QLL   ++I        +       ++F  E        +L      +  +   
Sbjct: 883  FGVYRSQLLAVYEDIMDSIHKNRERNIKGQMSLFGSEIERNEVNYSLPDIKEFSQDMILS 942

Query: 954  NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVA---------TIRGNNIRLAAMVVSK 1004
             E+  +G Y SGHPLD ++  ++++      +                 ++ LA ++ SK
Sbjct: 943  MEKETMGLYISGHPLDEFQEDIQRVANCTTRDLKNGDDTFVKKSIFDNQDVVLAGIIESK 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + K T+  + + +V   +     +   FP
Sbjct: 1003 KIKFTKNNNMMAFVNLEDLYGTIDVIVFP 1031


>gi|313114111|ref|ZP_07799663.1| DNA polymerase III, alpha subunit [Faecalibacterium cf. prausnitzii
            KLE1255]
 gi|310623520|gb|EFQ06923.1| DNA polymerase III, alpha subunit [Faecalibacterium cf. prausnitzii
            KLE1255]
          Length = 1169

 Score =  836 bits (2159), Expect = 0.0,   Method: Composition-based stats.
 Identities = 376/1056 (35%), Positives = 593/1056 (56%), Gaps = 42/1056 (3%)

Query: 1    LTQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQ 60
            +++ L  +  FVHL +H+ YSLL+GA  ++ ++D++    Q AIA TD   ++  ++F +
Sbjct: 1    MSEALPNTRPFVHLHIHTEYSLLDGACRIDQLMDRVKECGQTAIACTDHGVMYGCVQFYK 60

Query: 61   KACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMY 120
             A  AGI+PIIGC++ +  +      N+          ++LL     GY+ LI++VS  +
Sbjct: 61   AAKKAGIKPIIGCEVYVATRTRFDKVNK----IDGNNHLILLCKNETGYKNLIKMVSAAF 116

Query: 121  LLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG- 179
             ++      RI    L++   EGLI L+   +G + +A      + A+   L ++ LFG 
Sbjct: 117  -VEGFYSKPRIDKELLEKYH-EGLICLSACLAGEVPQAILAGDYERAKAAALWYRDLFGE 174

Query: 180  DRLYVNLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHST 238
            +  Y+ LQ H   +      Q+++LA    +P+ ATN+S +L +ED +   +L+ +    
Sbjct: 175  ENYYIELQDHGLEEDNTVLPQLIKLARETGIPMAATNDSHYLRKEDAKMQGILLCIQTGK 234

Query: 239  VVSQKDRP-RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIE 297
             +   D+    T + Y+K   EM  +FS +PEA ENT +IA +C+F        +P +  
Sbjct: 235  TIQDADKMEFQTDEFYVKTTDEMYELFSMVPEACENTAKIAEQCNFDFDFGHTKIPYYKA 294

Query: 298  KECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYF 357
                D Q             GLE R            Q  + RL++E+ V+ +M ++ Y+
Sbjct: 295  PNGMDNQ----AFFEKLCWEGLERRYGPDV------PQANKDRLEYEIGVVKKMGYTNYY 344

Query: 358  LIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPD 417
            LIV D++ +AK   IPVGPGRGSGAGS+ AY++ ITDIDP+R++L+FERFLNP+R+SMPD
Sbjct: 345  LIVWDYVNYAKSQGIPVGPGRGSGAGSIAAYSVGITDIDPIRYNLIFERFLNPERVSMPD 404

Query: 418  FDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCK 477
            FD+DFC +RR EVI YV  KYG + VAQI+TFG++ A+ A+RDVGR + +PY QVD + K
Sbjct: 405  FDVDFCYERRQEVIDYVNRKYGADHVAQIVTFGTMAARNAIRDVGRVMGIPYQQVDVVAK 464

Query: 478  LIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDR 537
             +P +    +  +A+      +     DP V  L++ + K+EG+ RHASTHAAG+VI   
Sbjct: 465  QVPMELKMTLK-RALEVSPELKRMYDTDPQVTELIDTALKVEGMPRHASTHAAGVVITPE 523

Query: 538  PLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVD 597
            P    +P+       LPVTQFNM  IE+ GL+K DFLGL+TLT++  +   + +   +  
Sbjct: 524  PTDYYLPL--ATNDGLPVTQFNMTEIEELGLLKMDFLGLRTLTVIHDAETAVQKHHPEFS 581

Query: 598  LSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDN 657
            +  + +DD +TY +L    T G+FQLESSGM+Q L G+QP  +EDIIAL+SLYRPGP+D+
Sbjct: 582  IQKLDYDDPDTYRMLGQGDTEGVFQLESSGMKQVLVGLQPQNLEDIIALISLYRPGPMDS 641

Query: 658  IVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAM 717
            I  Y   ++  +KI    P +  +L  T G I+YQEQVMQI + L+G+S  +AD +RRAM
Sbjct: 642  IPTYLRNRHEPDKISYKTPQLAHILDVTNGCIVYQEQVMQIFRELAGFSFGQADNVRRAM 701

Query: 718  GKKIKEEMDKQKERF----------ISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
             KK    M+ ++E F            G   NGIS+ +A  I++ ++ FA Y FNKSHAA
Sbjct: 702  SKKKHAVMEAEREHFVYGCTDPGNECPGCVANGISEKVANEIYDEMSSFASYAFNKSHAA 761

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
             YA +++QTA++K HYP EF+AA +T  +DN +K+ ++  +  +  I+++PP VN     
Sbjct: 762  CYAYVAFQTAYLKCHYPSEFMAALLTSVLDNTDKVIEYSGECARLGIKVLPPDVNVSNGG 821

Query: 828  FKVGD-NRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLV 886
            F      +I + L A+K VG     ++++   +KP+ SL DFC R+   +LNRR +E L+
Sbjct: 822  FTADGSGQIRFGLNAVKNVGRNLIENVVKGRQNKPYTSLYDFCKRMHGNELNRRAVECLI 881

Query: 887  FAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA-----HEKGTFSDKITLE 941
             AGA D  G +R   +++++ I K  +   +   +   ++F+      + G   D   ++
Sbjct: 882  KAGAFDHLGNNRHSHVEAVEGILKSIETDSRRNLDGQLDLFSVMSGEAQGGASEDNYEIK 941

Query: 942  KFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEES----VATIRGNNIRL 997
            +    +     + E+ V G Y SGHPLD Y+    ++     ++          G  +R+
Sbjct: 942  QLPEYSHKELLQQEKEVSGLYLSGHPLDAYREQSARIASHTIKDLTGEDAHVRDGEKVRI 1001

Query: 998  AAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
               VV  +   T+  S + + +  +     E   FP
Sbjct: 1002 VCAVVKSRMMTTKSNSMMAFTSVEDLTGTMEVIVFP 1037


>gi|218778784|ref|YP_002430102.1| DNA polymerase III, alpha subunit [Desulfatibacillum alkenivorans
            AK-01]
 gi|218760168|gb|ACL02634.1| DNA polymerase III, alpha subunit [Desulfatibacillum alkenivorans
            AK-01]
          Length = 1168

 Score =  835 bits (2158), Expect = 0.0,   Method: Composition-based stats.
 Identities = 411/1034 (39%), Positives = 604/1034 (58%), Gaps = 22/1034 (2%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL VH+ YSLL+GA+ L+ ++++       A AITD   +F  LEF +KA +  I+
Sbjct: 2    SDFVHLHVHTQYSLLDGAIRLDALVNQCKEFGMDACAITDHGTMFGILEFYEKAKSKDIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC+  +  +     T   K        +VLL    +GY+ L  L +           
Sbjct: 62   PIIGCECYVARKSMEDKTPMDKDNR----HLVLLAENNQGYENLCRLATLAQRK-GFYYK 116

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQ 187
             RI    L+E  ++GLI L+    G I         ++AE+  L +K LFG D  Y+ +Q
Sbjct: 117  PRIDKKALEE-HSKGLICLSACLHGEIPMYISDGQMKLAEESALYYKNLFGPDHFYLEIQ 175

Query: 188  RHRGYD-RYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
             +   +      ++ +LA   ++PLV TN+  +L  +D +AH+VL+ +  +  +   +R 
Sbjct: 176  NNGLPEQEEMNQKLAELAEKLDIPLVGTNDCHYLRAKDAKAHEVLLCIQTNKTIHDTNRF 235

Query: 247  RV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
            +  T   YLK+  EM+  F   P A +NTV+IA  C+    +     P+F  +E     K
Sbjct: 236  KFRTDQLYLKSPQEMIEYFKGFPGATDNTVKIAEMCNVEFDLSTFHFPQFPTEEG----K 291

Query: 306  EEENELRNKAVAGLEV-RLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
             E   L      G      A  A+      + Y +RL +EL VI  M F GYFLIV+DFI
Sbjct: 292  TEAEILTQMTWDGFHKRMDAIKAVNPAVDEEKYLERLKYELGVIQDMGFPGYFLIVSDFI 351

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
            QW+K+N IPVGPGRGS AGS+ AYAL ITD+DPL   L+FERFLNP R SMPD D+DFC 
Sbjct: 352  QWSKRNGIPVGPGRGSAAGSLVAYALEITDLDPLEHKLIFERFLNPGRKSMPDIDVDFCI 411

Query: 425  DRRDEVIRYVQNKY-GHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDP 483
              R+    YV  KY G + V+QI TFGS+ A+A +RDVGRA+ +P  +VD + KLIP  P
Sbjct: 412  LGRERTFNYVVEKYGGGDYVSQITTFGSMNARAVVRDVGRAMAIPLGEVDVIAKLIPEAP 471

Query: 484  AHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
               +  +A+  + +  E     P +  L+E++Q LEGL RHASTHAAG+VI D+PL + +
Sbjct: 472  KMTLK-KAMEQEPKLLEIMKDKPEIAELIEVAQVLEGLSRHASTHAAGVVIADKPLVEYL 530

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-QRGVKVDLSLIP 602
            P+Y + +    VTQF+MK +EK GL+KFDFLGL+ LT++  ++  +  Q     DL  + 
Sbjct: 531  PLY-EGKKGEVVTQFDMKRVEKIGLVKFDFLGLRNLTVIDNAIKLIEGQGKTPPDLMHLD 589

Query: 603  FDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--V 660
              D  TY+LL+   T G+FQLESSGM+  L  ++P+C ED++A+V+LYRPGP+++ +   
Sbjct: 590  VTDKATYNLLSRGDTTGVFQLESSGMKDLLARLKPECFEDVVAVVALYRPGPLNSGMVDD 649

Query: 661  YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKK 720
            +  RK+G   +    P ++P+LK+T GVI+YQEQVMQIA  L+ YS+SEAD LR+AMGKK
Sbjct: 650  FVKRKHGDIPVTYALPELEPILKDTYGVIVYQEQVMQIAAALASYSMSEADDLRKAMGKK 709

Query: 721  IKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMK 780
            I E+M +Q+ RF+ G  +N +    A  +F L+ KF +YGFNKSH+AAYA++S+QTA++K
Sbjct: 710  IAEKMAQQRIRFMDGCKENNVDLKKAEALFNLMEKFGEYGFNKSHSAAYALVSFQTAYLK 769

Query: 781  THYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLA 840
            TH+ VEF+A+ MT EMDN + + KF  + R  +I+++PP VNT  V F V + +I Y +A
Sbjct: 770  THFQVEFMASLMTSEMDNTDNVLKFMSECRDHDIEVLPPDVNTSSVSFTVLEGKIVYGMA 829

Query: 841  AIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRM 899
            AIKGVG      I+E    + PF+++ D C RVD +++N+RVLESLV AGA D  G  R 
Sbjct: 830  AIKGVGQGAVEAIVEERKANGPFENIFDLCERVDLRRVNKRVLESLVKAGAFDSTGAKRS 889

Query: 900  QLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVL 959
            QL+  L++   + Q + K + +    +F   +   +    L      +  ++   E+  L
Sbjct: 890  QLMAVLESAIDHGQRISKEKNDPQMGLFGAIE-MPTITPALPDIEEWDDQLKLSYEKEAL 948

Query: 960  GFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVT 1019
            GF+ +GHPL  Y+ IL K               + +R+  M++S +   T+KG  + ++T
Sbjct: 949  GFFLTGHPLGKYEDILIKFANADTLTLPEMPDKSAVRVGGMILSTKNLVTKKGDPMAFIT 1008

Query: 1020 FSEPAKEYEANFFP 1033
              +     E   FP
Sbjct: 1009 LEDMKGSVEVVVFP 1022


>gi|328953644|ref|YP_004370978.1| DNA polymerase III, alpha subunit [Desulfobacca acetoxidans DSM
            11109]
 gi|328453968|gb|AEB09797.1| DNA polymerase III, alpha subunit [Desulfobacca acetoxidans DSM
            11109]
          Length = 1150

 Score =  835 bits (2157), Expect = 0.0,   Method: Composition-based stats.
 Identities = 416/1035 (40%), Positives = 609/1035 (58%), Gaps = 17/1035 (1%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +  +P FVHL VH++YSLL+GA+ LN+++D   + + PA+AITD  N+F  +EF  KA  
Sbjct: 1    MA-TPGFVHLHVHTAYSLLDGAIRLNDLIDTALSMEMPAVAITDHGNMFGVVEFYTKAEK 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            AG++PIIGC+L +     L+ + +          +VLL     GYQ L++LVS+  L + 
Sbjct: 60   AGLKPIIGCELYVAPGSRLEKSGK----KGDNYHLVLLAENLTGYQNLLKLVSKANL-EG 114

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                 R+    L +   EGLI L+    G +      +  + AE     + ++F  R Y+
Sbjct: 115  FYYKPRVDRELLAD-HAEGLIALSACLHGVVAAHVVADDLKTAEIAAREYGEIFPGRFYL 173

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             +Q +   ++    + ++++A    LP+VATN+  +L  ED  AHDVL+ +     ++  
Sbjct: 174  EVQANDLTEQQKVNAALLEMAPRLGLPVVATNDCHYLRPEDARAHDVLLCIQTGKTINTT 233

Query: 244  DRPRVTPDHYLKN-RSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             R R + D        +M + F D P+ LE ++EIA RC   L +     P F  +    
Sbjct: 234  KRMRFSTDQLFFKSPVQMAAAFPDRPDLLEASLEIANRCQLELPLGEFHFPVFPLENGQT 293

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
            ++ + + E R      L      GA       Q YR R++ EL ++ +M F+GYFL+VAD
Sbjct: 294  MEAQLQQEARRGLEHRLHQWQLSGAWPMEKI-QHYRARMEEELALLCQMGFAGYFLVVAD 352

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI++A+K +IPVGPGRGS AGS+ A AL ITD+DP+ + L FERFLNP+R SMPD D+DF
Sbjct: 353  FIRYARKRHIPVGPGRGSAAGSLVACALEITDLDPIAYGLFFERFLNPERKSMPDIDVDF 412

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            C +RR E+I YV  KYG E V QIITFGS++ +  +RDVGRAL +PY + D++ KL+P+ 
Sbjct: 413  CFERRGEIIDYVARKYGKEHVGQIITFGSMKTRQVIRDVGRALDLPYPEADKIAKLVPDV 472

Query: 483  PAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQL 542
                +   A+  + R REAR AD ++  +L I+  LEGL RHASTHAAG+VI D+PL   
Sbjct: 473  LKINL-RTALEKEPRLREARDADENIREVLTIAAALEGLPRHASTHAAGVVIADKPLWCY 531

Query: 543  VPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSLI 601
            +P+Y+    D  +TQF MK +EK GLIKFDFLGL+TLT+L+ +      Q+    D   +
Sbjct: 532  LPLYKG-NKDEIITQFEMKGVEKVGLIKFDFLGLRTLTVLETAAQIVRRQKDKNFDYRQL 590

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P +D  T+ LL +  T G+FQLESSGMR+ L  ++P C ED+IALV+LYRPGP+++ +V 
Sbjct: 591  PLEDAATFELLRSGNTAGVFQLESSGMREKLVQLRPTCFEDLIALVALYRPGPLESGMVD 650

Query: 662  NNRKNGKEK--IVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGK 719
            +  K    +  +    P ++P+LKET G+I+YQEQVMQIA ++SGYS+ EAD+LRRAMGK
Sbjct: 651  DFIKRKHGELNVTYELPELEPILKETYGIILYQEQVMQIAGIISGYSMGEADILRRAMGK 710

Query: 720  KIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWM 779
            K    M  QKERF SGA   G     A  +F L+ KFA YGFNKSH+AAYA I+YQTA++
Sbjct: 711  KEPAVMAAQKERFCSGAVSRGFPLAKAEKLFHLIEKFAGYGFNKSHSAAYAYITYQTAYL 770

Query: 780  KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSL 839
            K HYP+EFLAA  T E+++   + K  Q+AR+  I ++PPS+N    DF V  ++I + L
Sbjct: 771  KAHYPLEFLAALFTSEINSPTTLTKHIQEAREDGIVLLPPSLNASERDFTVEGSQIRFGL 830

Query: 840  AAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRM 899
            A +K VG    + I+EA    PF SL +F  R +  K+N++VLESL+ AGALD  G +R 
Sbjct: 831  AGVKNVGDNAIKAILEARKKGPFISLGNFLERANQTKVNKKVLESLIQAGALDFLGINRA 890

Query: 900  QLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFENEQR 957
            +L   ++   + AQ   K +  +  ++F    E         L      +   +   E+ 
Sbjct: 891  RLFGGVEAALERAQVALKLQAARQMDMFGGLGEADLGEGDDWLPPVPEWDEQEKLAREKE 950

Query: 958  VLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGW 1017
             LG Y SGHPL  Y+  L+ +     ++         + L  ++V+ ++  T+KG R+ +
Sbjct: 951  ALGIYLSGHPLAKYRQQLQALTDLTIDDLAEKPENGPVLLGGLIVAVKETMTKKGERMAF 1010

Query: 1018 VTFSEPAKEYEANFF 1032
             T  +     E   F
Sbjct: 1011 ATLEDQVGSVEVVVF 1025


>gi|206901842|ref|YP_002251105.1| DNA polymerase III alpha subunit [Dictyoglomus thermophilum H-6-12]
 gi|206740945|gb|ACI20003.1| DNA polymerase III alpha subunit [Dictyoglomus thermophilum H-6-12]
          Length = 1127

 Score =  835 bits (2156), Expect = 0.0,   Method: Composition-based stats.
 Identities = 401/1026 (39%), Positives = 626/1026 (61%), Gaps = 27/1026 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL VH+ YSLL+GA  ++ ++D+      PA+AITD   ++  ++F + A   GI+P
Sbjct: 2    SFVHLHVHTEYSLLDGACRIDELIDQALEFNMPAVAITDHGVMYGVIDFYKNAKEKGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +          +       +  ++LL    EGY+ LI++VS  +L +      
Sbjct: 62   IIGCEVYVAPGSRFDKKQRTD-----LYHLILLAKDFEGYKNLIKIVSLSFL-EGFYYKP 115

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            R+    L+E  ++G+I L+   +G I      N+ + A+  +  +  +FG+  Y+ LQ +
Sbjct: 116  RVDKELLREY-SKGIIALSSCLAGEIPSYILQNNLEKAKNAIKEYLDIFGEDFYLELQNN 174

Query: 190  RGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++    S +++L+    +PLVATN+  +L +ED E HD+L+ +   + ++ KDR R 
Sbjct: 175  GMEEQEYVNSYLIKLSRELNVPLVATNDVHYLRKEDAEIHDILLCIQTGSKLNDKDRLRF 234

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + Y K+  EM ++F D+P+A+ENT++IA +C+  + ++  ILP F   E +      
Sbjct: 235  KTNEFYFKSPEEMKALFKDVPDAIENTLKIAEKCNVEIPLNNVILPVFEVPEGE----TL 290

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            ++        G + R  +         ++ R+RL +E++VI +M FSGYFLIV DF+ +A
Sbjct: 291  DSYFERLCWEGAKKRFGED------IPENIRERLSYEISVIKQMGFSGYFLIVQDFVNYA 344

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K   IPVGPGRGS AGS+ +Y L IT+I+P R+ L+FERFLNP+R++MPD DIDFC +RR
Sbjct: 345  KSRGIPVGPGRGSAAGSLVSYVLGITNIEPTRWGLIFERFLNPERVTMPDIDIDFCFERR 404

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
            +EVI YV+NKYG E VAQIITFG++ A+A++RDVGR L +PY++VDR+ KLI   P +  
Sbjct: 405  EEVIEYVRNKYGKEHVAQIITFGTMAARASVRDVGRVLDVPYNEVDRIAKLI---PPNTS 461

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+      R     +P   R++EI++++EG  RHAS HAAGIVI   PL + VP+  
Sbjct: 462  IEEALNTSEELRNLVENNPQAKRIIEIAKRIEGNARHASIHAAGIVISKDPLMEYVPLQ- 520

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDDH 606
             +     VTQ  M  +E+ GL+K DFLGL+TLT++  ++  + +   +++D++ I   D 
Sbjct: 521  VMNGTDVVTQLPMTNLEELGLLKMDFLGLRTLTVIYDTIKKIKENYGIEIDINNISLSDE 580

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            + Y LL    T+G+FQLES GMR  L  ++P+  ED+IA+++LYRPGP+  +  Y  RK 
Sbjct: 581  KVYELLQKGETIGVFQLESRGMRNLLRDIKPEKFEDLIAVLALYRPGPLGRLESYIKRKR 640

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
            G+EK+  +HP ++P+L ET GVIIYQEQVM+IA  L+G++L +ADVLRRAMGKK  E M+
Sbjct: 641  GEEKVEYMHPALEPILAETYGVIIYQEQVMEIAHRLAGFTLGQADVLRRAMGKKKPEVME 700

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
            +Q+  F+ GA + GI + +A+ IFE +AKFA+YGFNKSH+AAYA +S+QTA++K +YP E
Sbjct: 701  EQRGIFVKGAVERGIPENVAIEIFEDMAKFAEYGFNKSHSAAYAFVSFQTAYLKAYYPKE 760

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            ++A+ +T   ++  K+ K+  +A++  I+I+PP VN   VDF V    I + L+AIK VG
Sbjct: 761  YMASLLTSVKNSTTKLSKYIAEAKRIGIKILPPDVNESVVDFTVTPQGIRFGLSAIKNVG 820

Query: 847  TTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLD 906
             + A  I+E  +   F S+ DF  R+ SK +N+R LESL+ +GA D FGYSR  LL+++D
Sbjct: 821  ESVAEAIVEERSRGRFKSIFDFIKRLSSKVINKRALESLIKSGAFDSFGYSRRALLENID 880

Query: 907  NIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSGH 966
             I + AQ V K       ++   E     + I        +     E E+ +LGFY S  
Sbjct: 881  KILESAQ-VMKRAHIGQVSLIDLESLPQEEIIN--NMPEFSIDEILEMEKEMLGFYVSYD 937

Query: 967  PLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKE 1026
            P +  + I  K+     ++ V    G+ + +  ++ + ++   RK  ++ + T  +   E
Sbjct: 938  PQEELRKISEKLFDYTIDDLVEVESGSQVIVPGILKNVREVIDRKNQKMLFATLEDFTGE 997

Query: 1027 YEANFF 1032
             E   F
Sbjct: 998  AEITVF 1003


>gi|125973779|ref|YP_001037689.1| DNA polymerase III DnaE [Clostridium thermocellum ATCC 27405]
 gi|281417936|ref|ZP_06248956.1| DNA polymerase III, alpha subunit [Clostridium thermocellum JW20]
 gi|125714004|gb|ABN52496.1| DNA polymerase III catalytic subunit, DnaE type [Clostridium
            thermocellum ATCC 27405]
 gi|281409338|gb|EFB39596.1| DNA polymerase III, alpha subunit [Clostridium thermocellum JW20]
          Length = 1181

 Score =  834 bits (2154), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/1068 (35%), Positives = 601/1068 (56%), Gaps = 62/1068 (5%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VH+ YSLL+GA  + +++ +       +IAITD   ++  ++F ++A   GI+PI
Sbjct: 5    FVHLHVHTEYSLLDGANRIKDLIRRTKELGMDSIAITDHGVMYGVVDFYKEAVNNGIKPI 64

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++               +       +VLL     GY+ L+++VS  +  +      R
Sbjct: 65   LGCEIYTAKGSRFDKQGGWDSDPG---HMVLLAKNNTGYKNLMKIVSIGFT-EGFYYKPR 120

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            + +  L++  +EGLI ++   SG I +A   N+ + A++  L    +FG D  Y+ LQ +
Sbjct: 121  VDMEVLEKY-SEGLIAMSACLSGDIPKAILNNNYEKAKELALKLNSIFGQDNFYLELQMN 179

Query: 190  RGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++     Q+++L+    +PLVATN++ +L  ED  AH++L+ +     ++ +DR R 
Sbjct: 180  GIEEQNIVNQQLIKLSRETGIPLVATNDAHYLRREDARAHEILLCIQTGKSINDEDRMRF 239

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             + D Y+K+  EM+S+F ++PEA+ NTV IA  C+  L+ +   LP+F   +     K+ 
Sbjct: 240  SSDDFYIKSPEEMISLFRNIPEAISNTVRIADMCNVELEFNKLHLPKFDVPDG----KDP 295

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               LR     G E    +         ++   RL++EL+VI +M +  YFLIV+DFI++A
Sbjct: 296  FEYLRALCYEGFERIYGKDNRD-----EEKINRLEYELSVIKQMGYVDYFLIVSDFIRYA 350

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K+  I VGPGRGS AGS  AY L IT+IDPL+++LLFERFLNP+R+SMPD DIDFC +RR
Sbjct: 351  KEKGIMVGPGRGSAAGSFVAYCLGITNIDPLKYNLLFERFLNPERISMPDIDIDFCFERR 410

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RVAQIITFG++ A+A +RDVGRAL +PY +VD + K+IP      +
Sbjct: 411  QEVIDYVVEKYGKDRVAQIITFGTMAARAVIRDVGRALDIPYGEVDAIAKMIPFQIGMSI 470

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+  +   R+    D  V  L++ ++ LEG+ RHASTHAAG+VI   PL++ VP+ R
Sbjct: 471  E-KAMELNPELRQRYNDDERVKELIDTAKLLEGMPRHASTHAAGVVISREPLTEYVPLQR 529

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
                D   TQF M  +E+ GL+K DFLGL+TLT+++ ++  + +   + V +  +  DD 
Sbjct: 530  S--EDSITTQFPMGILEELGLLKMDFLGLRTLTVIRDAVALIKKNHNIDVKIDELQMDDP 587

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              + L+    T G+FQLES+GM Q ++ +QP  +EDIIA +SLYRPGP+D I  Y   KN
Sbjct: 588  NVFKLIGEGRTAGVFQLESAGMTQFMKELQPASLEDIIAGISLYRPGPMDQIPRYLRNKN 647

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E +   HPL++ +L  T G ++YQEQVMQI + L+GYS+  +D++RRAM KK    M+
Sbjct: 648  NPELVKYDHPLLENILNVTYGCMVYQEQVMQIVRDLAGYSMGRSDLVRRAMAKKKVSVME 707

Query: 727  KQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI             GA +NG+ +  A  IF+ +  FA Y FNKSHAAAYAVI+Y
Sbjct: 708  QERKNFIYGIDDDNGNIIVKGAVRNGVDEETANKIFDEMMDFASYAFNKSHAAAYAVIAY 767

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTAW+K +YPVEF+AA +   M + +KI ++  + R+  I+++PP +N   V F V + +
Sbjct: 768  QTAWLKCYYPVEFIAALLNSFMGSSDKISQYVHECRKLGIEVLPPDINESDVRFTVVNGK 827

Query: 835  IYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + LAA+K VG    R I++    +  + S  +F  RVD K +N+R +ESL+ +GA D 
Sbjct: 828  IRFGLAAVKNVGENAVRSIIDERNINGNYKSFRNFLERVDGKDVNKRCIESLIKSGAFDS 887

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTF------------SDKITLE 941
             G  R +L+ + + + +      K       +IF     T              D+    
Sbjct: 888  MGVYRSRLMNAYEKMMEGISSQRKKSMEGQLSIFDMALNTEDGKKDEKHQLYPEDEDIYP 947

Query: 942  KFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEES--------------- 986
                 +  +    E+ +LG Y SGHPL  ++    ++     ++                
Sbjct: 948  DIPEYSQKILLSMEKEMLGLYISGHPLSEFEKEFSEVVTLYSKDMVSDADENGEVITVEG 1007

Query: 987  -VATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
                  G  + +  ++ S++ K T+  + + +VT  +     E   FP
Sbjct: 1008 NKGLKDGMTVTVGGIITSRKTKTTKNNNLMAFVTLEDLYGTMEIIVFP 1055


>gi|315648837|ref|ZP_07901932.1| DNA polymerase III, alpha subunit [Paenibacillus vortex V453]
 gi|315275805|gb|EFU39157.1| DNA polymerase III, alpha subunit [Paenibacillus vortex V453]
          Length = 1143

 Score =  834 bits (2153), Expect = 0.0,   Method: Composition-based stats.
 Identities = 398/1046 (38%), Positives = 608/1046 (58%), Gaps = 32/1046 (3%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
             SFVHL VHS YSLL+GA  + +++ + AA    ++A+TD   ++ A+ F +   A GI+
Sbjct: 2    SSFVHLHVHSEYSLLDGAARIGDLVREAAALGMKSLALTDHGVMYGAIPFYKACLAQGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC+  I      +   +G      +  ++LL     GY+ L++L S  +L +     
Sbjct: 62   PIIGCEAYITAGSRKE---RGSRKDQPIYHLILLAKNEVGYRNLMKLSSIGHL-EGYHYR 117

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             RI +  L     EG+I L+    G + +         A+   L ++ +FGD  Y+ LQ 
Sbjct: 118  PRIDMEALAA-HHEGIICLSACLGGEVPQHLLHGREAEAKAAALRYQAIFGDDYYLELQD 176

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++ R   Q++ L+    +PLVATN+  +L+EED E  DVL+ +     V  +DR +
Sbjct: 177  HGIPEQKRVNPQLIALSRETGIPLVATNDVHYLTEEDAEVQDVLICIGTGKTVEDEDRLQ 236

Query: 248  -VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T   YLK+ SEM  ++  +PEA++NT +IA +C+  L+    ILP +         K 
Sbjct: 237  IQTNQLYLKSGSEMERLYPHVPEAIQNTAKIADQCNLELEFGKSILPEYSS---LPEGKN 293

Query: 307  EENELRNKAVAG-LEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
                LR   + G  E               +  QRL++EL VI  M FS YFLIV DFI 
Sbjct: 294  AAEYLRELCLNGLQERYGITERWQDEALRSELEQRLNYELGVIENMGFSDYFLIVWDFIA 353

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            +A +  I VGPGRGS AGS+ AY L IT++DP+++ LLFERFLNP+R++MPD DIDF  +
Sbjct: 354  YAHRQGIAVGPGRGSSAGSLVAYTLQITNVDPMKYKLLFERFLNPERITMPDIDIDFSDE 413

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RRDEVI YV +KYG E VAQIITFG++ A+AA+RDVGRAL +P+  VD+  KLIPN    
Sbjct: 414  RRDEVIDYVVDKYGKEHVAQIITFGTMAARAAVRDVGRALNVPFGDVDKAAKLIPNHLGI 473

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
             +  +A+    + +E     P V  L++++ K+EG+ RHASTHAAGIVI   PL+  VP+
Sbjct: 474  SI-AKAMEQSPQLKEQYETRPKVRELIDMAMKVEGMPRHASTHAAGIVISRDPLTDAVPL 532

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFD 604
              +      +TQ++M+ +E  GL+K DFLGL+TL++++++L ++ +  G  +D   IP +
Sbjct: 533  Q-EGSEKTALTQYSMENLESVGLLKMDFLGLRTLSIIERTLKWIQELTGGALDFEQIPDN 591

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNR 664
            D  TY +L    T G+FQLES+G+R+ L+ ++P   EDI+++V+LYRPGP++ I  +   
Sbjct: 592  DGNTYEMLGRGETTGVFQLESAGVRRVLKDLKPSAFEDIVSVVALYRPGPMEFIPRFIQV 651

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G+      H  + P+L +T G+I+YQEQ+MQIA  ++G+SL EAD+LRRA+ KK +E 
Sbjct: 652  KHGQIDPEYPHEDLIPILGDTYGIIVYQEQIMQIASTMAGFSLGEADLLRRAVSKKKREV 711

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            +D+++  F+SG+ K G S+  A  +++++ +FA+YGF ++HAAAY V+++QTA++K HYP
Sbjct: 712  LDRERSHFVSGSLKLGYSEDEANRVYDMIVRFANYGFPRAHAAAYGVLAFQTAYLKAHYP 771

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVG------------- 831
            V F+A+ +T  M +  K+ ++  +AR+ +I++MPP VN     F                
Sbjct: 772  VPFMASMLTAVMGSHRKVAEYVLEARRIDIEVMPPDVNESGTYFTPVVSQSESGSLDEGS 831

Query: 832  ----DNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVF 887
                +  I + LAAIK VGT    +I+E   +KPF+SL DFC RVD +  N+RV+ESL+ 
Sbjct: 832  HHFTEGGIRFGLAAIKNVGTQAVENIVEIRREKPFESLLDFCRRVDLRVCNKRVIESLIQ 891

Query: 888  AGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVEN 947
            AGA D     R QL+  LD   + A    K R +    +F   + T  D I         
Sbjct: 892  AGAFDSLPGHRSQLVAMLDETVEAAVKWRKERDDLQIQLFDFVEATNWD-IEYPDIPPYT 950

Query: 948  SSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQK 1007
            +  + E E+ +LG Y SGHPLD Y+  L + G     +       +   +A MVV+ +  
Sbjct: 951  AGQQLEFERELLGMYLSGHPLDGYEDTLTESGADRLMDLHEAADESMAAVAGMVVTLKTI 1010

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             T++G  + ++   +  +  E   FP
Sbjct: 1011 TTKQGKAMAFMECEDQIERCEVVLFP 1036


>gi|302389432|ref|YP_003825253.1| DNA polymerase III catalytic subunit, DnaE type [Thermosediminibacter
            oceani DSM 16646]
 gi|302200060|gb|ADL07630.1| DNA polymerase III catalytic subunit, DnaE type [Thermosediminibacter
            oceani DSM 16646]
          Length = 1145

 Score =  833 bits (2152), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/1034 (36%), Positives = 595/1034 (57%), Gaps = 29/1034 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
             FVHL VH++YSLL+GA  ++ +  +       A+AITD   ++  ++F +   A G++P
Sbjct: 3    DFVHLHVHTNYSLLDGACEISKLAKRAKELGMNAMAITDHGVMYGIIDFYKTMKAEGVKP 62

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +                  +VLL     GY+ L++LVS  +L +      
Sbjct: 63   IIGCEVYVAKRSMADRQPG---IDDDQYHLVLLAENETGYKNLVKLVSLGFL-EGFYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L++  ++GLI L+   +G I         + A++      ++FG    ++ LQ 
Sbjct: 119  RVDKEVLKK-HSQGLIALSACLAGEIPYFLENGEYEKAKEAACELNEIFGKGNFFLELQD 177

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++ R  + + +L+    +PLVATN+  ++ + D   HD ++ +     V  +DR +
Sbjct: 178  HGIPEQKRVNANLCRLSKETGIPLVATNDVHYILKSDEPVHDAMLCIQTGKTVKDEDRLK 237

Query: 248  VTPDH-YLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                  YLK++ EM  +FS +PEALENTV IA+RC+  L      LP F   +       
Sbjct: 238  FNSAELYLKSQEEMWRLFSHIPEALENTVMIAQRCNVELDFGRIHLPHFEVPQGF----T 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
            +++ L      GL           G    + + RLD+EL+VI RM +S YFLIV DF+ +
Sbjct: 294  QDSYLEKLCYEGL-------VERYGRITPEIKARLDYELDVIKRMGYSSYFLIVWDFVNF 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+KN I VGPGRGS AGS+ AY L IT++DPLR++LLFERFLNP+R++MPD D+DFC +R
Sbjct: 347  ARKNGIMVGPGRGSAAGSLVAYCLHITNVDPLRYNLLFERFLNPERVTMPDIDVDFCYER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG +RVAQI TFG++ A+AA+RDVGR L  PY +VD + K++P +P   
Sbjct: 407  RQEVIDYVVRKYGEDRVAQIGTFGTMAARAAIRDVGRVLGYPYGEVDTVAKMVPMEPGMT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +    +  +   ++    +  + RL++ ++ LEG  RHASTHAAG+VI   PL +LVP++
Sbjct: 467  IEKA-LVLNPELKKLYDENERIKRLIDTAKGLEGFPRHASTHAAGVVISSEPLVELVPLH 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDD 605
            +   S++    F M  +E+ GL+K DFLGL+TLT+++ +L  + Q RG+ V L  +P DD
Sbjct: 526  KVGDSNVSTQ-FTMTALEELGLLKMDFLGLRTLTVIRDALGLIEQTRGISVVLDELPLDD 584

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDN--IVVYNN 663
             + Y LL+   T G+FQLESSGMR  L  ++P+  EDIIA++ LYRPGP+ +     +  
Sbjct: 585  EKVYDLLSRGETTGVFQLESSGMRNLLRELRPERFEDIIAVIGLYRPGPLGSGAADEFIK 644

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
             KN +  I  +HP + P+L+ET G+I+YQEQVM+IAQ L+G++L++AD+LR+AMGKK + 
Sbjct: 645  NKNNQGSIKYLHPRLKPILEETYGIILYQEQVMKIAQDLAGFTLAQADILRKAMGKKQQS 704

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             M+ Q+  FI G  +NGI +  A NIFE ++ FA YGFNKSHAAAYA+I+YQTA++K H+
Sbjct: 705  VMEAQRAAFIRGCVENGIDEETAANIFEEISYFAGYGFNKSHAAAYAMIAYQTAYLKAHF 764

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEF+AA +T    N +K+ ++  + R   I+++PP +N     F     +I + L A+K
Sbjct: 765  PVEFMAALLTSVRHNTDKVAQYIAECRHMGIEVLPPDINESFEVFTAVSGKIRFGLTAVK 824

Query: 844  GVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG   A+ I++       F S  DFC ++D  ++N++ +ESL+ +GA D  G  R QLL
Sbjct: 825  NVGEGMAKAIIKCRDEKGRFVSFSDFCEKLDQTEINKKAVESLIKSGAFDSLGARRSQLL 884

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFY 962
            +  +++    Q  +K +     ++F   +     +  L        +     E+ VLG Y
Sbjct: 885  KVYEDVLNRVQKKQKQQGKNQLSLFEMIRVDDVVEDELPDIPEYPENELLAMEKEVLGLY 944

Query: 963  FSGHPLDVYKPILRKMGIKGYEESVAT----IRGNNIRLAAMVVSKQQKKTRKGSRIGWV 1018
             SGHPL  +K +L K      ++           + + +  ++   + K T+    + ++
Sbjct: 945  LSGHPLREFKDLLEKTTTLCSKDLADEEKEFKDNSAVVVGGIISEIKLKSTKDNKLMAFI 1004

Query: 1019 TFSEPAKEYEANFF 1032
            T  +     E   F
Sbjct: 1005 TLEDLTGVMEVIAF 1018


>gi|94263380|ref|ZP_01287194.1| DNA polymerase III, alpha subunit [delta proteobacterium MLMS-1]
 gi|93456216|gb|EAT06350.1| DNA polymerase III, alpha subunit [delta proteobacterium MLMS-1]
          Length = 1174

 Score =  833 bits (2151), Expect = 0.0,   Method: Composition-based stats.
 Identities = 429/1036 (41%), Positives = 618/1036 (59%), Gaps = 17/1036 (1%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL VH+ YS+L+GA+ L+ +  K       A+AITD   +F ALEF  KA  AGI+
Sbjct: 2    SDFVHLHVHTQYSMLDGAIRLDRLFAKCREYGMEAVAITDHGAMFGALEFYVKAKKAGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC+  I        + +          ++LL     GYQ L++L +   L +     
Sbjct: 62   PIIGCEFYIAPDSRRDKSAKSAGAAAHH--LMLLAMDQTGYQNLMKLATIAQL-EGFHYK 118

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             RI L  L +   EGLI +T    G +           A        +LF  RLY+ +Q 
Sbjct: 119  PRIDLEVLAD-HREGLIAMTACLHGKVPSLLVKGDKAGARAEAKRLHELFPGRLYLEMQE 177

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            ++  ++      + +LA   ELPLVATN+  +L  E+ +AH+VL+ +     +  +DR R
Sbjct: 178  NQIPEQTTVNEGLKELAAELELPLVATNDCHYLDREEAKAHEVLLCIQTGKTMDSQDRFR 237

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T + + K+ +EM + F+  P+AL  TVEIA+RC+  L + +   P F     D +   
Sbjct: 238  FATDELFFKSPAEMKAAFAHSPQALAATVEIAQRCNLELDLESHHFPDFPVPTGDTLASL 297

Query: 307  EENELRN-KAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
             E E R   A    E+R  QG        + YRQRL+ E++VI +M F GYFLIVADFI 
Sbjct: 298  FEREARAGLAQRLTEMRDKQGLTVGAELEEQYRQRLEHEIDVINQMGFPGYFLIVADFIN 357

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            WAK   IPVGPGRGSGAGS+ AYA+ ITD+DP+   L+FERFLN +R SMPDFD+DFCQ+
Sbjct: 358  WAKDQQIPVGPGRGSGAGSLVAYAMRITDVDPIPHGLIFERFLNIERKSMPDFDVDFCQE 417

Query: 426  RRDEVIRYVQNKY-GHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            RR EVI YVQ+KY G   V QI+T+GS++AKA +RDVGRAL M + + DR+ KLIP++  
Sbjct: 418  RRGEVIDYVQHKYGGQSHVVQIVTYGSMKAKAVVRDVGRALGMSFGEADRIAKLIPDELN 477

Query: 485  HPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
              +  +AI  + +F+E    +P V  LL +++ LEGL RH S HAAG+VI  RP+ + +P
Sbjct: 478  ITLD-KAIDKEPKFKELMKREPQVAELLNVAKVLEGLNRHTSIHAAGVVISPRPMVEYLP 536

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-GVKVDLSLIPF 603
            + +       +TQ++MK  E  GLIKFDFLGLKTLT++ ++   +      +VD++ IP 
Sbjct: 537  LCKGP-KGEVLTQYDMKHTEMTGLIKFDFLGLKTLTVIDRACKLIKADLDHEVDIAAIPM 595

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VY 661
            DD +T+ LL     LG+FQLESSGMR  L  M+P+   D+IALV+LYRPGP+++ +   +
Sbjct: 596  DDAKTFDLLCKGDALGVFQLESSGMRSLLMKMKPEQFSDLIALVALYRPGPLESGMVEDF 655

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
             N K+G+         ++P+LKET GVI+YQEQVM+IA +L+GYSL +AD LRRAMGKKI
Sbjct: 656  VNTKHGRMVAKYPLAQLEPILKETYGVIVYQEQVMKIANVLAGYSLGDADNLRRAMGKKI 715

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
             E M+ +K +F++G + NGI    A  IF+L+AKFA YGFNKSH+AAYA+I+YQTAW+K 
Sbjct: 716  PEVMEAEKGKFMAGCADNGIDPKKAEYIFDLVAKFAGYGFNKSHSAAYALIAYQTAWLKA 775

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYP +F+AA ++ +M N +K+ ++  + R+  I+++PP +N    DF V D+RI + LAA
Sbjct: 776  HYPSQFMAALLSCDMGNTDKVVRYINECREHEIEVLPPDINESFRDFTVIDDRIRFGLAA 835

Query: 842  IKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQ 900
            +K VG      I+E    D P+ SL DFC RVD +K+NRRV+ESL+ AGA D  G  R Q
Sbjct: 836  VKNVGGAALDSIIEVRETDGPYQSLSDFCGRVDGRKVNRRVIESLIKAGAFDSLGAKRAQ 895

Query: 901  LLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDK---ITLEKFSVENSSVRFENEQR 957
            L   LD     AQ  +++R +   ++FA      + +   I L + +  +   R   E+ 
Sbjct: 896  LFAILDQAMDQAQATQRDRQSGQISLFAAMPAEQAAQAQNIELPEIAEWDEKQRLLLEKE 955

Query: 958  VLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGW 1017
             +GFY +GHPLD Y+  L  +      +         +R+  ++   +  +++KG  + +
Sbjct: 956  TVGFYLTGHPLDKYRRELAAVVDTDLHDLADWNEQQPVRVGGLIRHCKPHRSKKGDAMAF 1015

Query: 1018 VTFSEPAKEYEANFFP 1033
            +T  +     E   FP
Sbjct: 1016 LTLEDTLASAEVVIFP 1031


>gi|256004510|ref|ZP_05429489.1| DNA polymerase III, alpha subunit [Clostridium thermocellum DSM 2360]
 gi|255991515|gb|EEU01618.1| DNA polymerase III, alpha subunit [Clostridium thermocellum DSM 2360]
 gi|316940028|gb|ADU74062.1| DNA polymerase III, alpha subunit [Clostridium thermocellum DSM 1313]
          Length = 1181

 Score =  833 bits (2151), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/1068 (35%), Positives = 600/1068 (56%), Gaps = 62/1068 (5%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VH+ YSLL+GA  + +++ +       +IAITD   ++  ++F ++A   GI+PI
Sbjct: 5    FVHLHVHTEYSLLDGANRIKDLIRRTKELGMDSIAITDHGVMYGVVDFYKEAVNNGIKPI 64

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++               +       +VLL     GY+ L+++VS  +  +      R
Sbjct: 65   LGCEIYTAKGSRFDKQGGWDSDPG---HMVLLAKNNTGYKNLMKIVSIGFT-EGFYYKPR 120

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            + +  L++  +EGLI ++   SG I +A   N+ + A++  L    +FG D  Y+ LQ +
Sbjct: 121  VDMEVLEKY-SEGLIAMSACLSGDIPKAILNNNYEKAKELALKLNSIFGQDNFYLELQMN 179

Query: 190  RGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++     Q+++L+    +PLVATN++ +L  ED  AH++L+ +     ++ +DR R 
Sbjct: 180  GIEEQNIVNQQLIKLSRETGIPLVATNDAHYLRREDARAHEILLCIQTGKSINDEDRMRF 239

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             + D Y+K+  EM+S+F ++PEA+ NTV IA  C+  L+ +   LP+F   +     K+ 
Sbjct: 240  SSDDFYIKSPEEMISLFRNIPEAISNTVRIADMCNVELEFNKLHLPKFDVPDG----KDP 295

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               LR     G E    +         ++   RL++EL+VI +M +  YFLIV+DFI++A
Sbjct: 296  FEYLRALCYEGFERIYGKDNRD-----EEKINRLEYELSVIKQMGYVDYFLIVSDFIRYA 350

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K+  I VGPGRGS AGS  AY L IT+IDPL+++LLFERFLNP+R+SMPD DIDFC +RR
Sbjct: 351  KEKGIMVGPGRGSAAGSFVAYCLGITNIDPLKYNLLFERFLNPERISMPDIDIDFCFERR 410

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RVAQIITFG++ A+A +RDVGRAL + Y +VD + K+IP      +
Sbjct: 411  QEVIDYVVEKYGKDRVAQIITFGTMAARAVIRDVGRALDISYGEVDAIAKMIPFQIGMSI 470

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+  +   R+    D  V  L++ ++ LEG+ RHASTHAAG+VI   PL++ VP+ R
Sbjct: 471  E-KAMELNPELRQRYNDDERVKELIDTAKLLEGMPRHASTHAAGVVISREPLTEYVPLQR 529

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
                D   TQF M  +E+ GL+K DFLGL+TLT+++ ++  + +   + V +  +  DD 
Sbjct: 530  S--EDSITTQFPMGILEELGLLKMDFLGLRTLTVIRDAVALIKKNHNIDVKIDELQMDDP 587

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              + L+    T G+FQLES+GM Q ++ +QP  +EDIIA +SLYRPGP+D I  Y   KN
Sbjct: 588  NVFKLIGEGRTAGVFQLESAGMTQFMKELQPASLEDIIAGISLYRPGPMDQIPRYLRNKN 647

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E +   HPL++ +L  T G ++YQEQVMQI + L+GYS+  +D++RRAM KK    M+
Sbjct: 648  NPELVKYDHPLLENILNVTYGCMVYQEQVMQIVRDLAGYSMGRSDLVRRAMAKKKVSIME 707

Query: 727  KQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI             GA +NG+ +  A  IF+ +  FA Y FNKSHAAAYAVI+Y
Sbjct: 708  QERKNFIYGIDDDNGNIIVKGAVRNGVDEETANKIFDEMMDFASYAFNKSHAAAYAVIAY 767

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTAW+K +YPVEF+AA +   M + +KI ++  + R+  I+++PP +N   V F V + +
Sbjct: 768  QTAWLKCYYPVEFIAALLNSFMGSSDKISQYVHECRKLGIEVLPPDINESDVRFTVVNGK 827

Query: 835  IYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + LAA+K VG    R I++    +  + S  +F  RVD K +N+R +ESL+ +GA D 
Sbjct: 828  IRFGLAAVKNVGENAVRSIIDERNINGNYKSFRNFLERVDGKDVNKRCIESLIKSGAFDS 887

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTF------------SDKITLE 941
             G  R +L+ + + + +      K       +IF     T              D+    
Sbjct: 888  MGVYRSRLMNAYEKMMEGISSQRKKSMEGQLSIFDMALNTEDGKKDEKHQLYPEDEDIYP 947

Query: 942  KFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEES--------------- 986
                 +  +    E+ +LG Y SGHPL  ++    ++     ++                
Sbjct: 948  DIPEYSQKILLSMEKEMLGLYISGHPLSEFEKEFSEVVTLYSKDMVSDADENGEVITVEG 1007

Query: 987  -VATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
                  G  + +  ++ S++ K T+  + + +VT  +     E   FP
Sbjct: 1008 NKGLKDGMTVTVGGIITSRKTKTTKNNNLMAFVTLEDLYGTMEIIVFP 1055


>gi|15888619|ref|NP_354300.1| DNA polymerase III subunit alpha [Agrobacterium tumefaciens str. C58]
 gi|15156343|gb|AAK87085.1| DNA polymerase III, alpha chain [Agrobacterium tumefaciens str. C58]
          Length = 1167

 Score =  832 bits (2149), Expect = 0.0,   Method: Composition-based stats.
 Identities = 644/1033 (62%), Positives = 799/1033 (77%), Gaps = 7/1033 (0%)

Query: 7    KSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAG 66
            K+P FVHL+VHS+YSLLEGAL L  I+ K   D QPAIAITDTNNLF ALEFS+KA   G
Sbjct: 16   KTPGFVHLRVHSAYSLLEGALPLKKIMSKAVGDGQPAIAITDTNNLFVALEFSEKARDEG 75

Query: 67   IQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            +QPIIGCQL IDMQD  +      +    +P+IVLL + AEGY+RL++LVSR YL  +G 
Sbjct: 76   LQPIIGCQLSIDMQDAAEDRRNHNSHLQKLPAIVLLAANAEGYERLVDLVSRAYLDGEGG 135

Query: 127  -QSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVN 185
              SV I  +WL+E    GLI LTG S GP+D A     +  A++RLLT K LFGDRLY+ 
Sbjct: 136  SHSVHITRAWLEEASNAGLIALTGASGGPVDMALKEGHAAQAKERLLTLKSLFGDRLYIE 195

Query: 186  LQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDR 245
            LQR  GYDR  E +++ LAY H++PLVATN + F S+ DYEAHD LMAVAH+ +VS   R
Sbjct: 196  LQRQSGYDRSHERRLIGLAYEHDIPLVATNEAFFPSKADYEAHDALMAVAHNAIVSDDSR 255

Query: 246  PRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
             R+TPDHYLK+R EM ++F+DLPEALENTVEIA RCS++L+   PILPRF     D    
Sbjct: 256  FRLTPDHYLKSRDEMTALFADLPEALENTVEIALRCSYVLKKRGPILPRFTGASDDPEAA 315

Query: 306  EEENE--LRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADF 363
            E      LR +AV GL+ RL+   +A GY  QDYR+RLDFEL VI+RMKF GYFLIVADF
Sbjct: 316  ERAETEELRRQAVEGLDQRLSALGMAPGYTEQDYRERLDFELGVISRMKFPGYFLIVADF 375

Query: 364  IQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFC 423
            I+WAK+ +IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNP+R+SMPDFDIDFC
Sbjct: 376  IKWAKQQDIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPERVSMPDFDIDFC 435

Query: 424  QDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDP 483
            QDRR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL+PN+P
Sbjct: 436  QDRREEVIRYVQRKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKLVPNNP 495

Query: 484  AHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQL 542
            A+P    +AI ++ R +E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLS+L
Sbjct: 496  ANPTPLSKAIEEEPRLQEEADKEPVVARLLDIAQKIEGLYRHASTHAAGIVIGDRPLSKL 555

Query: 543  VPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIP 602
            VPMYRD RSD+PVTQFNMKW+E AGL+KFDFLGLKTLT+L+ ++DF+A+RG+KVDL+ IP
Sbjct: 556  VPMYRDPRSDMPVTQFNMKWVESAGLVKFDFLGLKTLTVLKVAVDFVAKRGIKVDLAAIP 615

Query: 603  FDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYN 662
             +D +TY +L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI VYN
Sbjct: 616  LEDAKTYEMLSRGETIGVFQVESAGMRKALIGMRPDCIEDIIALVALYRPGPMENIPVYN 675

Query: 663  NRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIK 722
             RK+G+E++ SIHP ID +LKETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKIK
Sbjct: 676  ARKHGEEELESIHPTIDHLLKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIK 735

Query: 723  EEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTH 782
            EEMD+Q+ERF+ GA KNG+SK  A  IF+LLAKFA+YGFNKSHAAAYA++SYQTA+MK H
Sbjct: 736  EEMDQQRERFVDGAIKNGVSKPQANTIFDLLAKFANYGFNKSHAAAYAIVSYQTAYMKAH 795

Query: 783  YPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAI 842
            YPVEFLAASMTL+M N EK+  F QDA +  I+++ PSV T    F+ G+NRIYYSLAAI
Sbjct: 796  YPVEFLAASMTLDMANTEKLNDFRQDAGRLGIEVVAPSVQTSFRQFETGENRIYYSLAAI 855

Query: 843  KGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
            KGVG     HI++   +KPF SLEDFC R+D K++NRRVLESL+ AGA DCFG  R +L+
Sbjct: 856  KGVGEGAVEHIVQVRGEKPFTSLEDFCLRIDPKQINRRVLESLINAGAFDCFGRDRAELI 915

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFY 962
              LD I  YAQ  + NRT    ++F    GT  +K+ L  F     S +   E +VLGFY
Sbjct: 916  GGLDRIIGYAQMAQNNRTIGQSDMFGSGGGTGPEKLILPAFQSWLPSEKLIREYQVLGFY 975

Query: 963  FSGHPLDVYKPILRKMGIKGYEESVATIRG--NNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
             + HPLD Y+P+L K+ ++ + +  A ++   + + RLA  V  KQ++KTR G+++G VT
Sbjct: 976  LTAHPLDTYRPLLEKLRVQNFADFSAAVKQGASTVGRLAGTVTGKQERKTRTGNKMGIVT 1035

Query: 1020 FSEPAKEYEANFF 1032
            FS+ + +YEA  F
Sbjct: 1036 FSDASGQYEAVLF 1048


>gi|225180853|ref|ZP_03734301.1| DNA polymerase III, alpha subunit [Dethiobacter alkaliphilus AHT 1]
 gi|225168334|gb|EEG77137.1| DNA polymerase III, alpha subunit [Dethiobacter alkaliphilus AHT 1]
          Length = 1144

 Score =  830 bits (2144), Expect = 0.0,   Method: Composition-based stats.
 Identities = 408/1039 (39%), Positives = 604/1039 (58%), Gaps = 30/1039 (2%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            S +FVHL VH+ YSLL+GA  + N + + A    PA+AITD   ++  ++F + A  AGI
Sbjct: 3    SSNFVHLHVHTEYSLLDGASKIKNTVARAAELDMPALAITDHGVMYGVIDFYKAAKDAGI 62

Query: 68   QPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQ 127
            +P+IGC++ +  +       +          +VLL     GY  L+ELVSR +  +    
Sbjct: 63   KPVIGCEVYVAPRTRHD---RDSRRDSKQHHLVLLAQDQTGYANLMELVSRGF-SEGFYY 118

Query: 128  SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNL 186
              R+    LQ    +GL +L+   +G I  A      + A K +  +K+ FG +  ++ L
Sbjct: 119  KPRVDHELLQRY-NKGLTVLSACLAGEIPVALLEGRQEDARKLVSFYKETFGSENFFLEL 177

Query: 187  QRHRGYDRYRES-QVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDR 245
            Q H   ++   S  ++ LA   + P+V +N+  +   ED  AHD L+ +     +  ++R
Sbjct: 178  QDHGLQEQKELSPLLIDLAKDTQTPMVVSNDLHYTHREDAHAHDALLCIQTGKTLDDENR 237

Query: 246  PRVT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQ 304
             R +  + YLK   EM S++ DLPE L+NTV IA  C+         LP +      D  
Sbjct: 238  MRFSTEEFYLKTAEEMGSLYPDLPELLDNTVHIAENCNVDFDFSTTYLPGYEVPPAHD-- 295

Query: 305  KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
              E + LR   V G + R  +            ++RLD+EL+VIA+M +  YFLI  DF+
Sbjct: 296  --ERSYLRELCVQGTKERYGE------ELPPHVQERLDYELSVIAQMGYDSYFLITWDFV 347

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
             +A +N I VGPGRGS AGS+ AYAL IT+IDPL++ LLFERFLNP+R++MPD DIDFC 
Sbjct: 348  NYAHENGILVGPGRGSAAGSLVAYALGITNIDPLKYGLLFERFLNPERVTMPDIDIDFCY 407

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            + R++VI YV  KYG E VAQIITFG++ A+AA+RDVGR L +PY+ VDR+ KLIP +  
Sbjct: 408  ENREKVIDYVVEKYGEECVAQIITFGTMAARAAVRDVGRVLNVPYADVDRIAKLIPAELN 467

Query: 485  HPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
              +    +      +E    D  + +LL++S  +EGL RHASTHAAG+VI   PL   VP
Sbjct: 468  ISI-ADGLEKSPDLKELYDKDEKIRQLLDLSMAVEGLPRHASTHAAGVVISKDPLVNYVP 526

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPF 603
            + +     + VTQF M  +E+ GL+K DFLGL+TLT++ +++  + +  GV+VDL+ +P 
Sbjct: 527  LQKAGEDGM-VTQFPMGTLEELGLLKMDFLGLRTLTIMGEAVRLIKKSTGVEVDLNELPL 585

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNN 663
            DD  T+H+L+   T GIFQLES GMR  L  M+PD  EDIIA+V+LYRPGP++ I  +  
Sbjct: 586  DDKNTFHMLSQGDTSGIFQLESGGMRGILREMKPDVFEDIIAVVALYRPGPMEQIPTFIQ 645

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
             K+G   I  +H  ++P+LKET G+++YQEQ+MQ+A  ++G+SL E+D+LRRA+GKK  E
Sbjct: 646  SKHGHIPIKYLHSDLEPILKETYGIMVYQEQIMQVASAMAGFSLGESDLLRRAIGKKKLE 705

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             +++Q+E F++G    G  K +A  +++L+ KFA YGFNKSHAAAYA+++YQTA++K +Y
Sbjct: 706  VLNQQRELFVNGCVAKGHKKEMANELYDLIVKFASYGFNKSHAAAYALVAYQTAYLKANY 765

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR-IYYSLAAI 842
            P +F+AA +T  M   EK+  +  + +Q  I ++PP VN    +F V D + I Y +AA+
Sbjct: 766  PTQFMAAQLTGVMGTTEKVAGYIANCKQMGISVLPPDVNLSEKNFTVTDAKVIRYGMAAV 825

Query: 843  KGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            K VG      I+ A  +   F SL DFC+RVD +  N++V+ESL+ AGA DC G +R QL
Sbjct: 826  KNVGLGAIESIIAARKEQGDFTSLRDFCARVDLRSCNKKVMESLIKAGAFDCLGANRNQL 885

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD------KITLEKFSVENSSVRFENE 955
            L  LD     AQ + K R N    +F   +    D      +  L          R   E
Sbjct: 886  LAILDETVSAAQTMHKERQNGQMCMFEVVEEDEEDCQWVNLQDDLPDIPAPLPRERLNME 945

Query: 956  QRVLGFYFSGHPLDVYKPILRKM-GIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSR 1014
            +  LG Y +GHPL+ Y+ +L     +   +         ++ +A M+   +   T+KG  
Sbjct: 946  KDTLGLYITGHPLEEYENVLNIYPDLARTDTLQKAPDNKSVVIAGMINGLKPIITKKGKP 1005

Query: 1015 IGWVTFSEPAKEYEANFFP 1033
            + + T  + A   E   FP
Sbjct: 1006 MAFFTLEDLAGGLEVVVFP 1024


>gi|260887140|ref|ZP_05898403.1| DNA polymerase III, alpha subunit [Selenomonas sputigena ATCC 35185]
 gi|260863202|gb|EEX77702.1| DNA polymerase III, alpha subunit [Selenomonas sputigena ATCC 35185]
          Length = 1137

 Score =  830 bits (2143), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/1040 (36%), Positives = 598/1040 (57%), Gaps = 31/1040 (2%)

Query: 3    QYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKA 62
              + K P F HL VH+ YSLL+GA  +  ++ +       ++AITD   ++  ++F ++A
Sbjct: 5    AAMTKIP-FAHLHVHTCYSLLDGASRIPELIARTKELGMDSVAITDHGAMYGVIDFYKEA 63

Query: 63   CAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLL 122
               GI+PIIGC+  +  +     T   +        ++LL    EGY+ L++LVS     
Sbjct: 64   KKQGIRPIIGCEAYLAPESRFDRT---EVRGTRYYHLILLAENDEGYRSLVKLVSLANT- 119

Query: 123  DQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DR 181
            +      R+    L++   +GLI L+   +G I +A      + AEK +  +  +FG + 
Sbjct: 120  EGMYYKPRVDKDILRKYH-KGLICLSACVAGEIPQAILRGERERAEKLVEEYIDIFGREN 178

Query: 182  LYVNLQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVV 240
             ++ +Q H   D     + V++LA    + LVATN+  ++ +ED EAHDVL+A+     V
Sbjct: 179  FFLEIQDHGIPDEKTAFAGVIELAEKFGVGLVATNDIHYVHKEDTEAHDVLLAIQTGKGV 238

Query: 241  SQKDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKE 299
                R R    + Y+++  EM  +F D PEAL NT +IA RC    +     LP F   E
Sbjct: 239  HDPTRMRYAEGEFYMRSPEEMQELFHDHPEALANTQKIAERCKVDFEFGHLHLPNFPLPE 298

Query: 300  CDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
                   ++  LR              ++         R+RLD+EL++I RM +  YFLI
Sbjct: 299  GM----TDDAYLRQLCEE-------NLSLRYEKITPAVRERLDYELSIIHRMGYDSYFLI 347

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V DFI++A+   I VGPGRGS AGS+ AY L IT++DPL++ LLFERFLNP+R++MPD D
Sbjct: 348  VWDFIKYARGEGIAVGPGRGSAAGSIVAYLLGITNLDPLKYELLFERFLNPERVTMPDID 407

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            IDFC  RR+EVI YV+ +YG + VAQIITFG++ AK A+RDVGRAL+M Y+ VDR+ K +
Sbjct: 408  IDFCYIRREEVIDYVKRRYGADHVAQIITFGTMAAKGAIRDVGRALEMTYASVDRVAKAV 467

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P++    +    +AD   FR          RL++ ++ LEGL RH+STHAAG+VI   PL
Sbjct: 468  PSELGITLDRA-LADSQDFRSIYEESDETKRLIDFARDLEGLPRHSSTHAAGVVIARNPL 526

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDL 598
            +  VP+   V     VT+++   +E+ GL+K DFLGL+TLT++  +L  + + RGV +D+
Sbjct: 527  TDYVPVQ--VSDGTLVTEYDKDHVEELGLLKMDFLGLRTLTVIADALKNIKKSRGVTIDI 584

Query: 599  SLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNI 658
              +P +D +T  +L    T  +FQ+ES+GM   ++ +QP   +D+I  V+LYRPGP+ + 
Sbjct: 585  DTMPLEDEKTAEMLCRGDTGAVFQMESAGMTNLVKDLQPKNFQDLIPTVALYRPGPLGSG 644

Query: 659  V--VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRA 716
            +   +   ++GK+K+  +HPL++P+LKET GV++YQEQVMQ+ Q+L+ ++L +AD+LRRA
Sbjct: 645  MVTDFIAGRHGKKKVTYLHPLLEPILKETFGVVLYQEQVMQVVQVLANFTLGQADILRRA 704

Query: 717  MGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQT 776
            MGKK  E +  Q+E ++ G  +NGI   +A  IF+LL  FADYGFNKSH+AAYA++++QT
Sbjct: 705  MGKKKHEVLMSQRETYMKGTRENGIDDALAEKIFDLLTHFADYGFNKSHSAAYALVAWQT 764

Query: 777  AWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIY 836
            A++K HYP EF+AA +T  MD  +K+  + +  R+  I+I+PP VN    +F V    I 
Sbjct: 765  AYLKAHYPQEFMAAMLTSIMDTNDKVGVYIELCRRMGIKILPPDVNASEANFSVDGAAIR 824

Query: 837  YSLAAIKGVGTTTARHIMEASADK-PFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFG 895
            + LAA++ VG    + +     +   F SL DFC+RVD +  N+RVLESL+  GA D  G
Sbjct: 825  FGLAAVRNVGEAAIKSLAAVREEGGAFTSLLDFCTRVDMRTANKRVLESLIKCGAFDSLG 884

Query: 896  YSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENE 955
              R QLL  L+ +   A     +  +    +F       ++ + L      +S  R   E
Sbjct: 885  AHRSQLLAVLERVIDVAARKHADAASGQIGLFGEAAMQEAEDVALPDIDEADSVQRLAWE 944

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNN--IRLAAMVVSKQQKKTRKGS 1013
            +   GF+ +GHPLD ++  ++   +    + +   +     +R+  ++ S ++  T+KG 
Sbjct: 945  KENTGFFITGHPLDRHEKKIK--NLVPIGDILDGKKKERQLVRIGGLISSAKRIATKKGD 1002

Query: 1014 RIGWVTFSEPAKEYEANFFP 1033
             + ++   +     E   FP
Sbjct: 1003 TMCFLELEDYTHSVEVVVFP 1022


>gi|330839090|ref|YP_004413670.1| DNA polymerase III, alpha subunit [Selenomonas sputigena ATCC 35185]
 gi|329746854|gb|AEC00211.1| DNA polymerase III, alpha subunit [Selenomonas sputigena ATCC 35185]
          Length = 1131

 Score =  830 bits (2143), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/1038 (36%), Positives = 598/1038 (57%), Gaps = 31/1038 (2%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            + K P F HL VH+ YSLL+GA  +  ++ +       ++AITD   ++  ++F ++A  
Sbjct: 1    MTKIP-FAHLHVHTCYSLLDGASRIPELIARTKELGMDSVAITDHGAMYGVIDFYKEAKK 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GI+PIIGC+  +  +     T   +        ++LL    EGY+ L++LVS     + 
Sbjct: 60   QGIRPIIGCEAYLAPESRFDRT---EVRGTRYYHLILLAENDEGYRSLVKLVSLANT-EG 115

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLY 183
                 R+    L++   +GLI L+   +G I +A      + AEK +  +  +FG +  +
Sbjct: 116  MYYKPRVDKDILRKYH-KGLICLSACVAGEIPQAILRGERERAEKLVEEYIDIFGRENFF 174

Query: 184  VNLQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + +Q H   D     + V++LA    + LVATN+  ++ +ED EAHDVL+A+     V  
Sbjct: 175  LEIQDHGIPDEKTAFAGVIELAEKFGVGLVATNDIHYVHKEDTEAHDVLLAIQTGKGVHD 234

Query: 243  KDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
              R R    + Y+++  EM  +F D PEAL NT +IA RC    +     LP F   E  
Sbjct: 235  PTRMRYAEGEFYMRSPEEMQELFHDHPEALANTQKIAERCKVDFEFGHLHLPNFPLPEGM 294

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
                 ++  LR              ++         R+RLD+EL++I RM +  YFLIV 
Sbjct: 295  ----TDDAYLRQLCEE-------NLSLRYEKITPAVRERLDYELSIIHRMGYDSYFLIVW 343

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DFI++A+   I VGPGRGS AGS+ AY L IT++DPL++ LLFERFLNP+R++MPD DID
Sbjct: 344  DFIKYARGEGIAVGPGRGSAAGSIVAYLLGITNLDPLKYELLFERFLNPERVTMPDIDID 403

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FC  RR+EVI YV+ +YG + VAQIITFG++ AK A+RDVGRAL+M Y+ VDR+ K +P+
Sbjct: 404  FCYIRREEVIDYVKRRYGADHVAQIITFGTMAAKGAIRDVGRALEMTYASVDRVAKAVPS 463

Query: 482  DPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            +    +    +AD   FR          RL++ ++ LEGL RH+STHAAG+VI   PL+ 
Sbjct: 464  ELGITLDRA-LADSQDFRSIYEESDETKRLIDFARDLEGLPRHSSTHAAGVVIARNPLTD 522

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSL 600
             VP+   V     VT+++   +E+ GL+K DFLGL+TLT++  +L  + + RGV +D+  
Sbjct: 523  YVPVQ--VSDGTLVTEYDKDHVEELGLLKMDFLGLRTLTVIADALKNIKKSRGVTIDIDT 580

Query: 601  IPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV- 659
            +P +D +T  +L    T  +FQ+ES+GM   ++ +QP   +D+I  V+LYRPGP+ + + 
Sbjct: 581  MPLEDEKTAEMLCRGDTGAVFQMESAGMTNLVKDLQPKNFQDLIPTVALYRPGPLGSGMV 640

Query: 660  -VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMG 718
              +   ++GK+K+  +HPL++P+LKET GV++YQEQVMQ+ Q+L+ ++L +AD+LRRAMG
Sbjct: 641  TDFIAGRHGKKKVTYLHPLLEPILKETFGVVLYQEQVMQVVQVLANFTLGQADILRRAMG 700

Query: 719  KKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            KK  E +  Q+E ++ G  +NGI   +A  IF+LL  FADYGFNKSH+AAYA++++QTA+
Sbjct: 701  KKKHEVLMSQRETYMKGTRENGIDDALAEKIFDLLTHFADYGFNKSHSAAYALVAWQTAY 760

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K HYP EF+AA +T  MD  +K+  + +  R+  I+I+PP VN    +F V    I + 
Sbjct: 761  LKAHYPQEFMAAMLTSIMDTNDKVGVYIELCRRMGIKILPPDVNASEANFSVDGAAIRFG 820

Query: 839  LAAIKGVGTTTARHIMEASADK-PFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            LAA++ VG    + +     +   F SL DFC+RVD +  N+RVLESL+  GA D  G  
Sbjct: 821  LAAVRNVGEAAIKSLAAVREEGGAFTSLLDFCTRVDMRTANKRVLESLIKCGAFDSLGAH 880

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQR 957
            R QLL  L+ +   A     +  +    +F       ++ + L      +S  R   E+ 
Sbjct: 881  RSQLLAVLERVIDVAARKHADAASGQIGLFGEAAMQEAEDVALPDIDEADSVQRLAWEKE 940

Query: 958  VLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNN--IRLAAMVVSKQQKKTRKGSRI 1015
              GF+ +GHPLD ++  ++   +    + +   +     +R+  ++ S ++  T+KG  +
Sbjct: 941  NTGFFITGHPLDRHEKKIK--NLVPIGDILDGKKKERQLVRIGGLISSAKRIATKKGDTM 998

Query: 1016 GWVTFSEPAKEYEANFFP 1033
             ++   +     E   FP
Sbjct: 999  CFLELEDYTHSVEVVVFP 1016


>gi|94267210|ref|ZP_01290812.1| DNA polymerase III, alpha subunit [delta proteobacterium MLMS-1]
 gi|93452086|gb|EAT02768.1| DNA polymerase III, alpha subunit [delta proteobacterium MLMS-1]
          Length = 1174

 Score =  829 bits (2142), Expect = 0.0,   Method: Composition-based stats.
 Identities = 428/1036 (41%), Positives = 617/1036 (59%), Gaps = 17/1036 (1%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL VH+ YS+L+GA+ L+ +  K       A+AITD   +F ALEF  KA  AGI+
Sbjct: 2    SDFVHLHVHTQYSMLDGAIRLDRLFAKCREYGMEAVAITDHGAMFGALEFYVKAKKAGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC+  I        + +          ++LL     GYQ L++L +   L +     
Sbjct: 62   PIIGCEFYIAPDSRRDKSAKSAGAAAHH--LMLLAMDQTGYQNLMKLATIAQL-EGFHYK 118

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             RI L  L     EGLI +T    G +           A        +LF  RLY+ +Q 
Sbjct: 119  PRIDLEVLAA-HREGLIAMTACLHGKVPSLLVKGDKAGARAEAKRLHELFPGRLYLEMQE 177

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            ++  ++      + +LA   ELPLVATN+  +L  E+ +AH+VL+ +     ++ +DR R
Sbjct: 178  NQIPEQTTVNEGLKELAAELELPLVATNDCHYLDREEAKAHEVLLCIQTGKTMAAQDRFR 237

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T + + K+ +EM + F+  P+AL  T EIA+RC+  L + +   P F     D +   
Sbjct: 238  FATDELFFKSPAEMKAAFAHSPQALAATAEIAQRCNLELDLESHHFPDFPVPTGDTLASL 297

Query: 307  EENELRN-KAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
             E E R   A    E+R  QG        + YRQRL+ E++VI +M F GYFLIVADFI 
Sbjct: 298  FEREARAGLAQRLTEMRDKQGLTVGAELEEQYRQRLEHEIDVINQMGFPGYFLIVADFIN 357

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            WAK   IPVGPGRGSGAGS+ AYA+ ITD+DP+   L+FERFLN +R SMPDFD+DFCQ+
Sbjct: 358  WAKDQQIPVGPGRGSGAGSLVAYAMRITDVDPIPHGLIFERFLNIERKSMPDFDVDFCQE 417

Query: 426  RRDEVIRYVQNKY-GHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            RR EVI YVQ+KY G   V QI+T+GS++AKA +RDVGRAL M + + DR+ KLIP++  
Sbjct: 418  RRGEVIDYVQHKYGGQSHVVQIVTYGSMKAKAVVRDVGRALGMSFGEADRIAKLIPDELN 477

Query: 485  HPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
              +  +AI  + +F+E    +P V  LL +++ LEGL RH S HAAG+VI  RP+ + +P
Sbjct: 478  ITLD-KAIDKEPKFKELMKREPQVAELLNVAKVLEGLNRHTSIHAAGVVISPRPMVEYLP 536

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-GVKVDLSLIPF 603
            + +       +TQ++MK  E  GLIKFDFLGLKTLT++ ++   +      +VD++ IP 
Sbjct: 537  LCKGP-KGEVLTQYDMKHTEMTGLIKFDFLGLKTLTVIDRACKLIKADLDHEVDIAAIPM 595

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VY 661
            DD +T+ LL     LG+FQLESSGMR  L  M+P+   D+IALV+LYRPGP+++ +   +
Sbjct: 596  DDAKTFDLLCKGDALGVFQLESSGMRSLLMKMKPEQFSDLIALVALYRPGPLESGMVEDF 655

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
             N K+G+         ++P+LKET GVI+YQEQVM+IA +L+GYSL +AD LRRAMGKKI
Sbjct: 656  VNTKHGRMVAKYPLAQLEPILKETYGVIVYQEQVMKIANVLAGYSLGDADNLRRAMGKKI 715

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
             E M+ +K +F++G + NGI    A  IF+L+AKFA YGFNKSH+AAYA+I+YQTAW+K 
Sbjct: 716  PEVMEAEKGKFMAGCADNGIDPKKAEYIFDLVAKFAGYGFNKSHSAAYALIAYQTAWLKA 775

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYP +F+AA ++ +M N +K+ ++  + R+  I+++PP +N    DF V D+RI + LAA
Sbjct: 776  HYPSQFMAALLSCDMGNTDKVVRYINECREHEIEVLPPDINESFRDFTVIDDRIRFGLAA 835

Query: 842  IKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQ 900
            +K VG      I+E    D P+ SL DFC RVD +K+NRRV+ESL+ AGA D  G  R Q
Sbjct: 836  VKNVGGAALDSIIEVRETDGPYQSLSDFCGRVDGRKVNRRVIESLIKAGAFDSLGAKRAQ 895

Query: 901  LLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDK---ITLEKFSVENSSVRFENEQR 957
            L   LD     AQ  +++R +   ++FA      + +   I L + +  +   R   E+ 
Sbjct: 896  LFAILDQAMDQAQATQRDRQSGQISLFAAMPAEQAAQAQNIELPEIAEWDEKQRLLLEKE 955

Query: 958  VLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGW 1017
             +GFY +GHPLD Y+  L  +      +         +R+  ++   +  +++KG  + +
Sbjct: 956  TVGFYLTGHPLDKYRRELSGVIDTDLHDLADWNEQQPVRVGGLIRHCKPHRSKKGDAMAF 1015

Query: 1018 VTFSEPAKEYEANFFP 1033
            +T  +     E   FP
Sbjct: 1016 LTLEDTLASAEVVIFP 1031


>gi|298291824|ref|YP_003693763.1| DNA polymerase III subunit alpha [Starkeya novella DSM 506]
 gi|296928335|gb|ADH89144.1| DNA polymerase III, alpha subunit [Starkeya novella DSM 506]
          Length = 1149

 Score =  829 bits (2141), Expect = 0.0,   Method: Composition-based stats.
 Identities = 559/1036 (53%), Positives = 741/1036 (71%), Gaps = 18/1036 (1%)

Query: 2    TQYLEKSPS-FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQ 60
             Q + ++ + FVHL VHSS+SLLEGAL++  + +    D+QPAIA+TDT NLF ALEFS+
Sbjct: 3    QQDMTQADAGFVHLHVHSSFSLLEGALTIGKLAELAKKDRQPAIALTDTGNLFGALEFSE 62

Query: 61   KACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMY 120
            K   +GIQPI+GC L +D          G       P +VLL  + EG++ L+ELVSR +
Sbjct: 63   KMAGSGIQPILGCALSVDFPGPAPRGPAG----QQRPRVVLLAMSEEGWKNLMELVSRSF 118

Query: 121  LLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD 180
            L      +  I L WL E  T GLI LTGG SGPIDRA    S   AE+RL T  +LFGD
Sbjct: 119  LDTASDGAPHIKLDWL-EGRTGGLIALTGGPSGPIDRALAAGSHDQAEQRLHTLAELFGD 177

Query: 181  RLYVNLQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTV 239
            RLYV +QRH   +  R E+ +++LAY  +LPLVATN   F  ++DYEAHD L+ +A   +
Sbjct: 178  RLYVEIQRHGVAEERRVETALIELAYRLDLPLVATNEPFFAGQDDYEAHDALICIAEGRL 237

Query: 240  VSQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKE 299
            V++ DR ++TP+H  + R+EM+++F+DLPEAL NTVEIARRC++  +   PILPR     
Sbjct: 238  VAEGDRRQLTPEHRFRTRAEMMALFADLPEALANTVEIARRCAYRPRTVKPILPR----- 292

Query: 300  CDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
               ++++E  ELR +A  GL  RLA    A G   +DY  RL FEL++I +MKF GYFLI
Sbjct: 293  -FTMERDEAEELRVQAEEGLRKRLAVHGPAPGLAEKDYEDRLAFELSIIEKMKFPGYFLI 351

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V+DFI+WAK   IPVGPGRGSGAGS+ AY+LTITD+DPLRF LLFERFLNP+R+SMPDFD
Sbjct: 352  VSDFIKWAKAQGIPVGPGRGSGAGSLVAYSLTITDLDPLRFGLLFERFLNPERVSMPDFD 411

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            IDFCQ+RRDEVIRYVQ +YG ++VAQIITFG+LQA+  LRDVGR L+MPY QVD+LCKL+
Sbjct: 412  IDFCQERRDEVIRYVQQRYGRDQVAQIITFGTLQARGVLRDVGRVLEMPYGQVDKLCKLV 471

Query: 480  PNDPAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRP 538
            P +PA+PV+  QAI  + R +     +P V R  +I+ KLEGL RHASTHAAGIVIGDR 
Sbjct: 472  PQNPANPVTLTQAIEGEPRLQAESEQNPVVKRAFDIATKLEGLNRHASTHAAGIVIGDRK 531

Query: 539  LSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDL 598
            LS LVP+YRD RSD+PVTQ+NMKW+E+AGL+KFDFLGLKTLT+LQ ++  +AQ G+++DL
Sbjct: 532  LSNLVPLYRDPRSDMPVTQYNMKWVEQAGLVKFDFLGLKTLTVLQTAVRLVAQLGIQLDL 591

Query: 599  SLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNI 658
            S IP +D +TY +LT   T+G+FQ+ESSGMR+AL  M+PD +EDIIALV+LYRPGP+ NI
Sbjct: 592  STIPLNDEKTYAMLTRGETVGVFQVESSGMRRALVDMKPDRLEDIIALVALYRPGPMANI 651

Query: 659  VVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMG 718
             VY   KNG E+ V  HP ++  LKET GVIIYQEQVMQIAQ LSGYSL EAD+LRRAMG
Sbjct: 652  PVYCAVKNGHEQAVYAHPALESSLKETYGVIIYQEQVMQIAQTLSGYSLGEADLLRRAMG 711

Query: 719  KKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            KKI+ EMDKQ+ERF+SGA + G++K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+
Sbjct: 712  KKIRAEMDKQRERFVSGAVERGVAKAKASEIFDLLAKFADYGFNKSHAAAYALVSYQTAY 771

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            MK +Y  EFLAASMTL+M N +K+ +F Q+A++  I+++PPSVN    +F V + RI Y+
Sbjct: 772  MKANYATEFLAASMTLDMGNTDKLAEFRQEAQRLGIEVVPPSVNHSGREFAVKEGRILYA 831

Query: 839  LAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSR 898
            LAAIKGVG      I+EA  D+PF SL DF +R+++K LN+R +ESLV AGA D    +R
Sbjct: 832  LAAIKGVGVHAVEAIVEARGDRPFASLSDFAARINAKALNKRTMESLVNAGAFDALEPNR 891

Query: 899  MQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRV 958
             +   ++D+I  +A  V         N+F       + ++ +   +    + + + E   
Sbjct: 892  ARAAAAIDSILAHAASVGAEAAIGQGNMFGGPAA--ATELPIPNATPWLPAEKLQREYDA 949

Query: 959  LGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNI--RLAAMVVSKQQKKTRKGSRIG 1016
            +GF+ +GHPLD Y   L ++ ++ + +   ++R  +I  RLAA VVS+Q+++T+ G+++G
Sbjct: 950  IGFFLTGHPLDEYGKALDRLRVQRWSDFTRSVRAGSIAGRLAATVVSRQERRTKTGNKMG 1009

Query: 1017 WVTFSEPAKEYEANFF 1032
             V  S+P+ ++EA  F
Sbjct: 1010 IVGLSDPSGQFEAVLF 1025


>gi|160945128|ref|ZP_02092354.1| hypothetical protein FAEPRAM212_02647 [Faecalibacterium prausnitzii
            M21/2]
 gi|158442859|gb|EDP19864.1| hypothetical protein FAEPRAM212_02647 [Faecalibacterium prausnitzii
            M21/2]
          Length = 1169

 Score =  829 bits (2141), Expect = 0.0,   Method: Composition-based stats.
 Identities = 375/1056 (35%), Positives = 596/1056 (56%), Gaps = 42/1056 (3%)

Query: 1    LTQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQ 60
            +++    +  F HL +H+ YSLL+GA  ++ +++++    Q AIA TD   ++  ++F +
Sbjct: 1    MSEPTANTRPFAHLHIHTEYSLLDGACRIDQLMERVKECGQTAIACTDHGVMYGCVQFYK 60

Query: 61   KACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMY 120
             A  AGI+PIIGC++ +  +      N+          ++LL     GY+ LI++VS  +
Sbjct: 61   AAKKAGIKPIIGCEVYVATRTRFDKVNK----IDGNNHLILLCKNETGYKNLIKMVSAGF 116

Query: 121  LLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG- 179
             ++      R+    L++   EGLI L+   +G I +A      + A+   L ++ LFG 
Sbjct: 117  -VEGFYSKPRVDKQLLEQYH-EGLICLSACLAGEIPQAILAGDYERAKATALWYRDLFGA 174

Query: 180  DRLYVNLQRHRG-YDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHST 238
            +  Y+ LQ H    D     Q+++L+    +P+ ATN++ +L +ED +   +L+ +    
Sbjct: 175  ENYYIELQDHGLKEDSTVLPQLIKLSRETGIPMAATNDAHYLRKEDAKMQSILLCIQTGK 234

Query: 239  VVSQKDRP-RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIE 297
             +   DR    T + Y+K   EM  +FS +PEA  NT +IA +C+F  +     +P +  
Sbjct: 235  TIQDADRMEFQTDEFYVKTTDEMYELFSMVPEACANTAKIAEQCNFDFEFGHTKIPYYKA 294

Query: 298  KECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYF 357
             +  D Q             GLE R            Q    RL +E++V+  M ++ Y+
Sbjct: 295  PDGMDNQ----AYFEKLCWDGLERRYGPDV------PQANIDRLKYEISVVKTMGYTNYY 344

Query: 358  LIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPD 417
            LIV D+I +AK   IPVGPGRGSGAGS+ AY + ITDIDP+R++L+FERFLNP+R+SMPD
Sbjct: 345  LIVWDYINFAKSQGIPVGPGRGSGAGSIAAYCVGITDIDPIRYNLIFERFLNPERVSMPD 404

Query: 418  FDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCK 477
            FD+DFC +RR EVI YV  KYG + VAQI+TFG++ A+ A+RDVGR + +PY QVD + K
Sbjct: 405  FDVDFCYERRQEVIDYVNRKYGADHVAQIVTFGTMAARNAIRDVGRVMGIPYQQVDVVAK 464

Query: 478  LIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDR 537
            L+P +    +  +A+   S  ++    DP V  L++ + K+EG+ RHASTHAAG+VI   
Sbjct: 465  LVPMELKMTLK-RALEVSSELKKLYDTDPQVTELIDTALKVEGMPRHASTHAAGVVITPE 523

Query: 538  PLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVD 597
            P    +P+       LPVTQFNM  IE+ GL+K DFLGL+TLT+++ +   + ++  +  
Sbjct: 524  PTDYYLPL--ATNDGLPVTQFNMTEIEELGLLKMDFLGLRTLTVIRDAEVAVQKQHPEFS 581

Query: 598  LSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDN 657
            + ++ +DD +TY +L    T G+FQLESSGM+Q L G+QP  +ED+IAL+SLYRPGP+D+
Sbjct: 582  IRMLDYDDPDTYKMLGQGDTEGVFQLESSGMKQVLVGLQPQNLEDVIALISLYRPGPMDS 641

Query: 658  IVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAM 717
            I  Y   ++  +KI    P +  +L  T G I+YQEQVMQI + L+G+S  +AD +RRAM
Sbjct: 642  IPTYLRNRHEPDKISYKTPQLAHILDVTNGCIVYQEQVMQIFRELAGFSFGQADNVRRAM 701

Query: 718  GKKIKEEMDKQKERFISGASKNGI----------SKTIAVNIFELLAKFADYGFNKSHAA 767
             KK    M+ ++E F+ G ++ G            + +A  I++ ++ FA Y FNKSHAA
Sbjct: 702  SKKKHAVMEAEREHFVHGCTEPGHECPGCVANGIPEQVANQIYDEMSSFASYAFNKSHAA 761

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
             YA +++QTA++K HYP +F+AA +T  +DN +K+ ++  +  +  I+++PP VN     
Sbjct: 762  CYAYVAFQTAYLKCHYPSQFMAALLTSVLDNTDKVIEYSGECARLGIKVLPPDVNISNGG 821

Query: 828  FKVGDN-RIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLV 886
            F   DN +I + L A+K VG     + +    +KP+ SL DFC R+   +LNRR +ESL+
Sbjct: 822  FTADDNGQIRFGLNAVKNVGRNLIENAVTERKEKPYTSLYDFCKRMHGSELNRRAVESLI 881

Query: 887  FAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKI-----TLE 941
             AGA DCFG +R  ++++++ I K  +   +       ++F+   G            + 
Sbjct: 882  KAGAFDCFGSNRHSMVEAVEGILKSIETDSRRNLEGQLDLFSVMSGEVQQSPQEDVYEIR 941

Query: 942  KFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEES----VATIRGNNIRL 997
              +    +   + E+ V G Y SGHPLD Y+    ++G    ++          G  +R+
Sbjct: 942  PLAEYTPAELLQQEKEVSGLYLSGHPLDAYREKSARIGSHTIKDLTGEDAHVQDGEKVRI 1001

Query: 998  AAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
               VV  +   T+  S + + +  +     E   FP
Sbjct: 1002 VCAVVKNRMMTTKSNSMMAFTSVEDLTGTMEVIVFP 1037


>gi|295105629|emb|CBL03173.1| DNA polymerase III catalytic subunit, DnaE type [Faecalibacterium
            prausnitzii SL3/3]
          Length = 1169

 Score =  829 bits (2140), Expect = 0.0,   Method: Composition-based stats.
 Identities = 375/1056 (35%), Positives = 594/1056 (56%), Gaps = 42/1056 (3%)

Query: 1    LTQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQ 60
            +++    +  F HL +H+ YSLL+GA  ++ +++++    Q AIA TD   ++  ++F +
Sbjct: 1    MSEPTANTRPFAHLHIHTEYSLLDGACRIDQLMERVKECGQTAIACTDHGVMYGCVQFYK 60

Query: 61   KACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMY 120
             A  AGI+PIIGC++ +  +      N+          ++LL     GY+ LI++VS  +
Sbjct: 61   AAKKAGIKPIIGCEVYVATRTRFDKVNK----IDGNNHLILLCKNETGYKNLIKMVSAGF 116

Query: 121  LLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG- 179
             ++      R+    L++   EGLI L+   +G I +A      + A+   L ++ LFG 
Sbjct: 117  -VEGFYSKPRVDKQLLEQYH-EGLICLSACLAGEIPQAILAGDYERAKATALWYRDLFGA 174

Query: 180  DRLYVNLQRHRG-YDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHST 238
            +  Y+ LQ H    D     Q+++L+    +P+ ATN++ +L +ED +   +L+ +    
Sbjct: 175  ENYYIELQDHGLKEDTTVLPQLIKLSRETGIPMAATNDAHYLRKEDAKMQSILLCIQTGK 234

Query: 239  VVSQKDRP-RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIE 297
             +   DR    T + Y+K   EM  +FS +PEA  NT +IA +C+F  +     +P +  
Sbjct: 235  TIQDADRMEFQTDEFYVKTTDEMYELFSMVPEACANTAKIAEQCNFDFEFGHTKIPYYKA 294

Query: 298  KECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYF 357
             +  D Q             GLE R            Q    RL +E+ V+  M ++ Y+
Sbjct: 295  PDGMDNQ----AYFEKLCWDGLERRYGPDV------PQANIDRLKYEIGVVKTMGYTNYY 344

Query: 358  LIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPD 417
            LIV D+I +AK   IPVGPGRGSGAGS+ AY + ITDIDP+R++L+FERFLNP+R+SMPD
Sbjct: 345  LIVWDYINFAKSQGIPVGPGRGSGAGSIAAYCVGITDIDPIRYNLIFERFLNPERVSMPD 404

Query: 418  FDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCK 477
            FD+DFC +RR EVI YV  KYG + VAQI+TFG++ A+ A+RDVGR + +PY QVD + K
Sbjct: 405  FDVDFCYERRQEVIDYVNRKYGADHVAQIVTFGTMAARNAIRDVGRVMGIPYQQVDVVAK 464

Query: 478  LIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDR 537
            L+P +    +  +A+   S  ++    DP V  L++ + K+EG+ RHASTHAAG+VI   
Sbjct: 465  LVPMELKMTLK-RALEVSSELKKLYDTDPQVTELIDTALKVEGMPRHASTHAAGVVITPE 523

Query: 538  PLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVD 597
            P    +P+       LPVTQFNM  IE+ GL+K DFLGL+TLT+++ +   + ++  +  
Sbjct: 524  PTDYYLPL--ATNDGLPVTQFNMTEIEELGLLKMDFLGLRTLTVIRDAETAVQKQHPEFS 581

Query: 598  LSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDN 657
            +  + +DD +TY +L    T G+FQLESSGM+Q L G+QP  +ED+IAL+SLYRPGP+D+
Sbjct: 582  IRKLDYDDPDTYKMLGQGDTEGVFQLESSGMKQVLVGLQPQNLEDVIALISLYRPGPMDS 641

Query: 658  IVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAM 717
            I  Y   ++  +KI    P +  +L  T G I+YQEQVMQI + L+G+S  +AD +RRAM
Sbjct: 642  IPTYLRNRHEPDKISYKTPQLAHILDVTNGCIVYQEQVMQIFRELAGFSFGQADNVRRAM 701

Query: 718  GKKIKEEMDKQKERFISGASKNGI----------SKTIAVNIFELLAKFADYGFNKSHAA 767
             KK    M+ ++E F+ G ++ G            + +A  I++ ++ FA Y FNKSHAA
Sbjct: 702  SKKKHAVMEAEREHFVHGCTEPGHECPGCVANGIPEQVANQIYDEMSSFASYAFNKSHAA 761

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
             YA +++QTA++K HYP +F+AA +T  +DN +K+ ++  +  +  I+++PP VN     
Sbjct: 762  CYAYVAFQTAYLKCHYPSQFMAALLTSVLDNTDKVIEYSGECARLGIKVLPPDVNISNGG 821

Query: 828  FKVGDN-RIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLV 886
            F   DN +I + L A+K VG     + +    +KP+ SL DFC R+   +LNRR +ESL+
Sbjct: 822  FTADDNGQIRFGLNAVKNVGRNLIENAVTERKEKPYTSLYDFCKRMHGSELNRRAVESLI 881

Query: 887  FAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKI-----TLE 941
             AGA DCFG +R  ++++++ I K  +   +       ++F+   G            + 
Sbjct: 882  KAGAFDCFGSNRHSMVEAVEGILKSIETDSRRNLEGQLDLFSVMSGEVQQSPQEDVYEIR 941

Query: 942  KFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEES----VATIRGNNIRL 997
              +    +   + E+ V G Y SGHPLD Y+    ++G    ++          G  +R+
Sbjct: 942  PLAEYTPAELLQQEKEVSGLYLSGHPLDAYREKSARIGSHTIKDLTGEDAHVQDGEKVRI 1001

Query: 998  AAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
               VV  +   T+  S + + +  +     E   FP
Sbjct: 1002 VCAVVKNRMMTTKSNSMMAFTSVEDLTGTMEVIVFP 1037


>gi|255657970|ref|ZP_05403379.1| DNA polymerase III, alpha subunit [Mitsuokella multacida DSM 20544]
 gi|260850171|gb|EEX70178.1| DNA polymerase III, alpha subunit [Mitsuokella multacida DSM 20544]
          Length = 1128

 Score =  828 bits (2139), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/1030 (36%), Positives = 600/1030 (58%), Gaps = 26/1030 (2%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL VH+ +SLL+GA  +  +++   A    +IAITD   ++  ++F ++A   G++PI
Sbjct: 3    FTHLHVHTEFSLLDGASRIKELIETTKALGMDSIAITDHGAMYGVIDFYKEAKKQGVKPI 62

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +      +              ++LL     GY+ L++LVS    ++      R
Sbjct: 63   IGCEVYVAPGARQEHREVNGVR---YYHLILLAENQTGYRNLVKLVSLAN-VEGMYYKPR 118

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +    L++   EG+I L+   +G I RA   ++ + A+  +  + ++FG +  ++ +Q H
Sbjct: 119  VDKDLLRQYH-EGIICLSACIAGEIPRAILQDNMERADALVREYLEIFGRENFFLEIQNH 177

Query: 190  RGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               +  +  + +V+LA  +++ LVATN+  ++  ED E HD+L+ +  +      DR R 
Sbjct: 178  GLPEERKANAGLVELAKKYDVGLVATNDLHYVHREDSEFHDILLCIQMNKTFDDPDRMRF 237

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             + D+YLK+  EM ++F DLPEA+ NT +IA RC    +     LP +          ++
Sbjct: 238  ASDDYYLKSPEEMAALFPDLPEAIANTEKIAARCKVDFEFGHLQLPYYPIPAPY---ADD 294

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            E  LR+                     +  R+RL++EL +I RM +  YFLIV DFI ++
Sbjct: 295  EAYLRHLCEE-------NLPRRYATVTEKIRERLEYELGIIHRMGYDSYFLIVWDFINYS 347

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            +++ I VGPGRGS AGS+ AY L IT++DPL++ LLFERFLNP+R++MPD D+DF   +R
Sbjct: 348  REHGIGVGPGRGSAAGSIVAYLLGITNLDPLKYDLLFERFLNPERVTMPDIDVDFDYIQR 407

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             +VI YV+ +YG++ VAQI+TFG++ AK A+RDVGR L +PY++V  + KL+PN+    +
Sbjct: 408  GKVIDYVKERYGYDHVAQIVTFGTMAAKGAIRDVGRVLNLPYAEVAEIAKLVPNELKITL 467

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                + + + FR+A  +   V RL+++++K+EGL RH+STHAAG+VI   PL+  VP+  
Sbjct: 468  DKA-MQESADFRKAYESSEDVHRLIDLARKIEGLPRHSSTHAAGVVIARHPLTDYVPV-- 524

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
             +     VT+++   +E+ GL+K DFLGL+TLT++  ++  + + R  KVD+  IP  D 
Sbjct: 525  SISEGTLVTEYDKDHVEELGLLKMDFLGLRTLTVISDTIANIEKSRHEKVDIDKIPLTDG 584

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNNR 664
             T  +L    T  +FQ+ES+GM Q +  + P+   D+I LV+LYRPGP+ + +   +   
Sbjct: 585  LTSKMLCEGKTGAVFQMESAGMTQLVRDLAPENFADLIPLVALYRPGPLGSGMVEDFIKG 644

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            ++G++++  +HPL++P+LKET GV++YQEQVMQI Q+L+G++L +AD+LRRAMGKK  E 
Sbjct: 645  RHGEKEVTYMHPLLEPILKETFGVVLYQEQVMQIVQVLAGFTLGQADLLRRAMGKKKHEI 704

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            +  QKE F+ G  KN I   +A  IF+LL  FADYGFNKSH+AAYA++++QTA++K HYP
Sbjct: 705  LMAQKENFLDGCEKNHIDAGLANTIFDLLTHFADYGFNKSHSAAYALVAWQTAYLKAHYP 764

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKG 844
             EF+AA +T  MD   K+  + +  R+  I+I+PP +N     F V  + I + LAA++ 
Sbjct: 765  AEFMAAMLTSIMD-TPKVSTYIELCRRMGIKILPPDINASSAYFSVDGDAIRFGLAAVRN 823

Query: 845  VGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
            VG T   ++        PF SL DFC RVD + +NRRV+ESL+  GA D FG  R QLL 
Sbjct: 824  VGETAIENVARIRETGGPFSSLSDFCRRVDMRVVNRRVIESLIKCGAFDSFGAKRSQLLA 883

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
             L      A   +K+  +    +F+ E    +  + L        + R   E+   GFY 
Sbjct: 884  VLPQTVMEAAQQQKDAVSGQMGLFSDETIEETGMLQLPDIDEVPKAERLRWEKEATGFYI 943

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEP 1023
            +GHPLD Y   L  +   G  +         +R+  M+   ++  T+KG  + + T  + 
Sbjct: 944  TGHPLDQYAAKLENLPRIGSLQPDTVRDKQVVRIGGMLTEAKRITTKKGDTMCFATVEDF 1003

Query: 1024 AKEYEANFFP 1033
                E   FP
Sbjct: 1004 TDSIEVTVFP 1013


>gi|197119463|ref|YP_002139890.1| DNA polymerase III subunit alpha [Geobacter bemidjiensis Bem]
 gi|197088823|gb|ACH40094.1| DNA polymerase III, alpha subunit [Geobacter bemidjiensis Bem]
          Length = 1156

 Score =  828 bits (2139), Expect = 0.0,   Method: Composition-based stats.
 Identities = 402/1037 (38%), Positives = 617/1037 (59%), Gaps = 13/1037 (1%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            ++ + +FVHL +HS YSLL+GA+ + ++L K+     PA+A+TD  N+F  LEF  K   
Sbjct: 1    MDST-NFVHLHLHSQYSLLDGAIRIGDLLKKVKECHMPAVAMTDHGNMFGTLEFYLKCKD 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             G++PI+G ++ I  QD             +   ++LL     G++ L  LVS  Y  + 
Sbjct: 60   KGVKPILGSEVYIAPQDRFLKQAPSSPGQASSYHLILLCENMTGFKNLSYLVSAGY-KEG 118

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
              +  RI    L +   EGLI+L+    G +      N    A      + + F    Y+
Sbjct: 119  FYRRPRIDKELLLK-HKEGLIVLSACLQGEVAYLAGRNKMDEARAAASWYAENFPGSYYI 177

Query: 185  NLQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             LQ ++  ++     +++++A   +LPLVATN+  +L+ ED  AH++L+ +     +S  
Sbjct: 178  ELQENKLPEQDIANRRLMEIAREMDLPLVATNDCHYLNREDARAHEILLCIQTGKTMSDP 237

Query: 244  DRPRVT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
                 +  + Y+K   EM   F   PEA+ENTV+IA RC+          P +   E + 
Sbjct: 238  THMAFSVDEFYVKTPQEMAQAFHYAPEAIENTVKIAERCNLEFDFKTYYFPAYEAPEGET 297

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
            + ++ E E     V  L+    +  +      Q Y  RL  EL+ I +M F GYFLIVAD
Sbjct: 298  LDQQLEREATVGLVERLKKIRIKYNL-TEEQEQAYHARLRIELDCIKQMGFPGYFLIVAD 356

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI WAK + IPVGPGRGS AGS+ A+ + ITDIDP+ ++LLFERFLNP+R+SMPD D+DF
Sbjct: 357  FINWAKDHGIPVGPGRGSAAGSLVAFCIRITDIDPMPYNLLFERFLNPERISMPDIDVDF 416

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVI+Y+  KYG E+V QIITFG++ A+  +RDVGRAL + + +VDR+ KL+P  
Sbjct: 417  CQDRREEVIQYMVEKYGREKVCQIITFGTMAARGVIRDVGRALDLTFGEVDRIAKLVPEV 476

Query: 483  PAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQL 542
                +    +  + + +E   ADP V  ++ ++ +LEGL RHASTHAAG+V+  R + + 
Sbjct: 477  LGITLDKA-LEQEPKLKELMAADPKVKEVMTVALRLEGLARHASTHAAGLVVAPRQMEEF 535

Query: 543  VPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLI 601
             P+Y+D ++    TQ++MK++EK GL+KFDFLGLK LT++  +   +   +    D++L+
Sbjct: 536  CPVYKDQKTGSLTTQYSMKYVEKIGLVKFDFLGLKNLTVIDNACKHIRNGKDPNFDITLL 595

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV-- 659
              DD E+Y LL    T G+FQLESSGM++ L  ++P C EDIIA+ +LYRPGP+ + +  
Sbjct: 596  RDDDEESYKLLQAGNTTGVFQLESSGMKELLVKLKPSCFEDIIAVCALYRPGPLGSGMVD 655

Query: 660  VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGK 719
             +  RK+G+++ V   P ++P+LK+T GVI+YQEQVMQI++ L+GYSL  AD+LRRAMGK
Sbjct: 656  DFIERKHGRKQTVYDLPQLEPVLKDTYGVIVYQEQVMQISRSLAGYSLGGADLLRRAMGK 715

Query: 720  KIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWM 779
            K  E+M K++++F+ G+ K G+       IF+L+AKFA+YGFNKSH+AAYA+++YQTA++
Sbjct: 716  KDAEQMAKERDKFLEGSEKLGLDGKKCAAIFDLMAKFAEYGFNKSHSAAYALVAYQTAFL 775

Query: 780  KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSL 839
            K HYPVEF+AA +T +M N +K+ K   D R+  I+++PP +N     F+V D  + + L
Sbjct: 776  KAHYPVEFMAALLTEDMGNTDKVIKSIGDCREMGIEVLPPDINESDRSFRVLDKAMRFGL 835

Query: 840  AAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRM 899
             A+K VG      I+EA  D+PF  L DFC RVD +++N+RV+E+L+  GA DC G  R 
Sbjct: 836  GAVKNVGEGAIEAIIEARGDEPFKDLFDFCERVDLRRVNKRVIEALIKCGAFDCTGAKRS 895

Query: 900  QLLQSLDNIQKYAQWVEKNRTNKHENIFAHEK---GTFSDKITLEKFSVENSSVRFENEQ 956
            QL+  L++     Q V++ R +   ++F   +   G       L +    +   R   E+
Sbjct: 896  QLMAGLEDAASAGQRVQQERESAQASLFGAAEIVRGANGGGNRLPEIPEWDEKYRLGCEK 955

Query: 957  RVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIG 1016
              +GF+ +GHPLD Y   +R+         +     + +R+  +  S ++  T+KG R+ 
Sbjct: 956  EAIGFFITGHPLDRYVADMRRFSSVDCSTILDAKEKSEVRICGVPASVKELITKKGDRMA 1015

Query: 1017 WVTFSEPAKEYEANFFP 1033
            ++   +     E   FP
Sbjct: 1016 FLALEDLVGSVEVVVFP 1032


>gi|154499865|ref|ZP_02037903.1| hypothetical protein BACCAP_03522 [Bacteroides capillosus ATCC 29799]
 gi|150271463|gb|EDM98720.1| hypothetical protein BACCAP_03522 [Bacteroides capillosus ATCC 29799]
          Length = 1161

 Score =  827 bits (2135), Expect = 0.0,   Method: Composition-based stats.
 Identities = 365/1048 (34%), Positives = 583/1048 (55%), Gaps = 42/1048 (4%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL VH+ +SLL+GA  +  +  ++    Q A+AITD   ++ A++F +   A G++P
Sbjct: 2    SFVHLHVHTEFSLLDGACRIPALAARVRELGQSAVAITDHGVMYGAVDFYRACKAEGVKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +      ++          +VLL     GY+ L  LVSR +L D      
Sbjct: 62   IIGCEVYVAPRGMTDRVHE---LDAEARHLVLLCKNETGYRNLCYLVSRAFL-DGFYIKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            RI    L +  TEGLI ++   +G + R     + + A++  L  K+ FG+  Y+ +Q H
Sbjct: 118  RIDKELLWQ-HTEGLIAMSACLAGEVPRLILGGNYEGAKRAALEMKEHFGEDYYLEIQDH 176

Query: 190  -RGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
                D      ++++     +PLVATN++ +   ED    D LM +     V    R + 
Sbjct: 177  SLPEDAEVVRGIIRIHEETGIPLVATNDAHYTRREDAAMQDTLMCIQMGRTVDDPGRMKF 236

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + Y+K+  EM  +F D PEA+ENTV +A +C+   +     LP F   E      + 
Sbjct: 237  ETEEFYIKSEEEMAQLFPDWPEAIENTVRVAEKCNLEFEFGKYHLPEFKLPEGWT---DP 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            +    +    G   R  +G       +Q  +++L++E+ VI +M F  YFLIV+DFI +A
Sbjct: 294  DAYFEHLCWEGFARRYPEG-------SQKNKEQLEYEMGVIRQMGFVDYFLIVSDFIGYA 346

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K +NIPVGPGRGS AGS+ +Y + ITD+DP+++ L FERFLNP+R++MPD DIDFC  RR
Sbjct: 347  KSHNIPVGPGRGSAAGSMVSYCMNITDVDPVKYDLFFERFLNPERVTMPDIDIDFCIRRR 406

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA--H 485
             EVI YVQ KYG + VAQI+TFG++ A+ A+RDVGRAL +PY+ VD + K +P+ P   H
Sbjct: 407  QEVIEYVQQKYGEDHVAQIVTFGTMAARGAIRDVGRALNIPYADVDAVAKQVPSGPGALH 466

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
                +++    + R++   D  +  L++ ++ +EG+ RHASTHAAG+VI  RP+ + VP+
Sbjct: 467  ITLDESLKLSKQLRDSYEGDERIHNLIDTAKAIEGMPRHASTHAAGVVITKRPVYEYVPL 526

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDD 605
                  +  VTQ+ M  +E+ GL+K DFLGL+ LT+L  ++  + +R    D+  IP  D
Sbjct: 527  --AKNDESVVTQYVMTTLEELGLLKMDFLGLRNLTVLDDAVQLVRRRIPDFDIHSIPDHD 584

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
               + +L+   T G+FQ+ES+GM     G++P  IEDI A+++LYRPGP+++I  +   K
Sbjct: 585  PAVFKMLSDGKTSGVFQMESAGMTGVCVGLKPQNIEDITAIIALYRPGPMESIPRFIACK 644

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
               +K+   HP+++P+LK T G I+YQEQV++I Q L GYSL +AD++RRA+ KK K ++
Sbjct: 645  QNPDKVKYKHPMLEPILKVTYGCIVYQEQVIRIFQELGGYSLGQADMVRRAISKKKKAQI 704

Query: 726  DKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            +K+++ FI         G    G+ +    +I++ +  FA+Y FNK+HA +YA+++YQTA
Sbjct: 705  EKERQTFIYGDSERGIEGCIARGVPEQTGKDIYDEIYDFANYAFNKAHAVSYAIVAYQTA 764

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            + K HY  E++AA +T  +D+ EK+ ++  + ++  I ++PP +N     F V    I +
Sbjct: 765  YFKCHYTREYMAALLTSVLDSSEKVAEYIAECKECGISLLPPDINESGASFTVTGENIRF 824

Query: 838  SLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
             LAA+KGVG    + +++       F SL DFCSR+    LN+RVLE+L+  GA D  G 
Sbjct: 825  GLAAVKGVGWGFIQSVLDERERGGAFQSLSDFCSRMMDADLNKRVLENLIKCGAFDSTGA 884

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIF--AHEKGTFSDKITLEKFSVENSSVRFEN 954
             R QLL+    +        +       ++F    ++   + ++ L      +       
Sbjct: 885  RRSQLLKVFPQVVDSIAQTRRKNLEGQFDLFGGGGDQPQAAPEMELPDIPEFSRRELMTM 944

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVAT----------IRGNNIRLAAMVVSK 1004
            E+   G Y +GHP+D Y+   R+         ++             G  + +A ++ S 
Sbjct: 945  EKETTGLYLTGHPMDEYRETARRYHAAPIGAILSDFAKEEGNTDFQDGQKVNIAGVISSA 1004

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            + K TR  S + +VT  +     E   F
Sbjct: 1005 KTKTTRNNSLMAYVTLEDDTGSMELLVF 1032


>gi|323705009|ref|ZP_08116585.1| DNA polymerase III, alpha subunit [Thermoanaerobacterium
            xylanolyticum LX-11]
 gi|323535435|gb|EGB25210.1| DNA polymerase III, alpha subunit [Thermoanaerobacterium
            xylanolyticum LX-11]
          Length = 1144

 Score =  826 bits (2134), Expect = 0.0,   Method: Composition-based stats.
 Identities = 394/1049 (37%), Positives = 601/1049 (57%), Gaps = 45/1049 (4%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VHS YSLL+G+  +  ++ +       +IAITD   ++ A++F ++A + G++PI
Sbjct: 2    FVHLHVHSEYSLLDGSCRIKELIKRTKELGMNSIAITDHGVMYGAIDFYKEAVSYGVKPI 61

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +  +                  ++LL     GY+ L+++VS+  + D      R
Sbjct: 62   IGCEIYVSPRSLYDKEYGIDNL---NYHLILLCKNMTGYENLMKIVSKASI-DGFYYKPR 117

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            I   +L+E  +EGLI L+    G I      +  + A++  + +  +FG    Y+ LQ H
Sbjct: 118  IDHQYLKE-HSEGLIALSSCLGGEIPSYLISDDYEKAKETAIFYNSIFGTGNFYLELQYH 176

Query: 190  R-GYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP-R 247
                     S++++L+    +PLVATN+  +L +ED+ AH+VL+ +     +   DR   
Sbjct: 177  GLSQQEKVNSELIKLSQELNIPLVATNDVHYLKKEDHLAHEVLLCIQTGKNMDDSDRMSF 236

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T   YLK+  EM  +FS   EALENTV+IA  C+   + +   LP+F   +        
Sbjct: 237  PTDQFYLKSPDEMYEMFSYCKEALENTVKIADMCNLEFEFNKTKLPKFEVPDGMK----S 292

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            +  LR   + GL  R             +  +RL++EL+VI +M +  YFLIV DFI++A
Sbjct: 293  DEYLRKLCIDGLYKRYPN-------PTDEVMERLNYELSVIEKMGYVDYFLIVWDFIKFA 345

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            + N I  GPGRGS AGS+ AY L IT IDP++++LLFERFLNP+R+SMPD D DFC +RR
Sbjct: 346  RDNGIMTGPGRGSAAGSLVAYCLGITKIDPIKYNLLFERFLNPERVSMPDIDSDFCYERR 405

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RVAQIITFG++ A+AA+RDVGRAL  PY++VD + K+IP +    +
Sbjct: 406  QEVIDYVVKKYGEDRVAQIITFGTMAARAAIRDVGRALNFPYAEVDVIAKMIPFELGMTI 465

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                I  +   ++    D  + RL++IS+ LEGL RHASTHAAG+VI   PL + VP+ +
Sbjct: 466  DKA-IELNPELKDKYEKDEKIRRLIDISRSLEGLPRHASTHAAGVVISSEPLVKYVPLQK 524

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
            +      VTQF M  +E+ GL+K DFLGL+TLT+++ +LD + + RG+ VD+  I F+D 
Sbjct: 525  N--EGSIVTQFTMTTLEELGLLKMDFLGLRTLTVIRDTLDIVKETRGIDVDIDSIDFEDK 582

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            E Y L++   T G+FQLESSGM+Q +  ++P+ +ED+IA +SLYRPGP+D I  Y   KN
Sbjct: 583  EVYALISRGDTEGVFQLESSGMKQFMTELRPEKLEDVIAGISLYRPGPMDQIPRYIENKN 642

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E I   HPL+ P+L  T G ++YQEQVMQI + L+GYSL  +D++RRAM KK  + M+
Sbjct: 643  NPENIKYEHPLLKPILDVTYGCMVYQEQVMQIVRDLAGYSLGRSDLVRRAMAKKKMKVME 702

Query: 727  KQKERFISG------------ASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI G            A   G+ +  A  +F+ +  FA+Y FNKSHAAAYAV+++
Sbjct: 703  EERKNFIYGIKDENGNYVVPGAVNRGVDEATANRLFDEMIDFANYAFNKSHAAAYAVVAF 762

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTA++K +YPVEF+AA +   +DN +K+  + Q  ++  IQI+PP +N     F V + +
Sbjct: 763  QTAYLKRYYPVEFMAALLNSFVDNTDKVAFYVQVLKKIGIQILPPDINESYSYFTVVNGK 822

Query: 835  IYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + LAA+K VG      I+E    +  + S+ DF  R+D  +LN++ +ESL+ AGA D 
Sbjct: 823  IRFGLAAVKNVGLNATLEIVEDRKKNGRYTSIIDFFERIDEMQLNKKAVESLIKAGAFDS 882

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFE 953
            FG  R QLL   + I +      +       ++F  +  +     +L      +  V   
Sbjct: 883  FGVYRSQLLAVYEGIMESIHRSREKNIKGQMSLFESDSESHKIDYSLPDIKEFSKGVILS 942

Query: 954  NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVA---------TIRGNNIRLAAMVVSK 1004
             E+  +G Y SGHPLD Y+  +R++      +                 ++ L  +V SK
Sbjct: 943  MEKETMGLYISGHPLDEYQDDIRRIANCTTRDLKNSDDSFVKKSAFDDQDVVLVGIVESK 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + K T+  + + +V  ++     E   FP
Sbjct: 1003 KIKFTKNNNMMAFVNLADLYGTIEVIVFP 1031


>gi|253699799|ref|YP_003020988.1| DNA polymerase III subunit alpha [Geobacter sp. M21]
 gi|251774649|gb|ACT17230.1| DNA polymerase III, alpha subunit [Geobacter sp. M21]
          Length = 1155

 Score =  825 bits (2132), Expect = 0.0,   Method: Composition-based stats.
 Identities = 404/1035 (39%), Positives = 615/1035 (59%), Gaps = 13/1035 (1%)

Query: 7    KSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAG 66
             S +FVHL +HS YSLL+GA+ + ++L K+     PA+A+TD  N+F  LEF  K    G
Sbjct: 2    DSANFVHLHLHSQYSLLDGAIRIGDLLKKVKECHMPAVAMTDHGNMFGTLEFYLKCKDKG 61

Query: 67   IQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            I+PIIG ++ I  Q  L               ++LL     G++ L  LVS  Y  +   
Sbjct: 62   IKPIIGSEVYIAPQSRLLKQAPA-AGEANSYHLILLCENMTGFKNLSYLVSAGY-KEGFY 119

Query: 127  QSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNL 186
            +  RI    L +   EGLI+L+    G +      N    A      + + F    Y+ L
Sbjct: 120  RRPRIDKELLLK-HKEGLIVLSACLQGEVAYLAGRNKMDEARAAASWYAENFPGSYYIEL 178

Query: 187  QRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDR 245
            Q ++  ++     +++++A   +LPLVATN+  +L+ ED  AH++L+ +     +S  +R
Sbjct: 179  QENKLPEQDVANRRLMEIAREMDLPLVATNDCHYLNREDARAHEILLCIQTGKTMSDPNR 238

Query: 246  PRVT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQ 304
               +  + Y+K   EM + F   PEAL NTV+IA RC      +    P +   E + + 
Sbjct: 239  MAFSVDEFYVKTPEEMAAAFHYAPEALSNTVKIAERCHLEFDFNTYYFPAYEAPEGETLD 298

Query: 305  KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
            ++ E E +   +  L+    +  +      Q Y  RL  EL+ I +M F GYFLIVADFI
Sbjct: 299  QQLERESKAGLIERLKKIRIKYNL-TEEQEQGYHARLRIELDCIKQMGFPGYFLIVADFI 357

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
             WAK + IPVGPGRGS AGS+ A+ + ITDIDP+ ++LLFERFLNP+R+SMPD D+DFCQ
Sbjct: 358  NWAKDHGIPVGPGRGSAAGSLVAFCIRITDIDPMPYNLLFERFLNPERISMPDIDVDFCQ 417

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            DRR+EVI+Y+  KYG E+V QIITFG++ A+  +RDVGRAL + + +VDR+ KL+P    
Sbjct: 418  DRREEVIQYMVEKYGREKVCQIITFGTMAARGVIRDVGRALDLTFGEVDRIAKLVPEVLG 477

Query: 485  HPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
              +    +  + + +E   ADP V  ++ ++ +LEGL RHASTHAAG+V+  R + +  P
Sbjct: 478  ITLEKA-LEQEPKLKELMAADPKVKEVMTVALRLEGLARHASTHAAGLVVAPRQMEEFCP 536

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPF 603
            +Y+D ++    TQ++MK++EK GL+KFDFLGLK LT++  +   +   +    D++L+  
Sbjct: 537  VYKDQKTGSLTTQYSMKYVEKIGLVKFDFLGLKNLTVIDNACKHIRNGKDPNFDITLLRD 596

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VY 661
            DD E+Y LL    T G+FQLESSGM++ L  ++P C EDIIA+ +LYRPGP+ + +   +
Sbjct: 597  DDAESYKLLQAGNTTGVFQLESSGMKELLVKLKPSCFEDIIAVCALYRPGPLGSGMVDDF 656

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
              RK+G+++ V   P ++P+LK+T GVI+YQEQVMQI++ L+GYSL  AD+LRRAMGKK 
Sbjct: 657  IERKHGRKQTVYDLPQLEPVLKDTYGVIVYQEQVMQISRSLAGYSLGGADLLRRAMGKKD 716

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
             E+M K++++F+ G+ K G+       IF+L+AKFA+YGFNKSH+AAYA+++YQTA++K 
Sbjct: 717  AEQMAKERDKFLEGSEKLGLDGKKCAAIFDLMAKFAEYGFNKSHSAAYALVAYQTAFLKA 776

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEF+AA +T +M N +K+ K   D R+  I+++PP +N     F+V D  + + L A
Sbjct: 777  HYPVEFMAALLTEDMGNTDKVIKSIGDCREMGIEVLPPDINESDRSFRVLDKAMRFGLGA 836

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            +K VG      I+EA  D+PF  L DFC RVD +++N+RV+E+L+  GA DC G  R QL
Sbjct: 837  VKNVGEGAIEAIIEARGDEPFKDLFDFCERVDLRRVNKRVIEALIKCGAFDCTGAKRSQL 896

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEK---GTFSDKITLEKFSVENSSVRFENEQRV 958
            +  L++     Q V++ R +   ++F   +   G       L      +   R   E+  
Sbjct: 897  MAGLEDAAATGQRVQQERESAQASLFGAAEIVRGGNGGGNRLPDIPEWDEKYRLGCEKEA 956

Query: 959  LGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWV 1018
            +GF+ +GHPLD Y   +R+         +       +R+  +  + ++  T+KG R+ ++
Sbjct: 957  IGFFITGHPLDRYVADMRRFSTVDCSTILDAKEKGEVRICGVPSTVKELITKKGDRMAFL 1016

Query: 1019 TFSEPAKEYEANFFP 1033
               +     E   FP
Sbjct: 1017 ALEDLVGSVEVVVFP 1031


>gi|150396144|ref|YP_001326611.1| DNA polymerase III subunit alpha [Sinorhizobium medicae WSM419]
 gi|150027659|gb|ABR59776.1| DNA polymerase III, alpha subunit [Sinorhizobium medicae WSM419]
          Length = 1165

 Score =  825 bits (2130), Expect = 0.0,   Method: Composition-based stats.
 Identities = 642/1030 (62%), Positives = 794/1030 (77%), Gaps = 6/1030 (0%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
            P FVHL+VHS+YSLLEGAL L  I+ K  AD QPAI I DTNNLF+ALEFSQKA   G+Q
Sbjct: 17   PQFVHLRVHSAYSLLEGALPLKKIIGKAIADDQPAIGIADTNNLFAALEFSQKAAGDGLQ 76

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTP-FPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQ 127
            PIIGCQL IDM+D  +   +G    F  +PS+VL+ +T +GY RL+ELVSR YL  +G  
Sbjct: 77   PIIGCQLSIDMEDEAEGERRGHAHQFVKLPSLVLIAATDDGYARLVELVSRAYLEGEGHH 136

Query: 128  SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQ 187
             VRI  SWL   GT GLI LTG  +GPID A    S  +AE RL T  +LFGDRLYV LQ
Sbjct: 137  QVRISRSWLSAGGTSGLIALTGAGTGPIDMAVKAGSPALAEARLKTLIELFGDRLYVELQ 196

Query: 188  RHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            RH  YDR  E++++ LAY  ++PLVATN + F S  DY+AHD L+AVAH+ +VS   R R
Sbjct: 197  RHGNYDRSHENRMIDLAYRLDVPLVATNEAFFPSPADYDAHDALIAVAHNAMVSDDSRFR 256

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE- 306
            +TPDHYLK+R EM ++F+DLPEALENT+EIARRCSF+L+  +PILPRF     D  Q E 
Sbjct: 257  LTPDHYLKSRKEMAALFADLPEALENTIEIARRCSFMLKTRSPILPRFTGASGDPEQAER 316

Query: 307  -EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
             E  ELR +A  GLE RLA+  +A GY  +DYR+RL FEL VI RMKF GYFLIVADFI+
Sbjct: 317  AEVAELRRQAEEGLEGRLAKLGMAPGYKEEDYRERLAFELGVIERMKFPGYFLIVADFIK 376

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            WAK+++IPVGPGRGSGAGS+ AYALTITD+DP+RFSLLFERFLNP+R+SMPDFDIDFCQD
Sbjct: 377  WAKQHDIPVGPGRGSGAGSLVAYALTITDVDPMRFSLLFERFLNPERVSMPDFDIDFCQD 436

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL+PN+PA+
Sbjct: 437  RREEVIRYVQQKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKLVPNNPAN 496

Query: 486  PVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
            P    +AI ++ R +E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLSQLVP
Sbjct: 497  PTPLSKAIEEEPRLQEEAEKEPVVGRLLDIAQKIEGLYRHASTHAAGIVIGDRPLSQLVP 556

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFD 604
            MYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++DF+A+RG+ +DL+ IP D
Sbjct: 557  MYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKTAVDFVAKRGIHIDLASIPLD 616

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNR 664
            D +TY  L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI +YN R
Sbjct: 617  DPKTYETLSRGETVGVFQVESAGMRKALIGMRPDCIEDIIALVALYRPGPMENIPIYNAR 676

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G+E+I SIHP ID +LKETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKIKEE
Sbjct: 677  KHGEEEIESIHPKIDYLLKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIKEE 736

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            MDKQ+ RF+ GA +NG+SK  A  IF+LLAKFA+YGFNKSHAAAYA++SYQTA+MK HYP
Sbjct: 737  MDKQRARFVDGAVRNGVSKPQADLIFDLLAKFANYGFNKSHAAAYAIVSYQTAYMKAHYP 796

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKG 844
            VEFLAASMTL+M N EKI  F QDA +  IQ++ PSV T    F+ G+ RIYYSLAA+KG
Sbjct: 797  VEFLAASMTLDMSNTEKINDFRQDAMRLGIQVIAPSVQTSHRHFETGEKRIYYSLAALKG 856

Query: 845  VGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQS 904
            VG +   HI+    D+PF SLEDFC R+D K LNRRV ESL+ AGA DCFGY R +L+  
Sbjct: 857  VGESAVDHIVAVREDRPFASLEDFCLRIDPKLLNRRVFESLIAAGAFDCFGYDRAELVGG 916

Query: 905  LDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFS 964
            LD I  +AQ  ++N+ +   ++F     T  +KI L  ++   +S +   E +VLGFY S
Sbjct: 917  LDRILGFAQRAQENKVSGQSDMFGAGAATGPEKIALPPYTPWLASEKLHREFQVLGFYLS 976

Query: 965  GHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVTFSE 1022
             HPLD Y  +L KM ++ + +   A  +G    RLA  V SKQ++KTR G+++G V FS+
Sbjct: 977  AHPLDTYNSLLAKMRVQTFADFSAAVKKGATAGRLAGTVTSKQERKTRTGNKMGIVAFSD 1036

Query: 1023 PAKEYEANFF 1032
             + ++EA  F
Sbjct: 1037 ASGQFEAVLF 1046


>gi|15965042|ref|NP_385395.1| DNA polymerase III subunit alpha [Sinorhizobium meliloti 1021]
 gi|307301114|ref|ZP_07580883.1| DNA polymerase III, alpha subunit [Sinorhizobium meliloti BL225C]
 gi|15074221|emb|CAC45868.1| Probable DNA polymerase III, alpha chain [Sinorhizobium meliloti
            1021]
 gi|306904069|gb|EFN34655.1| DNA polymerase III, alpha subunit [Sinorhizobium meliloti BL225C]
          Length = 1169

 Score =  824 bits (2128), Expect = 0.0,   Method: Composition-based stats.
 Identities = 637/1030 (61%), Positives = 786/1030 (76%), Gaps = 6/1030 (0%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
            P FVHL+VHS+YSLLEGAL L  I+ K  AD QPAI I DTNNLF+ALEFSQKA   G+Q
Sbjct: 21   PQFVHLRVHSAYSLLEGALPLKKIIGKAVADDQPAIGIADTNNLFAALEFSQKAADDGLQ 80

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTP-FPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQ 127
            PIIGCQL IDM+D  +   +G    F  +P+IVL+ +T +GY RL+ELVSR YL  +G Q
Sbjct: 81   PIIGCQLSIDMEDEAEGERRGHAHQFVKLPAIVLIAATEDGYARLVELVSRAYLEGEGHQ 140

Query: 128  SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQ 187
              RI  SWL   GT GLI LTG  +GP+D A    S  +AE RL    +LFGDRLYV LQ
Sbjct: 141  QTRISRSWLAAGGTTGLIALTGAGAGPVDMALKSGSPALAEARLKALIELFGDRLYVELQ 200

Query: 188  RHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            RH  YDR  E++++ LAY  ++PLVATN + F S  DY+AHD LMAVAH+ +VS   R R
Sbjct: 201  RHGNYDRRHENRMIDLAYRLDIPLVATNEAFFPSPSDYDAHDALMAVAHNAMVSDDSRFR 260

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
            +TPDHYLK+R EM ++F+DLPEALENT+E+ARRCSF+L+   PILPRF     D  + E 
Sbjct: 261  LTPDHYLKSRKEMAALFADLPEALENTIEVARRCSFMLKTRGPILPRFTGASDDPEEAER 320

Query: 308  ENE--LRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
                 LR +A  GLE RLA+  +A GY  +DYR+RL FEL VI RMKF GYFLIVADFI+
Sbjct: 321  AEVAELRRQAEEGLEERLAKLGMAPGYKEEDYRERLAFELGVIQRMKFPGYFLIVADFIK 380

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            WAK+++IPVGPGRGSGAGS+ AYALTITD+DP+RFSLLFERFLNP+R+SMPDFDIDFCQD
Sbjct: 381  WAKQHDIPVGPGRGSGAGSLVAYALTITDVDPMRFSLLFERFLNPERVSMPDFDIDFCQD 440

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL+PN+PA+
Sbjct: 441  RREEVIRYVQQKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKLVPNNPAN 500

Query: 486  PVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
            P    +AI ++ R RE    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLSQLVP
Sbjct: 501  PTPLSKAIEEEPRLREEAEKEPVVARLLDIAQKIEGLYRHASTHAAGIVIGDRPLSQLVP 560

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFD 604
            MYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++DF+ +RG+ +DL+ IP D
Sbjct: 561  MYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKTAIDFVGKRGIHIDLASIPLD 620

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNR 664
            D +TY  L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI VYN R
Sbjct: 621  DPKTYETLSRGETVGVFQVESAGMRKALIGMRPDCIEDIIALVALYRPGPMENIPVYNAR 680

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G+E+I SIHP ID +LKETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKIK E
Sbjct: 681  KHGEEEIESIHPKIDYLLKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIKAE 740

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            MDKQ+ RF+ GA KNG+SK  A  IF+LLAKFA+YGFNKSHAAAYA++SYQTA+MK HYP
Sbjct: 741  MDKQRARFVDGAVKNGVSKPQADLIFDLLAKFANYGFNKSHAAAYAIVSYQTAYMKAHYP 800

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKG 844
            VEFLAASMTL+M N +KI  F QDA +  IQ++ PSV T    F+ GDNRIYYSLAA+KG
Sbjct: 801  VEFLAASMTLDMSNTDKINDFRQDAMRLGIQVVAPSVQTSHRHFETGDNRIYYSLAALKG 860

Query: 845  VGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQS 904
            VG +   HI+    D+PF SLEDFC R+D K LNRRV ESL+ AGA DCFGY R +L+  
Sbjct: 861  VGESAVDHIVAVRGDRPFASLEDFCLRIDPKLLNRRVFESLIAAGAFDCFGYDRAELIGG 920

Query: 905  LDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFS 964
            LD I  +AQ  ++N+ +   ++F     T  +KI L  ++   +S +   E +VLGFY S
Sbjct: 921  LDRILGFAQRAQENKVSGQSDMFGAGAATGPEKIALPPYTPWLASEKLHREFQVLGFYLS 980

Query: 965  GHPLDVYKPILRKMGIKGYEES--VATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSE 1022
             HPLD Y  +L KM ++ + +            RLA  V SKQ++KTR G+++G V FS+
Sbjct: 981  AHPLDTYNNLLAKMRVQTFADFSAAVKKGAAAGRLAGTVTSKQERKTRTGNKMGIVAFSD 1040

Query: 1023 PAKEYEANFF 1032
             + ++EA  F
Sbjct: 1041 ASGQFEAVLF 1050


>gi|312793441|ref|YP_004026364.1| DNA polymerase III subunit alpha [Caldicellulosiruptor kristjanssonii
            177R1B]
 gi|312180581|gb|ADQ40751.1| DNA polymerase III, alpha subunit [Caldicellulosiruptor
            kristjanssonii 177R1B]
          Length = 1140

 Score =  823 bits (2126), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/1033 (37%), Positives = 598/1033 (57%), Gaps = 30/1033 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL +H+ YSLL+GA  ++ + +++      A+AITD   ++  ++F + A   GI+P
Sbjct: 2    SFVHLHLHTEYSLLDGACRIDRLFERVKELNMNAVAITDHGVMYGVIDFYKAAKENGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +               +  +VLL    EGY+ L ++VS  + ++      
Sbjct: 62   IIGCEVYLAPRTRFDKEP---NIDNDIHHLVLLAMDNEGYKNLSKIVSIGF-VEGFYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            R+    L +  ++GL+ LT   +G I +       +     +  +K++FG+  Y  LQ H
Sbjct: 118  RVDREVLSKY-SKGLVALTSCLAGEIPKLILREQKEKLYDAISFYKEVFGENFYFELQYH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++    +++++L+  +++PLVATN+  +L  ED   HD+L+ +     +S  +R   
Sbjct: 177  YIDEQRFVNNELMRLSKKYQIPLVATNDVHYLRREDRNLHDILLCIQTGKTISDSNRMEF 236

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM  IF  +PEAL+NT+EIA +C+   +     LP+F   E    + + 
Sbjct: 237  PTDEFYLKSPEEMQQIFGYIPEALKNTLEIAEKCNVEFEFGKINLPKFQLPEG---KSDA 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L+  A+ G +              +    RL  EL VI  M F  YFLIV DFI +A
Sbjct: 294  FEYLKELALEGFKK-------RYSKDDKAAYDRLMMELQVIKDMGFVEYFLIVRDFINYA 346

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K+NNI VGPGRGS AGS+ AY L IT++DP+++ LLFERFLNP+R+SMPD DIDFC  RR
Sbjct: 347  KQNNIMVGPGRGSAAGSIVAYCLGITNVDPIKYDLLFERFLNPERVSMPDIDIDFCYQRR 406

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RV+QIITFG++ A+A++RDVGR L +PYSQVD + K+IP  P   +
Sbjct: 407  QEVIDYVTRKYGEDRVSQIITFGTMAARASIRDVGRVLGIPYSQVDEIAKMIPFSPGMTI 466

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                +  +   ++    + +V ++++ ++ LEG+ RHAS HAAG+VI   P++ LVP+  
Sbjct: 467  DKA-LEINHELKKIYEQNDTVRKIIDTARNLEGMPRHASVHAAGVVISSCPITDLVPL-- 523

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
                D  VTQF M  +E+ GL+K DFLGL+TLT++Q +L+ + + RG+++DL  I ++D 
Sbjct: 524  ARTDDAIVTQFPMTTLEELGLLKMDFLGLRTLTVIQNTLELVKKNRGIEIDLDRIDYNDK 583

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              Y  ++   T G+FQLESSGM+Q ++ ++P+ +EDIIA +SL+RPGP+D I VY   KN
Sbjct: 584  NVYEFISEGNTNGVFQLESSGMKQFMKELKPENLEDIIAGISLFRPGPMDQIPVYIQNKN 643

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
             +EKI  +HP ++P+L  T G I+YQEQVMQI + L+GYSL  AD++RRAM KK  + + 
Sbjct: 644  NREKIEYLHPSLEPILNVTYGCIVYQEQVMQIFRTLAGYSLGRADLVRRAMAKKKADILM 703

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
            ++K+RFI GA  NG+ K  A  IF ++  FA Y FNKSHAAAYA+++YQTA++K +Y +E
Sbjct: 704  EEKDRFIEGAMANGVEKETAEKIFAIIEDFASYAFNKSHAAAYAILAYQTAYLKKYYTIE 763

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            F+ + +T  M++ EK+  + ++ R+F I I+PP +N    DF +  N I + L AIK +G
Sbjct: 764  FMTSLITSVMNSNEKVGMYIEECRKFGISILPPDINKSSYDFTIEGNSIRFGLRAIKSLG 823

Query: 847  TTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSL 905
                 HI++       F  L DF  RVD+  +N+R++E+L+ +GA D  G +R  LL S+
Sbjct: 824  ENVIAHILKEREVKGEFKDLYDFIMRVDTNTVNKRIIENLIRSGAFDFTGINRNSLLASV 883

Query: 906  DNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSG 965
            ++I        K +     + F    G  ++    +      +    + E+  +G Y S 
Sbjct: 884  EDIL--VLKQAKKKNANQFSFF-EISGNENESFEYKNMPQPTAQELMKMEKDTIGIYISS 940

Query: 966  HPLDVYKPILRKMGIKGYEESVATIRGNN-----IRLAAMVVSKQQKKTRKGSRIGWVTF 1020
            HPL+ Y   + K  +    E       +      I +  ++   + K T+    + +   
Sbjct: 941  HPLERYTEEISKYNVTPLSEISTMSEEDEYKFEQILVCGILKEVKVKLTKNNQTMAFAKL 1000

Query: 1021 SEPAKEYEANFFP 1033
             +     E  FFP
Sbjct: 1001 EDLTDSVEVLFFP 1013


>gi|86357261|ref|YP_469153.1| DNA polymerase III subunit alpha [Rhizobium etli CFN 42]
 gi|86281363|gb|ABC90426.1| DNA polymerase III alpha subunit protein [Rhizobium etli CFN 42]
          Length = 1165

 Score =  823 bits (2126), Expect = 0.0,   Method: Composition-based stats.
 Identities = 642/1031 (62%), Positives = 811/1031 (78%), Gaps = 6/1031 (0%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            +P F+HL+VHS+YSLLEGAL L  IL K   D QPAIAITDTNNLF ALEFSQKA   G+
Sbjct: 16   TPGFIHLRVHSAYSLLEGALPLKKILYKATGDNQPAIAITDTNNLFVALEFSQKAMDEGL 75

Query: 68   QPIIGCQLDIDMQDNLKMTNQGKT-PFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            QPIIGCQ+ IDM+D L+   +G       +PSIVLL +T  GY+RL++LVSR YL     
Sbjct: 76   QPIIGCQVSIDMEDGLESEKRGGQQALIKLPSIVLLAATEAGYERLVDLVSRAYLGGDSN 135

Query: 127  QSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNL 186
            Q+V I  SWL+E GTEGLI LTG  +GP+D A        AE RLLT K+LFGDRLYV L
Sbjct: 136  QAVHIRASWLEEAGTEGLIALTGALTGPVDAAVREGHPAQAEARLLTLKRLFGDRLYVEL 195

Query: 187  QRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
            QRH  YD+  E ++V+LAYTH+LPLVATN + F + +DY+AHD LMAVAH+ +VS   R 
Sbjct: 196  QRHGTYDKRHEQKIVRLAYTHDLPLVATNEAFFPTRDDYDAHDALMAVAHNAIVSDDSRF 255

Query: 247  RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFI--EKECDDIQ 304
            R+TPDHYLK+R+EM  +F+DLPEALENT+EIA+RCSF+L+   PILPRF     + ++ +
Sbjct: 256  RLTPDHYLKSRAEMARLFADLPEALENTIEIAKRCSFVLKTRKPILPRFTGATDDAEEAE 315

Query: 305  KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
            + E  ELR +AV GL++RLA   ++ GY  +DYR+RL+FEL+VI RM+F GYFLIV+DFI
Sbjct: 316  RAEAGELRRQAVEGLDMRLATLGMSPGYEEKDYRERLEFELSVIERMRFPGYFLIVSDFI 375

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
            +WAK+++IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNP+R+SMPDFDIDFCQ
Sbjct: 376  KWAKQHDIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPERVSMPDFDIDFCQ 435

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            DRR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL+PN+PA
Sbjct: 436  DRREEVIRYVQAKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKLVPNNPA 495

Query: 485  HPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
            +P    +AI ++ + +E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLS+LV
Sbjct: 496  NPTPLSKAIEEEPKLQEEAAKEPVVARLLDIAQKIEGLYRHASTHAAGIVIGDRPLSKLV 555

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPF 603
            PMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++DF+A+RG+ VDL+ IP 
Sbjct: 556  PMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKVAVDFVAKRGINVDLAAIPL 615

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNN 663
            DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI VYN 
Sbjct: 616  DDKPTYEMLSRGETVGVFQVESAGMRKALIGMKPDCIEDIIALVALYRPGPMENIPVYNA 675

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G+E++ SIHP ID +LKETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKIK 
Sbjct: 676  RKHGEEEVESIHPTIDHLLKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIKA 735

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
            EMD+Q+ERF+ GA KNG+ K  A  IF+LLAKFA+YGFNKSHAAAYA++SYQTA+MK HY
Sbjct: 736  EMDQQRERFVEGAVKNGVKKPQADVIFDLLAKFANYGFNKSHAAAYAIVSYQTAYMKAHY 795

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEFLAASMTL+M N EK+  F QDA++  I+++ PSV T    F+ GDNRIYY+LAA+K
Sbjct: 796  PVEFLAASMTLDMSNTEKVNDFRQDAKRLGIEVIAPSVQTSFRHFETGDNRIYYALAALK 855

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
            GVG +   HI+E   DKPF S+EDFC R+D +++NRRVLESL++AGA DCFG  R QL  
Sbjct: 856  GVGESAVDHIVEVRGDKPFASIEDFCLRIDPRQVNRRVLESLIYAGAFDCFGTDRAQLAA 915

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
             LD I  YAQ  ++N+ +   +IF     +  +KI+L  +S   +S R   E +VLGFY 
Sbjct: 916  GLDRILGYAQRAQENKLSGQSDIFGSALNSGPEKISLPPYSPWLASERLLKEFQVLGFYL 975

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIRG--NNIRLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            + HPLD Y  IL+KM ++ + E  A I+    N RLA  V+SKQ++KTR G+++G + FS
Sbjct: 976  TAHPLDSYNNILQKMRVQTFAEFSAAIKQGAANARLAGTVISKQERKTRTGNKMGIIVFS 1035

Query: 1022 EPAKEYEANFF 1032
            + + ++EA  F
Sbjct: 1036 DSSGQFEAVLF 1046


>gi|312876042|ref|ZP_07736031.1| DNA polymerase III, alpha subunit [Caldicellulosiruptor lactoaceticus
            6A]
 gi|311797240|gb|EFR13580.1| DNA polymerase III, alpha subunit [Caldicellulosiruptor lactoaceticus
            6A]
          Length = 1140

 Score =  823 bits (2125), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/1033 (36%), Positives = 597/1033 (57%), Gaps = 30/1033 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL +H+ YSLL+GA  ++ + +++      A+AITD   ++  ++F + A   GI+P
Sbjct: 2    SFVHLHLHTEYSLLDGACRIDRLFERVKELNMNAVAITDHGVMYGVIDFYKAAKENGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +               +  ++LL    EGY+ L ++VS  + ++      
Sbjct: 62   IIGCEVYLAPRTRFDKEP---NIDNDIHHLILLAMDNEGYKNLSKIVSIGF-VEGFYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            R+    L +  ++GL+ LT   +G I +       +     +  +K++FG+  Y  LQ H
Sbjct: 118  RVDREVLSKY-SKGLVALTSCLAGEIPKLILREQKEKLYDAISFYKEVFGENFYFELQYH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++    +++++L+  +++P+VATN+  +L  ED   HD+L+ +     +S  +R   
Sbjct: 177  YIDEQRFVNNELMRLSKKYKIPIVATNDVHYLRREDRNLHDILLCIQTGKTISDSNRMEF 236

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM  IF  +PEAL+NT+EIA +C+   +     LP+F   E    + + 
Sbjct: 237  PTDEFYLKSPEEMQQIFGYIPEALKNTLEIAEKCNVEFEFGKINLPKFQLPEG---KSDA 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L+  A+ G +              +    RL  EL VI  M F  YFLIV DFI +A
Sbjct: 294  FEYLKELALEGFKK-------RYSKDDKAAYDRLMMELQVIKDMGFVEYFLIVQDFINYA 346

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K+NNI VGPGRGS AGS+ AY L IT++DP+++ LLFERFLNP+R+SMPD DIDFC  RR
Sbjct: 347  KQNNIMVGPGRGSAAGSIVAYCLGITNVDPIKYDLLFERFLNPERVSMPDIDIDFCYQRR 406

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RV+QIITFG++ A+A++RDVGR L +PYSQVD + K+IP  P   +
Sbjct: 407  QEVIDYVTRKYGEDRVSQIITFGTMAARASIRDVGRVLGIPYSQVDEIAKMIPFSPGMTI 466

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                +  +   ++    + +V ++++ ++ LEG+ RHAS HAAG+VI   P++ LVP+  
Sbjct: 467  DKA-LEINHELKKIYEQNDTVRKIIDTARNLEGMPRHASVHAAGVVISSCPITDLVPL-- 523

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
                D  VTQF M  +E+ GL+K DFLGL+TLT++Q +L+ + + RG+++DL  I ++D 
Sbjct: 524  ARTEDAIVTQFPMTTLEELGLLKMDFLGLRTLTVIQNTLELVKKNRGIEIDLDRIDYNDK 583

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              Y  ++   T G+FQLESSGM+Q ++ ++P+ +EDIIA +SL+RPGP+D I VY   KN
Sbjct: 584  NVYEFISEGNTNGVFQLESSGMKQFMKELKPENLEDIIAGISLFRPGPMDQIPVYIQNKN 643

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
             +EKI  +HP ++P+L  T G I+YQEQVMQI + L+GYSL  AD++RRAM KK  + + 
Sbjct: 644  NREKIEYLHPSLEPILNVTYGCIVYQEQVMQIFRTLAGYSLGRADLVRRAMAKKKADILM 703

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
            ++K+RFI GA  NG+ K  A  IF ++  FA Y FNKSHAAAYA+++YQTA++K +Y +E
Sbjct: 704  EEKDRFIEGAMANGVEKETAEKIFAIIEDFASYAFNKSHAAAYAILAYQTAYLKKYYTIE 763

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            F+ + +T  M++ EK+  + ++ R+F I I+PP +N    DF +  N I + L AIK +G
Sbjct: 764  FMTSLITSVMNSNEKVGMYIEECRKFGISILPPDINKSSYDFTIEGNSIRFGLRAIKSLG 823

Query: 847  TTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSL 905
                  I++       F  L DF  RVD+  +N+R++E+L+ +GA D  G +R  LL S+
Sbjct: 824  ENVIAQILKEREVKGEFKDLYDFIMRVDTNTVNKRIIENLIRSGAFDFTGINRNSLLASV 883

Query: 906  DNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSG 965
            ++I        K +     + F    G  ++    +      +    + E+  +G Y S 
Sbjct: 884  EDIL--VLKQAKKKNANQFSFF-EISGNENESFEYKNMPQPTAQELMKMEKDTIGIYISS 940

Query: 966  HPLDVYKPILRKMGIKGYEESVATIRGNN-----IRLAAMVVSKQQKKTRKGSRIGWVTF 1020
            HPL+ Y   + K  +    E       +      I +  ++   + K T+    + +   
Sbjct: 941  HPLERYTEEISKYNVTPLSEISTMSEEDEYKFEQILVCGILKEVKVKLTKNNQTMAFAKL 1000

Query: 1021 SEPAKEYEANFFP 1033
             +     E  FFP
Sbjct: 1001 EDLTDSVEVLFFP 1013


>gi|304438918|ref|ZP_07398841.1| DNA polymerase III alpha subunit [Peptoniphilus duerdenii ATCC
            BAA-1640]
 gi|304372584|gb|EFM26167.1| DNA polymerase III alpha subunit [Peptoniphilus duerdenii ATCC
            BAA-1640]
          Length = 1140

 Score =  822 bits (2123), Expect = 0.0,   Method: Composition-based stats.
 Identities = 373/1043 (35%), Positives = 587/1043 (56%), Gaps = 45/1043 (4%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL VH+ YSLL+G+  +  +  K+      +IAITD  N+F A++F +     G++PI
Sbjct: 2    FTHLHVHTEYSLLDGSTRIKELPKKVKELGMDSIAITDHGNMFGAIQFYKACKDEGVKPI 61

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +   +        K        ++LL    +GY+ L+++VS+ + +D      R
Sbjct: 62   MGCEVYVSSTNLNVKDRTSKR-----YHLILLAENNKGYENLMKIVSKGW-VDGFYYKPR 115

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +    L+E  +EG+I L+    G + R       + A K  L ++ +FG D  ++ +Q H
Sbjct: 116  VDKKVLREY-SEGIIALSACLQGEVQRKILDRDFEAARKAALEYQDIFGKDNFFLEVQNH 174

Query: 190  RGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++      +  L+    +PL ATN+  +L + D +AHDVL+ +   T++S   R + 
Sbjct: 175  GIREQLEANIHLRNLSGELGIPLAATNDVHYLEKSDAKAHDVLLCIQTGTILSDGKRMKF 234

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             + + YLK+  EM     D  +A+ENT EIA+RC+  ++ H   LP+F   +        
Sbjct: 235  PSDEFYLKSEDEMKEALPDFVDAIENTYEIAKRCNVTIEFHNYHLPKFDVPDG----YTN 290

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            +  L+  A+ GL  +            +   +R +FELN I  M ++ YFLIV DFI +A
Sbjct: 291  DEYLKELALKGLREKYEN-------LDEKIMERFNFELNTIISMGYTDYFLIVWDFINYA 343

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K+N I VGPGRGS AGS+ +Y L I D+DPLRF LLFERFLNP+R+SMPD DIDFC +RR
Sbjct: 344  KENGIMVGPGRGSAAGSIISYGLGIIDVDPLRFDLLFERFLNPERVSMPDIDIDFCYERR 403

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
            +EVI YV  KYG + VAQI TFG++ A+ A+RDVGR + + YS+VD++ K+IP +    +
Sbjct: 404  EEVIEYVNRKYGKDHVAQIATFGTMAARGAIRDVGRVMDISYSKVDQVAKMIPQELNITI 463

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +AI      R A   DP V  +++ + K+EGL RH STHAAG+VI +R ++  VP+  
Sbjct: 464  -NKAIEMSEDLRNAMRDDPQVKGIIDTALKVEGLPRHMSTHAAGVVISNRDVTDYVPL-- 520

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDDH 606
                +  +TQFNM  +E+ GL+K DFLGL+TLT+++ +++ + +   +++D     FDD 
Sbjct: 521  ARTDEQLLTQFNMTELEELGLLKMDFLGLRTLTVIRDAVNMVKENYGIEIDFKDQGFDDK 580

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            E   L     TLGIFQ ESSGMR  L+ ++ D  ED++A  +L+RPGP+  I  +   K+
Sbjct: 581  EVIDLFKHANTLGIFQFESSGMRAFLKELKADAFEDLVAANALFRPGPMSQIPRFIESKH 640

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
               KI  IHP ++P+L  T G I+YQEQVMQI Q + GYSL  AD++RRAM KK    M+
Sbjct: 641  DPSKISYIHPSLEPILNVTYGCIVYQEQVMQIVQQIGGYSLGRADLVRRAMSKKKMSVME 700

Query: 727  KQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            +++  FI             GA  NG+ +  A  I++L+  FA+Y FNKSH+ AY+V++Y
Sbjct: 701  EERNNFIYGLKDEEGNVLIKGALANGVDEKSANEIYDLMIDFANYAFNKSHSVAYSVVAY 760

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            +TA++K +YP EF+A+ ++  M + +++  + ++ ++ NI+++PPSVN     F V ++ 
Sbjct: 761  RTAFLKRYYPKEFMASQISSFMSSPKQVALYAEELKRLNIKLLPPSVNESRNKFTVEEDA 820

Query: 835  IYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSR---VDSKKLNRRVLESLVFAGAL 891
            + + L A+K VG      I+EA  +K F S+ DF  R   V+S  +N+R LESL+ AGA 
Sbjct: 821  VRFGLKAVKNVGDNFIDAIVEARKEKKFTSMTDFIRRVVEVNSSAINKRALESLIKAGAF 880

Query: 892  DCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVR 951
            D    +R + L   + I +  Q   KN      ++F       +D+  L      +   +
Sbjct: 881  DFLPGNRAKYLAVYERILESVQSGIKNNVKGQFSMFNE----KTDEDDLPNLKDFDEKTK 936

Query: 952  FENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATI-RGNNIRLAAMVVSKQQKKTR 1010
               E  +LG Y SGHPL+ Y+  +         +       G N++++ ++  K+   T+
Sbjct: 937  LNMEYEMLGIYASGHPLNPYRNAIENNSSTNTSKIFENPVNGQNVKISGIIKQKRNLITK 996

Query: 1011 KGSRIGWVTFSEPAKEYEANFFP 1033
                + + T  +     E   FP
Sbjct: 997  NNKMMCFATLEDFFGTIELIVFP 1019


>gi|154248204|ref|YP_001419162.1| DNA polymerase III subunit alpha [Xanthobacter autotrophicus Py2]
 gi|154162289|gb|ABS69505.1| DNA polymerase III, alpha subunit [Xanthobacter autotrophicus Py2]
          Length = 1150

 Score =  822 bits (2122), Expect = 0.0,   Method: Composition-based stats.
 Identities = 543/1033 (52%), Positives = 727/1033 (70%), Gaps = 12/1033 (1%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P F+HL VHSSYSLLEGALS+  + D + AD QPAIA+TDT NLF ALEFS+K   
Sbjct: 1    MPD-PGFIHLHVHSSYSLLEGALSIGKLADLVKADAQPAIALTDTGNLFGALEFSEKMSG 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            AGIQPI G  L +D+ +            P  P IVLL  +  G++ L+ LVSR +L   
Sbjct: 60   AGIQPIAGVSLALDLPE---PAGPRGAIRPKRPRIVLLAQSEPGWRNLMRLVSRSFLETA 116

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
             +   RI   WL +   +GLI LTGG +GPID+A      ++A +RL     LFGDRLYV
Sbjct: 117  SEDEPRILPDWLADAH-DGLIALTGGPAGPIDKALVSGHPELAAERLDLLASLFGDRLYV 175

Query: 185  NLQRHR-GYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             +QRH    +R  E+ +++LAY   LPLVA+N   F S+ DYEAHD L+ +A   ++S+ 
Sbjct: 176  EVQRHDTDAERLAEAGLLELAYAKGLPLVASNEPFFASKTDYEAHDGLLCIAEGRLLSEG 235

Query: 244  DRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD-D 302
            DR R+TP+H  K R+EM+++F+DLPEA  NTVEIARRC++ ++   PILPRF     D D
Sbjct: 236  DRRRLTPEHRFKTRAEMLALFADLPEATANTVEIARRCAYRVRTVKPILPRFTSGGGDGD 295

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
               EE  EL  +A  GL  RL +   A G     Y +RL +EL+VI +MKF GYFLIV+D
Sbjct: 296  PLAEEAAELERQAKEGLAQRLEKHGPAPGLDIATYEERLAYELSVITKMKFPGYFLIVSD 355

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK ++IPVGPGRGSGAGS+ AY+L ITD+DP+RF LLFERFLNPDR+SMPDFD+DF
Sbjct: 356  FIKWAKAHDIPVGPGRGSGAGSLVAYSLQITDLDPIRFGLLFERFLNPDRVSMPDFDVDF 415

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQ+RRDEVI YVQ +YG  +VAQIITFG+LQA+  LRDVGR L+MPY QVD+LCKL+P +
Sbjct: 416  CQERRDEVIHYVQERYGRAQVAQIITFGTLQARGVLRDVGRVLEMPYGQVDKLCKLVPQN 475

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PV+  QAI D+ R + +R  +  V R  +I+ +LEGL RHASTHAAGIVIGDR L +
Sbjct: 476  PANPVTLKQAIEDEPRLQASRDQEEVVKRAFDIAVRLEGLNRHASTHAAGIVIGDRKLHE 535

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVP+YRD +SD+PVTQ+NMKW+E+AGL+KFDFLGLKTLT + K++  + QRG+ +D+S I
Sbjct: 536  LVPLYRDPKSDMPVTQYNMKWVEQAGLVKFDFLGLKTLTTIDKAVKLIHQRGIDLDISKI 595

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD +TY +L    T+G+FQ+ES+GMR+AL  M+ D +ED+IALV+LYRPGP+ NI VY
Sbjct: 596  PLDDPKTYAMLGKGETVGVFQVESAGMRRALVDMKADRVEDLIALVALYRPGPMANIPVY 655

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
             + K+G+ K   +HP+++P LKET GVIIYQEQVMQIAQ ++GYSL EAD+LRRAMGKKI
Sbjct: 656  CDCKHGRAKPDYLHPMLEPYLKETFGVIIYQEQVMQIAQAMAGYSLGEADLLRRAMGKKI 715

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            + EM+KQ+ERF+SG++  GI K  A  IF+LLAKFADYGFNKSHAAAYA+++YQTAW+K 
Sbjct: 716  RAEMEKQRERFVSGSAGRGIEKAQADTIFDLLAKFADYGFNKSHAAAYAIVAYQTAWLKA 775

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            +YP EFLAASMTL+M N +K+ +F Q+A++  I+++PP++N    +F V D +I Y++ A
Sbjct: 776  NYPTEFLAASMTLDMGNTDKLAEFRQEAQRLGIEVVPPNINLSAREFAVKDGKIIYAMCA 835

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG      ++ A  D+PF S  DF SR+  K +N+R LESL+ AG  D    +R + 
Sbjct: 836  IKGVGGAAVDALVAARGDRPFRSFADFASRLPVKLVNKRTLESLMAAGCFDVLEKNRARA 895

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
              ++++I   AQ VE N  +   ++F    G  +  + + + +    S R + E   +GF
Sbjct: 896  FAAIESIVAEAQRVEANAQSGQNDMFG--SGPSAVSLPIPEVAPWLPSERLQKEYDAIGF 953

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            + +GHPLD Y   L+KM ++ + +   A   G    RLAA VVSKQ+++T+ G+R+G V 
Sbjct: 954  FLTGHPLDDYADALKKMRVQSFSDFSRAVRSGAAAGRLAATVVSKQERRTKSGTRMGIVG 1013

Query: 1020 FSEPAKEYEANFF 1032
             S+P+  YEA  F
Sbjct: 1014 LSDPSGHYEAVIF 1026


>gi|85859457|ref|YP_461659.1| DNA polymerase III subunit alpha [Syntrophus aciditrophicus SB]
 gi|85722548|gb|ABC77491.1| DNA polymerase III alpha subunit [Syntrophus aciditrophicus SB]
          Length = 1155

 Score =  822 bits (2122), Expect = 0.0,   Method: Composition-based stats.
 Identities = 411/1036 (39%), Positives = 620/1036 (59%), Gaps = 22/1036 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            +FVHL VH+ YSLL+G + + +++ K       A+A+TD  N+F  ++F Q AC  GI+P
Sbjct: 5    TFVHLHVHTQYSLLDGTIRIKDLISKAKEFGMQAVAMTDHGNMFGTIDFYQAACKEGIKP 64

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC+L +  +   + T  G +   T   +++L    +GYQ L++L S  YL D      
Sbjct: 65   IIGCELYVAPKTRFEKT--GGSIGDTARHLLVLAKDYQGYQNLMKLSSLGYL-DGFYYRP 121

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYVNLQR 188
            R+    L++   +GLI L+   +G I      +  + A      ++++FG+   Y+ +  
Sbjct: 122  RVDKELLKKYH-KGLIALSACLNGEIANYILKDKFKDALLAAENYRQIFGEHNFYLEIME 180

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            +   ++      +++++    +P+ ATN+  +L+ ED E+H+VL+ +     +   DR R
Sbjct: 181  NGLPEQKTANEGLLEISRQLSIPVAATNDCHYLNREDAESHEVLLCIQTGKTLDDSDRMR 240

Query: 248  VTPD-HYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
             + D  Y ++  +M  +F+  PEA+ENT EIA RC+   +     LP+F         + 
Sbjct: 241  FSTDAFYFRSPDDMKQLFNYCPEAVENTKEIADRCNLSFEFGKFYLPKFEV----SSDET 296

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQ-DYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
             E+ L   A+ GL  R+      +G   +  Y +RL  EL +I  M F+GYFLIV+DF+ 
Sbjct: 297  LEDRLEKVAIQGLAERMPPIVDERGEEVRGIYEKRLADELKIIKSMGFAGYFLIVSDFVS 356

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            +AK+ NIPVGPGRGS AGS+ AYALTITDIDP+R+ L FERFLNPDR+SMPD DIDFC +
Sbjct: 357  YAKRMNIPVGPGRGSAAGSLVAYALTITDIDPIRYDLFFERFLNPDRISMPDIDIDFCPE 416

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
             R ++IRYV  KYG ++V+QIITFG +QA+A +RDVGRAL +PY +VD + KL+PN    
Sbjct: 417  GRGDIIRYVTEKYGEDKVSQIITFGKMQARAVIRDVGRALNIPYGEVDSIAKLVPNILNI 476

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
             +    +  + R +EA   D  + +LL++S+ LEGL RHAS HAAG+VI D PL + VP+
Sbjct: 477  SLDDA-MEMEPRLQEAAKRDEKIRKLLKLSKSLEGLNRHASVHAAGVVISDVPLVERVPL 535

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFD 604
            Y+  + D+    F+M  +   GL KFDFLGLKTLT+++ +L F+ +  G  +DL  +P +
Sbjct: 536  YKSPKDDVTTQ-FSMNDLSTVGLTKFDFLGLKTLTVIKNALSFIKEGLGTDLDLKNLPLN 594

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNR 664
            D +T+ LL+   T G+FQLES GM++ L  M+PDCIED+IAL++LYRPGP++ I  +  R
Sbjct: 595  DADTFKLLSKGETDGVFQLESDGMKEILVRMKPDCIEDLIALIALYRPGPMNMIPEFIAR 654

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K GK  I+     ++ +LKET GVI+YQEQVMQIA +++ YS+SEAD LR+ MGKK   +
Sbjct: 655  KQGKTPIIYEIDQLEGILKETYGVILYQEQVMQIASVIAQYSMSEADTLRKVMGKKDTAK 714

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            M+ ++ +F+ GA  NGI +     I+E +  FA YGFNKSH+ AYA+++YQTA++K HYP
Sbjct: 715  METERPKFMEGAKANGIPEQKTRKIWEQMETFASYGFNKSHSTAYAMVTYQTAYLKAHYP 774

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKG 844
            VEF+AA +T E DN +KI K+    ++  I I+PP +N    DF V  NRI + LAAIK 
Sbjct: 775  VEFMAALLTSEKDNRDKIIKYIHVCKEMGIAILPPDINESQRDFSVAGNRIRFGLAAIKN 834

Query: 845  VGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
            VG      ++ +      F S EDFC+R D KK+N+RVLESL+  GA D  G  R QL+ 
Sbjct: 835  VGLGAIDAMISSRQKGGEFLSFEDFCNRTDLKKVNKRVLESLIKCGAFDSTGQRRRQLMS 894

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDK------ITLEKFSVENSSVRFENEQR 957
              +NI + +Q  +K++ +K  + F   +    ++       +  +    +      +E+ 
Sbjct: 895  EYENIIEISQKRQKDKASKQASFFDDMEDLGVEEKRSYANSSAAEIQEWDPKELLAHEKE 954

Query: 958  VLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGW 1017
             LGFY +GHPL+ Y   +  +        +       + LA +V   ++  TRK   + +
Sbjct: 955  FLGFYVTGHPLEGYASKISMVANTDSAGILEKGDKEPVSLAGIVSGIREVFTRKKEIMAY 1014

Query: 1018 VTFSEPAKEYEANFFP 1033
            V+  +     +  FFP
Sbjct: 1015 VSLEDLKGATDVIFFP 1030


>gi|167465076|ref|ZP_02330165.1| DNA polymerase III DnaE [Paenibacillus larvae subsp. larvae
            BRL-230010]
          Length = 1218

 Score =  822 bits (2122), Expect = 0.0,   Method: Composition-based stats.
 Identities = 373/1058 (35%), Positives = 600/1058 (56%), Gaps = 44/1058 (4%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
             SFVHL VHS YSLL+GA  ++++ ++ A     A+A+TD   ++  + F +     GI+
Sbjct: 2    SSFVHLHVHSEYSLLDGAARIHDLTERAAELGMSALALTDHGVMYGTIAFYKACKQRGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC++        +  N+ + P   +  ++LL     GY+ L++L S  +L +     
Sbjct: 62   PIIGCEVYFTTGSIRQKGNRQEQP---IYHLILLAKNNTGYRNLMKLCSIGHL-EGFHYK 117

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             RI    L    +EGLI L+      + +    +  + A K    ++ +FG+  Y+ +Q 
Sbjct: 118  PRIDAEHLAA-HSEGLICLSACLGSEVSQHLLHDRKEDARKAAERYRSIFGEDFYLEIQD 176

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++      +++L+    +PL+ATN+  ++ E D+E  DVL+ +     V  +DR +
Sbjct: 177  HGMMEQKKVMHSMIELSRETGIPLIATNDVHYVREPDHEVQDVLICIGTGKTVEDEDRLK 236

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
            + T   YLK R  M ++F+ +PEA+ NT ++A +C   +++   ILP F   E       
Sbjct: 237  MGTSQLYLKTREAMAALFAHVPEAVLNTEKVAAQCQVEIELGHSILPSF---EPIPESLT 293

Query: 307  EENELRNKAVA---GLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADF 363
                L+   +    G      +         +   Q+L +EL+VI  M FS YFLIV DF
Sbjct: 294  AAEYLKQLCLEGISGRYGTRQEWNDPSSDFRKQVEQKLYYELDVIESMGFSDYFLIVWDF 353

Query: 364  IQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFC 423
            I++A +  I  GPGRGS AGS+ AYAL ITD+DP+ ++LLFERFLNP+R++MPD DIDF 
Sbjct: 354  IRYAHEQGIMTGPGRGSSAGSLVAYALNITDVDPIEYNLLFERFLNPERITMPDIDIDFN 413

Query: 424  QDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDP 483
             +RRDEVI YV  KYG ERVAQIITFG++ AKAA+RDVGR L +PY++VD+  KLIPN  
Sbjct: 414  DERRDEVIDYVVRKYGKERVAQIITFGTMAAKAAVRDVGRVLNLPYNEVDKAAKLIPNHL 473

Query: 484  AHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
               +   A+  +S  RE     P    LL +++++EG+ RHASTHAAG+VI   PL+  V
Sbjct: 474  GMTID-HALEVNSDLRELAEKQPKTAELLNMAKRVEGMPRHASTHAAGVVISRDPLTDYV 532

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSL-DFLAQRGVKVDLSLIP 602
            P+  +     P+TQ++M+ +E  GL+K DFLGL+TL++++++L     Q G  VD +   
Sbjct: 533  PLQ-EGTEQTPLTQYSMEHLESIGLLKIDFLGLRTLSIIERTLAWIKEQEGKLVDWTQTD 591

Query: 603  FDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYN 662
              D +TY LL+   T G+FQLES GMR+ L+ ++P   EDII++++LYRPGP++ I  Y 
Sbjct: 592  KSDPKTYELLSRGETTGVFQLESPGMRRVLKELKPSRFEDIISVLALYRPGPMEFIPQYI 651

Query: 663  NRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIK 722
              K+ + + V  HP ++ +LK+T G+I+YQEQ+MQIA  ++G+SL EAD+LRRA+ KK +
Sbjct: 652  ACKHKQTEPVYPHPSLETILKDTYGIIVYQEQIMQIASRMAGFSLGEADLLRRAVSKKKR 711

Query: 723  EEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTH 782
            E +D+Q+  F+ G+   G +   A ++++++ +FADYG+ ++HA AY V+++QTA++K H
Sbjct: 712  EVLDEQRSHFVEGSLGQGFTAEEANHVYDMIVRFADYGYPRAHATAYGVLAFQTAYLKAH 771

Query: 783  YPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFK------------- 829
            YP  F+A+ +T    N  K+ ++  + R+  + ++PP +N   V F              
Sbjct: 772  YPRHFMASMLTAVTGNQRKMAEYVDECRRMKLDVLPPDINESGVLFTPVASPGFGTEPAR 831

Query: 830  --------------VGDNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSK 875
                            +  I + LAAIK VG +    +++    + F SL DFC RVD +
Sbjct: 832  YAGEPAEEGMADKIPVNGAIRFGLAAIKNVGASAIEAVLKERRKETFTSLLDFCRRVDLR 891

Query: 876  KLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFS 935
              N+RV+ESL+ AGA D     R QL+  LD+  + A    K + +   ++F   +    
Sbjct: 892  ICNKRVIESLIQAGAFDTLPGHRAQLVAMLDDTAEAALKWRKEKDDLQLHLFGFVEEPHW 951

Query: 936  DKITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNI 995
             ++ +    +     + + E+ ++G Y SGHPLD ++ +L ++      +       + +
Sbjct: 952  -EVEVPDVPMLTKLQQLDYERELIGMYLSGHPLDAHEDLLGRLEADPLYQLQEYPDHSEV 1010

Query: 996  RLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
             +A MV S +   T++G  + ++   +   + E   FP
Sbjct: 1011 VVAGMVASSKTIVTKRGEPMAFMELEDRIAKVEIVLFP 1048


>gi|154253636|ref|YP_001414460.1| DNA polymerase III subunit alpha [Parvibaculum lavamentivorans DS-1]
 gi|154157586|gb|ABS64803.1| DNA polymerase III, alpha subunit [Parvibaculum lavamentivorans DS-1]
          Length = 1139

 Score =  821 bits (2121), Expect = 0.0,   Method: Composition-based stats.
 Identities = 534/1032 (51%), Positives = 698/1032 (67%), Gaps = 15/1032 (1%)

Query: 5    LEKSPS-FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKAC 63
            +  SP  F+HL++HS+YSLLEGA+ + +I     A+  PAIA+TDT NLF ALEFS+   
Sbjct: 1    MSDSPPKFIHLRLHSAYSLLEGAIRIKDIPKLCKANGMPAIALTDTANLFGALEFSETLA 60

Query: 64   AAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLD 123
              GIQPI GC L + + D      +G        ++ LL     GY+ L++L S  +L  
Sbjct: 61   KEGIQPITGCTLPVLL-DTSDEPTRGPIRREPSGNLALLAKDERGYENLMKLSSLAFLGP 119

Query: 124  QGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLY 183
               +   + +  ++E   EGLI LTGG  G ++R         A + LL  K++FGDRLY
Sbjct: 120  DAAEPAHVTMEKVEEF-QEGLICLTGGPDGLVNRLIEAGQPDAAAELLLRLKRIFGDRLY 178

Query: 184  VNLQRHR-GYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            V LQRH    ++  E  +++LAY HELPLVATN   F  E +YEAHD L+ +A    V Q
Sbjct: 179  VELQRHDLPREQIVEGPLIELAYKHELPLVATNEPYFTRESEYEAHDALICIAAGAYVVQ 238

Query: 243  KDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             DR R+TP H  K++ EM ++F+DLPEA+ENTVEIARRC++  Q   PILP+F       
Sbjct: 239  SDRRRLTPQHRFKSQDEMAALFADLPEAIENTVEIARRCAYRPQTRNPILPKFA------ 292

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
                E +ELR +A  GL +RLA   +      ++YR RL+FEL+VI +M F GYFLIVAD
Sbjct: 293  AGTSEADELRRQAEEGLTMRLA--TLEAVAPEEEYRARLNFELDVIIKMDFPGYFLIVAD 350

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK   IPVGPGRGSGAGSV A+ALTITD+DPLRF LLFERFLNP+R+SMPDFDIDF
Sbjct: 351  FIKWAKGQGIPVGPGRGSGAGSVVAWALTITDLDPLRFGLLFERFLNPERVSMPDFDIDF 410

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRRDEVIRYVQ +YG ++VAQIITFG LQA+A LRDVGR LQMPY QVDRLCKL+PN+
Sbjct: 411  CQDRRDEVIRYVQARYGEDKVAQIITFGKLQARAVLRDVGRVLQMPYGQVDRLCKLVPNN 470

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA PV+  +AI  + R +E + AD +V +LLEI Q LEGLYRHASTHAAG+VIGDRPL +
Sbjct: 471  PAAPVTLPEAIKGEPRLQEEQRADETVAKLLEIGQSLEGLYRHASTHAAGVVIGDRPLDE 530

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVP+YRD RSD+PVTQFNMKW+E AGL+KFDFLGLKTLT+L +++  LA+R +++DL  +
Sbjct: 531  LVPLYRDPRSDMPVTQFNMKWVEPAGLVKFDFLGLKTLTVLDRAVKLLARRDIQIDLLNL 590

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P  D +T+ +L    T+G+FQLESSGMR  L  ++ D  EDIIALV+LYRPGP+DNI  Y
Sbjct: 591  PLADEKTFAMLGRGETIGVFQLESSGMRDVLRKLEADRFEDIIALVALYRPGPMDNIPSY 650

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
              RK+G EK   +HPL++P+LKET GVIIYQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 651  VKRKHGTEKPDYLHPLLEPVLKETHGVIIYQEQVMQIAQILSGYSLGEADLLRRAMGKKI 710

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            K EM+ QKERF++GA    I K  A +IFEL+ KFA YGFNKSHAAAYA+++YQTAW+K 
Sbjct: 711  KAEMEAQKERFVTGAVAKQIDKAQAASIFELVDKFAGYGFNKSHAAAYALVAYQTAWLKA 770

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            ++PVEFLAASM+L++ N +K+  F Q+A +  +++  P +N     F V D  I Y+LAA
Sbjct: 771  NHPVEFLAASMSLDLGNTDKLGLFKQEAERLGLKVRRPCINRSEGLFGVADGEILYALAA 830

Query: 842  IKGVGTTTARHIME-ASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQ 900
            IK VG     HI+E      PF  L DF  R++ + +N+R  E+L  AGA D    +R Q
Sbjct: 831  IKNVGLQAMEHIVEVRREGGPFRDLFDFARRINPRLINKRTFENLARAGAFDALNPNRAQ 890

Query: 901  LLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLG 960
            +L + D +   A    + R +K   +F  E G  +    L          R   E   +G
Sbjct: 891  VLAAADLLLGTANVAAQERESKQVGLFGEESGVAAAHPALPAIEPWLPMDRLTEEFNAVG 950

Query: 961  FYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTF 1020
            FY SGHPLD Y+  L++ G+  Y E +        ++A  V +KQ++K++KG+   +++ 
Sbjct: 951  FYLSGHPLDDYRTALQRAGVVTYAELLGKTS-TAAKIAGTVTAKQERKSKKGNPFAFLSL 1009

Query: 1021 SEPAKEYEANFF 1032
            S+P  ++E   F
Sbjct: 1010 SDPTGQFEIVVF 1021


>gi|307317847|ref|ZP_07597285.1| DNA polymerase III, alpha subunit [Sinorhizobium meliloti AK83]
 gi|306896609|gb|EFN27357.1| DNA polymerase III, alpha subunit [Sinorhizobium meliloti AK83]
          Length = 1169

 Score =  821 bits (2121), Expect = 0.0,   Method: Composition-based stats.
 Identities = 636/1030 (61%), Positives = 786/1030 (76%), Gaps = 6/1030 (0%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
            P FVHL+VHS+YSLLEGAL L  I+ K  AD QPAI I DTNNLF+ALEFSQKA   G+Q
Sbjct: 21   PQFVHLRVHSAYSLLEGALPLKKIIGKAVADDQPAIGIADTNNLFAALEFSQKAADDGLQ 80

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTP-FPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQ 127
            PIIGCQL IDM+D  +   +G    F  +P+IVL+ +T +GY RL+ELVSR YL  +G Q
Sbjct: 81   PIIGCQLSIDMEDEAEGERRGHAHQFVKLPAIVLIAATEDGYARLVELVSRAYLEGEGHQ 140

Query: 128  SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQ 187
              RI  SWL   GT GLI LTG  +GP+D A    S  +AE RL    +LFGDRLYV LQ
Sbjct: 141  QTRISRSWLAAGGTTGLIALTGAGAGPVDMALKSGSPALAEARLQALIELFGDRLYVELQ 200

Query: 188  RHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            RH  YDR  E++++ LAY  ++PLVATN + F S  DY+AHD LMAVAH+ +VS   R R
Sbjct: 201  RHGNYDRRHENRMIDLAYRLDIPLVATNEAFFPSPSDYDAHDALMAVAHNAMVSDDSRFR 260

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
            +TPDHYLK+R EM ++F+DLPEALENT+E+ARRCSF+L+   PILPRF     D  + E 
Sbjct: 261  LTPDHYLKSRKEMAALFADLPEALENTIEVARRCSFMLKTRGPILPRFTGASDDPEEAER 320

Query: 308  ENE--LRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
                 LR +A  GLE RLA+  +A GY  +DYR+RL FEL VI RMKF GYFLIVADFI+
Sbjct: 321  AEVAELRRQAEEGLEERLAKLGMAPGYKEEDYRERLAFELGVIQRMKFPGYFLIVADFIK 380

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            WAK+++IPVGPGRGSGAGS+ AYALTITD+DP+RFSLLFERFLNP+R+SMPDFDIDFCQD
Sbjct: 381  WAKQHDIPVGPGRGSGAGSLVAYALTITDVDPMRFSLLFERFLNPERVSMPDFDIDFCQD 440

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL+PN+PA+
Sbjct: 441  RREEVIRYVQQKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKLVPNNPAN 500

Query: 486  PVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
            P    +AI ++ R +E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLSQLVP
Sbjct: 501  PTPLSKAIEEEPRLQEEAEKEPVVARLLDIAQKIEGLYRHASTHAAGIVIGDRPLSQLVP 560

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFD 604
            MYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++DF+ +RG+ +DL+ IP D
Sbjct: 561  MYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKTAVDFVGKRGIHIDLASIPLD 620

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNR 664
            D +TY  L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI VYN R
Sbjct: 621  DPKTYETLSRGETVGVFQVESAGMRKALIGMRPDCIEDIIALVALYRPGPMENIPVYNAR 680

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G+E+I SIHP ID +LKETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKIK E
Sbjct: 681  KHGEEEIESIHPKIDYLLKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIKAE 740

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            MDKQ+ RF+ GA KNG+SK  A  IF+LLAKFA+YGFNKSHAAAYA++SYQTA+MK HYP
Sbjct: 741  MDKQRARFVDGAVKNGVSKPQADLIFDLLAKFANYGFNKSHAAAYAIVSYQTAYMKAHYP 800

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKG 844
            VEFLAASMTL+M N +KI  F QDA +  IQ++ PSV T    F+ GDNRIYYSLAA+KG
Sbjct: 801  VEFLAASMTLDMSNTDKINDFRQDAMRLGIQVVAPSVQTSHRHFETGDNRIYYSLAALKG 860

Query: 845  VGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQS 904
            VG +   HI+    D+PF SLEDFC R+D K LNRRV ESL+ AGA DCFGY R +L+  
Sbjct: 861  VGESAVDHIVAVRGDRPFASLEDFCLRIDPKLLNRRVFESLIAAGAFDCFGYDRAELIGG 920

Query: 905  LDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFS 964
            LD I  +AQ  ++N+ +   ++F     T  +KI L  ++   +S +   E +VLGFY S
Sbjct: 921  LDRILGFAQRAQENKVSGQSDMFGAGAATGPEKIALSPYTPWLASEKLHREFQVLGFYLS 980

Query: 965  GHPLDVYKPILRKMGIKGYEES--VATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSE 1022
             HPLD Y  +L KM ++ + +            RLA  V SKQ++KTR G+++G V FS+
Sbjct: 981  AHPLDTYNNLLAKMRVQTFADFSAAVKKGAAAGRLAGTVTSKQERKTRTGNKMGIVAFSD 1040

Query: 1023 PAKEYEANFF 1032
             + ++EA  F
Sbjct: 1041 ASGQFEAVLF 1050


>gi|322420562|ref|YP_004199785.1| DNA polymerase III subunit alpha [Geobacter sp. M18]
 gi|320126949|gb|ADW14509.1| DNA polymerase III, alpha subunit [Geobacter sp. M18]
          Length = 1156

 Score =  821 bits (2120), Expect = 0.0,   Method: Composition-based stats.
 Identities = 405/1033 (39%), Positives = 613/1033 (59%), Gaps = 18/1033 (1%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL +HS YSLL+GA+ + ++L K+     PA+AITD  N+F  LEF  KA   GI+PI
Sbjct: 6    FVHLHLHSQYSLLDGAIRIGDLLKKVKDCHMPAVAITDHGNMFGTLEFFLKAKEKGIKPI 65

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +G ++ I                 T   ++LL     G++ L  LVS  Y  D   +  R
Sbjct: 66   LGSEVYIAPHSRTLKQAPTAADPVTSYHLILLCENMTGFKNLSYLVSAGY-KDGFYRRPR 124

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHR 190
            I    L +   EGLI+L+    G +      N    A      + + F    Y+ LQ ++
Sbjct: 125  IDKELLLK-HKEGLIVLSACLQGEVAYLAGRNKMDEARDAASWYAENFPGSYYIELQENK 183

Query: 191  GYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVT 249
              ++     +++++A    LPLVATN+  +L++ED  AH++L+ +     +S   R   +
Sbjct: 184  LPEQDIANKRLLEIAREMNLPLVATNDCHYLNQEDARAHEILLCIQTGKTMSDPTRMAFS 243

Query: 250  -PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEE 308
              + Y+K   EM   F   P+ALENTV+IA RC+          P +     +      +
Sbjct: 244  VDEFYVKTPEEMAKAFHYAPDALENTVKIAERCNLEFDFKTYYFPAYEAPPGE----TLD 299

Query: 309  NELRNKAVAGLEVRLAQGAIAKGYHAQD---YRQRLDFELNVIARMKFSGYFLIVADFIQ 365
             +L  +A  GL +RL +  I           Y  RL  EL+ I +M F GYFLIVADFI 
Sbjct: 300  QQLEREATEGLVLRLEKIRIKYNLTEDQEKGYWDRLRIELDCIRQMGFPGYFLIVADFIN 359

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            WAK + IPVGPGRGS AGS+ A+ + ITDIDP+ ++LLFERFLNP+R+SMPD D+DFCQD
Sbjct: 360  WAKDHGIPVGPGRGSAAGSLVAFCIRITDIDPMPYNLLFERFLNPERISMPDIDVDFCQD 419

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RR+EVI+Y+  KYG E+V QIITFG++ A+  +RDVGRAL + +  VD++ KL+P     
Sbjct: 420  RREEVIQYMVEKYGREKVCQIITFGTMAARGVIRDVGRALDLTFGDVDKIAKLVPEVLGI 479

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
             +    +  + + +E   ADP V  ++ ++ +LEGL RHASTHAAG+V+  R + +  P+
Sbjct: 480  TLEKA-LEQEPKLKELMDADPKVKEVMTVALRLEGLARHASTHAAGLVVAPRQMEEFCPV 538

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFD 604
            Y+D ++    TQ++MK++EK GL+KFDFLGLK LT++  +   +   +    D++L+  D
Sbjct: 539  YKDQKTGSLTTQYSMKYVEKIGLVKFDFLGLKNLTVIDNACKHIRAGKDPNFDITLLRDD 598

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYN 662
            D E+Y LL    T G+FQLESSGM++ L  ++P C EDIIA+ +LYRPGP+ + +   + 
Sbjct: 599  DEESYKLLQAGNTTGVFQLESSGMKELLVKLKPSCFEDIIAVCALYRPGPLGSGMVDDFI 658

Query: 663  NRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIK 722
             RK+G+++ V   P ++P+LK+T GVI+YQEQVMQI++ L+GYSL  AD+LRRAMGKK  
Sbjct: 659  ERKHGRKQTVYDLPQLEPVLKDTYGVIVYQEQVMQISRSLAGYSLGGADLLRRAMGKKDA 718

Query: 723  EEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTH 782
            E+M K++++F+ G+ K G+       IF+L+AKFA+YGFNKSH+AAYA+++YQTA++K H
Sbjct: 719  EQMAKERDKFLIGSEKLGLDSKKCAAIFDLMAKFAEYGFNKSHSAAYALVAYQTAFLKAH 778

Query: 783  YPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAI 842
            YPVEF+AA +T +M N +K+ K   D R+  I+++PP +N     F+V +  + + L A+
Sbjct: 779  YPVEFMAALLTEDMANTDKVVKSIGDCREMGIEVLPPDINESLRSFRVLEKAMRFGLGAV 838

Query: 843  KGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
            K VG      I+EA  D+PF  + DFC RVD +++N+RV+E+L+  GA DC G  R QL+
Sbjct: 839  KNVGEGAIEAIIEARGDEPFKDIFDFCERVDQRRVNKRVIEALIKCGAFDCTGAKRAQLM 898

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEK---GTFSDKITLEKFSVENSSVRFENEQRVL 959
             +L++     Q V++ R +   ++F   +   G+      L      +   R   E+  +
Sbjct: 899  AALEDAAVNGQRVQQERESAQASLFGAAEIQRGSNGSGNRLPDIPEWDEKYRLGCEKEAI 958

Query: 960  GFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVT 1019
            GF+ +GHPLD Y   +R+         +     + I++  +  S ++  T+KG R+G+V 
Sbjct: 959  GFFITGHPLDRYVADMRRFSSVDCTSILEAKEKSEIKICGVPTSLKEIMTKKGDRMGFVA 1018

Query: 1020 FSEPAKEYEANFF 1032
              +     E   F
Sbjct: 1019 LEDLVGSVEVVVF 1031


>gi|210621647|ref|ZP_03292734.1| hypothetical protein CLOHIR_00679 [Clostridium hiranonis DSM 13275]
 gi|210154667|gb|EEA85673.1| hypothetical protein CLOHIR_00679 [Clostridium hiranonis DSM 13275]
          Length = 1192

 Score =  821 bits (2120), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/1066 (36%), Positives = 601/1066 (56%), Gaps = 57/1066 (5%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +EK+  F HL VH+ YSLL+G   +  ++ +       A+AITD   +F A++F + A A
Sbjct: 4    MEKN--FTHLHVHTEYSLLDGFSRVKTLVKRAKEKGMTAVAITDHGCMFGAIDFYKAAKA 61

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GI+PIIGC++    +   K+T++          +VLL     GY+ LI++VS+ Y +D 
Sbjct: 62   EGIKPIIGCEVYTAPR---KLTDKDPNYDKHQGHLVLLAKDMVGYKNLIKIVSKSY-VDG 117

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLY 183
                 R  +  L++  ++GLI L+   +G + RA    +   A K  + ++ +FG+   Y
Sbjct: 118  FYYKPRTDMDELKK-HSQGLIALSACLAGDVPRAIMNGNYDKARKLAMEYRDIFGNGNYY 176

Query: 184  VNLQRHRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + +Q H   ++    ++VV+L+    +PLVATN+  ++ ++D +  D+LM +     +  
Sbjct: 177  LEIQDHGLPEQKQVNTEVVRLSRELNIPLVATNDVHYVDKDDAKIQDILMCLQMQKTIDD 236

Query: 243  KDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
            ++R +  + + YLK+R EM  +F +L EAL+NT EIA RC+   + H   LPR+   E  
Sbjct: 237  ENRMKFPSDEFYLKSREEMEQLFPELEEALDNTNEIAERCNVEFEFHKYHLPRYDVPEG- 295

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
                      R     GL  R  +         ++Y++RL++ELN I  M +  YFLIV 
Sbjct: 296  ---YTTNGYFRELCQKGLVERYGEDC------PEEYKERLEYELNTIENMGYVEYFLIVW 346

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DFI +AK+NNI VGPGRGS AGS+ AY L ITDIDP+++SLLFERFLNP+R+SMPD DID
Sbjct: 347  DFINFAKQNNIMVGPGRGSAAGSIVAYTLKITDIDPMKYSLLFERFLNPERVSMPDIDID 406

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FC +RR+EVI YV+ KYG + VAQIITFG++ AK A+RDV R L + Y++ D++ K IP 
Sbjct: 407  FCYERREEVIDYVKRKYGEDHVAQIITFGTMGAKIAIRDVARVLNVSYNKADQIAKEIPF 466

Query: 482  DPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            +    +  +A+  +    E   +D     +++IS++LEG  RHASTHAAG+VI   P+ +
Sbjct: 467  ELGMTID-KAMDSNPTLVELYESDAEAREVIDISKRLEGTLRHASTHAAGVVIARNPVDE 525

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGV------K 595
             VP+Y+    D   TQF M  +E+ GL+K DFLGL+TLT+++ +LD +            
Sbjct: 526  YVPLYK--HQDSITTQFTMTTLEELGLLKMDFLGLRTLTVIRDALDLIELNRDIKGYTEH 583

Query: 596  VDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPI 655
            +D S + +DD E +  L+   TLG+FQLESSGMR  ++ ++P+  EDI+A +SL+RPGP+
Sbjct: 584  IDFSKMEYDDDEVFETLSQGNTLGVFQLESSGMRNFMKQLKPNSFEDIVAGISLFRPGPM 643

Query: 656  DNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRR 715
            D+I  Y   KN  EK+  I+  + P+L+ T G ++YQEQVMQ+ + L+GYS   +D++RR
Sbjct: 644  DSIPTYIENKNNPEKVTYINDKLRPILEVTYGCLVYQEQVMQVVRDLAGYSYGRSDLVRR 703

Query: 716  AMGKKIKEEMDKQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNK 763
            AM KK  + M+++++ FI             G  +NGIS+  A  IF+ +  FA Y FNK
Sbjct: 704  AMSKKKMDVMEEERQYFIHGKFDDEGNIEIPGCIRNGISEEDANKIFDDMIDFARYAFNK 763

Query: 764  SHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNT 823
            SHAAAY V++Y+TA++K HYPVEF+AA MT  M N +K+ ++ ++     I + PP +N 
Sbjct: 764  SHAAAYGVLAYETAYLKVHYPVEFMAALMTSIMGNSDKVVEYIRECNAIGIPVNPPDINK 823

Query: 824  PCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVL 882
                F V  + I + LAA+K VG     +I++    +  F    DF  R+D+K  N+RV+
Sbjct: 824  SFSKFSVEGDSIRFGLAAVKNVGVNIIENIVKEREENGEFKDFVDFAKRLDTKDTNKRVV 883

Query: 883  ESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKIT--- 939
            ESL+  GA D    +R  L+   +++ +      K       ++F        +      
Sbjct: 884  ESLIKCGAFDQISENRATLMAGYESVLESISMDRKKNVQGQISLFDAFSTQVEEAPEMQL 943

Query: 940  ---LEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATI------ 990
               L      +   R   E+ VLG Y SGHPL  YK  L +      ++           
Sbjct: 944  STNLPVVREFSEKERLNMEKEVLGMYLSGHPLSEYKSELDRKTSINMKKINELKEDEKTY 1003

Query: 991  ---RGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
                   + +  MV++K+   T++   + ++T  +     E   FP
Sbjct: 1004 MKLHDREVIMGGMVIAKRIMTTKRNEIMAFITLEDLYGTIEVVVFP 1049


>gi|225028022|ref|ZP_03717214.1| hypothetical protein EUBHAL_02291 [Eubacterium hallii DSM 3353]
 gi|224954622|gb|EEG35831.1| hypothetical protein EUBHAL_02291 [Eubacterium hallii DSM 3353]
          Length = 1160

 Score =  820 bits (2117), Expect = 0.0,   Method: Composition-based stats.
 Identities = 367/1047 (35%), Positives = 579/1047 (55%), Gaps = 39/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            +F HL VH+ YSLL+G+  +  +L +       ++AITD   ++  ++F +KA   GI+P
Sbjct: 2    AFTHLHVHTEYSLLDGSSKIKELLPRAKELGMDSLAITDHGVMYGVIDFYKKAKEVGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +          +          +VLL    +GY+ L+++V+R +  +      
Sbjct: 62   ILGCEIYVAPGSRFDR--EQGRGEDRYYHLVLLAENNQGYKNLMKIVTRGFT-EGYYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYVNLQR 188
            R+    L++   EG+I L+   +G I           A       + +FG+   ++ LQ 
Sbjct: 119  RVDYEVLEKYH-EGIIALSACLAGEIPNKILKEDFDGARAAANKMRDIFGENNFFLELQD 177

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H    +    + +++L+    +P+V TN+  ++ EED   HD+L+ +     VS +DR R
Sbjct: 178  HGIRQQTQVNTSLIRLSRELGIPMVVTNDVHYIREEDAVPHDLLLCIQTGKKVSDQDRMR 237

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +YLK+  EM  +F    EA++NT +IA RC+  +      +P+F   E  D    
Sbjct: 238  YEGGQYYLKSEEEMQKVFPYAREAMDNTHKIAERCNVEIVFGEQKVPKFDVPEGYD---- 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
              + L+     GL  R            Q+ ++RL +EL+ I  M +  YFLIV DFI++
Sbjct: 294  AFSYLKELCETGLVKRYGDP------PPQELQERLSYELSTIKNMGYVDYFLIVWDFIRF 347

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK   I VGPGRGS AGS+ +Y L IT+IDP+R+ L+FERFLNP+R+SMPD DIDFC +R
Sbjct: 348  AKSQGIAVGPGRGSAAGSIVSYCLEITNIDPIRYQLIFERFLNPERVSMPDIDIDFCYER 407

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG ++V QI+TFG++ A+ A+RDVGR L +PY QVD + K+IP +    
Sbjct: 408  RQEVIDYVYEKYGKDKVVQIVTFGTMAARMAVRDVGRVLDIPYVQVDNVAKMIPMELGIT 467

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +   ++A  +D  V  L+++S +LEGL RH S HAAG+VIG +PL + VP+ 
Sbjct: 468  IE-KALKSNPELKQAYESDDVVKNLIDMSMRLEGLPRHTSIHAAGVVIGSKPLDEFVPLS 526

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-GVKVDLSLIPFDD 605
            R    ++  TQF M  IE+ GL+K DFLGL+TLT++Q +   + ++ G    +  I +DD
Sbjct: 527  RGA-DNVITTQFTMTTIEELGLLKMDFLGLRTLTVIQDAARMIGKKLGHDFSIDTIDYDD 585

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
             + Y ++    T G+FQLES+GM+  ++ ++P  +ED+IA +SLYRPGP+D I  Y   K
Sbjct: 586  AKVYEMIGQGKTEGVFQLESAGMKSFMKELKPTNLEDVIAGISLYRPGPMDFIPKYIKGK 645

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
              ++ I    P ++ +L  T G I+YQEQVMQI   L+GY+L  +D++RRAM KK  + M
Sbjct: 646  QNQDSIQYTCPELEEILAPTYGCIVYQEQVMQIVMRLAGYTLGRSDLVRRAMSKKKGDVM 705

Query: 726  DKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
             ++++ F+         G  K GI +  A  IF+ +  FA Y FNKSHAAAYAV+SYQTA
Sbjct: 706  ARERQNFVYGNEEEGVEGCIKRGIPEETANKIFDEMIDFAKYAFNKSHAAAYAVVSYQTA 765

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            W++ +YPVEF+AA +T  + N +KI ++    R   I I+PP +N   V F V  + I Y
Sbjct: 766  WLRCYYPVEFMAALLTSVITNPKKITEYINTCRVMGISILPPDINEGEVGFSVAGDSIRY 825

Query: 838  SLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
             LAAIK +G +    + +   A+  +  L+DF  R+ SK++N+R +E+L+ +GALD FG 
Sbjct: 826  GLAAIKSLGKSVIDVMTQEREANGKYKDLKDFMGRLTSKEINKRTIENLIKSGALDSFGK 885

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAH--EKGTFSDKITLEKFSVENSSVRFEN 954
            +R Q +     + +     +K   +   ++F    E+     ++        + + +   
Sbjct: 886  TRKQQMLVYPVVLEQVNREKKESMSGQMSLFDFFSEEEKKEYEMQYPDVGEYDDAQKLAL 945

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVA--------TIRGNNIRLAAMVVSKQQ 1006
            E+ VLG Y SGHPL+ Y   + K       +              G +  +  ++ +   
Sbjct: 946  EKDVLGIYVSGHPLEKYMDSIEKQTTARSTDFEPDEESGRAIVRDGQHYVVGGLISNITA 1005

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K T+    + +VT  +     E   FP
Sbjct: 1006 KLTKNNQNMAFVTLEDLYGTVEIIVFP 1032


>gi|317132302|ref|YP_004091616.1| DNA polymerase III, alpha subunit [Ethanoligenens harbinense YUAN-3]
 gi|315470281|gb|ADU26885.1| DNA polymerase III, alpha subunit [Ethanoligenens harbinense YUAN-3]
          Length = 1174

 Score =  820 bits (2117), Expect = 0.0,   Method: Composition-based stats.
 Identities = 394/1048 (37%), Positives = 589/1048 (56%), Gaps = 41/1048 (3%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL +HS YSLL+GA  + +I  +     Q A AITD   ++  ++F + A  AG++
Sbjct: 2    SGFVHLHLHSEYSLLDGACRIGDIPARAKELGQAAAAITDHGVMYGVMDFYKAARKAGVK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC++    +           P  +   +VLL    +GY+ LI LVS+ ++ D     
Sbjct: 62   PIIGCEVYTAARTRHDKQYH---PDASHGHLVLLCENMQGYRNLIRLVSQAFI-DGFYGK 117

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQ 187
             R+    L +   EGLI L+   SG + +     +   A  ++  +  LFG D  Y+ LQ
Sbjct: 118  PRVDWDLLTQYH-EGLIALSACLSGEVPKLLLAGNEAGARAKVEAYAALFGEDHFYLELQ 176

Query: 188  RHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
             H   ++ R  + ++++A    LPLVATN++ +L +ED     +L+ +  +  V +    
Sbjct: 177  DHGMPEQQRVNAGLLEIARVSGLPLVATNDAHYLRKEDAYLQKMLLCIQTNRTVDEPGVG 236

Query: 247  RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T + Y+K+  EM ++F  +PEA +NTV IA+RC+        ILP F         +E
Sbjct: 237  FPTDEFYMKSEEEMRALFPQVPEACDNTVAIAKRCNVEFTFGKTILPHFEVPGG----QE 292

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                LR  A  GL  R               ++RLD+EL+VI RM +  Y+LIV DFI+ 
Sbjct: 293  HGAYLRGMAERGLADRYGPQPD------DTVKERLDYELDVITRMGYVDYYLIVHDFIRH 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK+  IPVGPGRGSGAGS+ AY + IT IDP+R+ LLFERFLNP+R+SMPDFDIDFC +R
Sbjct: 347  AKEAGIPVGPGRGSGAGSLVAYCVGITGIDPMRYHLLFERFLNPERISMPDFDIDFCYER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG + VAQIITFG++ A+AA+RDVGRA+ +PY++VDR  K++P +    
Sbjct: 407  RQEVIDYVVRKYGSDHVAQIITFGTMAARAAIRDVGRAMGVPYAEVDRTAKMVPAELGMT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+      R    AD +V RLL+ ++ LEG+ RHASTHAAG+VI   P+   VP+ 
Sbjct: 467  I-AKALEHSEDLRTRYDADETVRRLLDTAKGLEGMPRHASTHAAGVVITRDPVDSYVPLQ 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-QRGVKVDLSLIPFDD 605
            ++   +  VTQF M  +E+ GL+K DFLGL+TLT+++ + + +  Q      +  I  +D
Sbjct: 526  KN--DESIVTQFTMTTLEELGLLKMDFLGLRTLTVIRYAENRIREQYVPDFSIEQIALND 583

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
            H  Y +L +  T G+FQ ES GMR  +  + P+ +ED+IA++SL+RPGP+++I  Y   +
Sbjct: 584  HAVYDMLGSGNTEGVFQFESPGMRHTIMELGPEHMEDLIAVISLFRPGPMESIPRYIENR 643

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            +  EK+   HPL+  +L  T G I+YQEQVM+I + L GYS   AD++RRAM KK    M
Sbjct: 644  HHPEKVAYRHPLLKDILDVTYGCIVYQEQVMEIVRKLGGYSYGRADLVRRAMAKKKAAVM 703

Query: 726  DKQKERF------------ISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVIS 773
             ++++ F              GA +NG+ ++ A  IF+ ++ FA Y FNKSHAAAYA++S
Sbjct: 704  QQERDHFIHGLRREDGTFECVGAVRNGVDESTANAIFDEMSSFASYAFNKSHAAAYALVS 763

Query: 774  YQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDN 833
            YQTA++K HYP E+ AA +T  ++N  K+ ++  +  + +I I+PP VN     F V  N
Sbjct: 764  YQTAYLKCHYPKEYFAALLTSVLENSAKVSEYINECVRLHIGILPPDVNESMNGFTVSGN 823

Query: 834  RIYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALD 892
             I + L A+K +G    R ++   A + PF S  DF  R     LNRR+LESL+  GA D
Sbjct: 824  NIRFGLDAVKNLGRGFIRSLVRERAENGPFASFRDFVRRALPYDLNRRMLESLIKCGAFD 883

Query: 893  CFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRF 952
               Y R QL+   + +    +   KN  +   ++F         +  L+         R 
Sbjct: 884  SLHYKRRQLMLGYEALLAQEETTRKNNLSGQVSLFGTPAAPTDKQENLKDAEEFAPRERL 943

Query: 953  ENEQRVLGFYFSGHPLDVYKPILRKMGIKGY-------EESVATIRGNNIRLAAMVVSKQ 1005
              E+ VLGFY +GHP++ Y+  +R++ +          E       G ++ LA +V SKQ
Sbjct: 944  AYEKEVLGFYLTGHPVERYRAAIRRLKLPSVGTILEHEEHISNDADGTSVSLAGIVQSKQ 1003

Query: 1006 QKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
             K T+    + + T  + +   E   FP
Sbjct: 1004 TKITKNNETMAFCTLDDGSGTIELIVFP 1031


>gi|317052727|ref|YP_004113843.1| DNA polymerase III subunit alpha [Desulfurispirillum indicum S5]
 gi|316947811|gb|ADU67287.1| DNA polymerase III, alpha subunit [Desulfurispirillum indicum S5]
          Length = 1163

 Score =  819 bits (2115), Expect = 0.0,   Method: Composition-based stats.
 Identities = 411/1048 (39%), Positives = 612/1048 (58%), Gaps = 34/1048 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL +H+ YSLL+GA+ +  ++ K      PA+A+TD  N+F A++F ++   AGI+P
Sbjct: 2    SFVHLHLHTMYSLLDGAIKIPELVKKAKEYGMPAVAMTDHGNMFGAVDFYKQCTKAGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +     ++     +  +     +VLL     GY+ LI +VS+ YL +      
Sbjct: 62   ILGCEVYVSPGS-MREKRNAEGVYEGAYHLVLLAENMTGYRNLIYMVSQGYL-EGFYYKP 119

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYVNLQR 188
            RI    L+E  +EG+I L+    G +        ++ A +  L + ++FG+   ++ LQ 
Sbjct: 120  RIDKELLREC-SEGIIALSACLGGEVPNQLLAGDTEGARRSALEYLEIFGEGNFFLELQE 178

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            +   D+     Q++ LA    +P+VATN+  +L+ ED +AHD+L+ +   +    + R R
Sbjct: 179  NGMDDQRAVNRQLIALAEETGIPMVATNDCHYLNREDAKAHDILLCIQTQSNFDDEKRFR 238

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              +   Y K+   M   F  + +A+ NTV+IA RC+  L++    LP++        +  
Sbjct: 239  FDSDQLYFKSPETMHKDFGHIKDAIANTVKIAERCNVQLEMGKVYLPKYDIP----AEHT 294

Query: 307  EENELRNKAVAGLEVRLAQ-GAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
             E+ +   +  GL  R AQ   +   Y    Y +RL+ EL+VI  M F GYFLIVADFIQ
Sbjct: 295  LESYIGEVSRKGLLERFAQFDRLGLTYDRPAYEERLEIELDVINSMGFPGYFLIVADFIQ 354

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            W K  +IPVGPGRGS AGS+ AYAL ITDIDP+ ++LLFERFLNP+R+SMPD DIDFC +
Sbjct: 355  WGKDQDIPVGPGRGSAAGSLVAYALKITDIDPIPYNLLFERFLNPERVSMPDIDIDFCMN 414

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RR EVI YV+ KYG + V QI+T+ SLQAK  LRDV R + +PYS  D+L KL+PN    
Sbjct: 415  RRGEVIDYVRKKYGDQNVCQIVTYASLQAKGVLRDVCRVMGLPYSDGDKLSKLVPNKLGI 474

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
             +  +AI+ + + +EA  A P  + LL+ S  LEGL+R A  HAAGIVI D P+    P+
Sbjct: 475  TLD-EAISMEPKLKEAAAAMPHGENLLKYSLALEGLFRQAGMHAAGIVITDEPIYTYAPL 533

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGV---KVDLSLIP 602
             R      PV QF+    E  GL+KFDFLGLKTLT++ ++  F+ Q      K D+S I 
Sbjct: 534  SRGP-EGEPVCQFDKDKAEDIGLVKFDFLGLKTLTVIDEACRFVQQTQKLPAKFDISAIA 592

Query: 603  FDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--V 660
             DD  TY LL +  + GIFQLES GMR  L  ++P   EDI+A+++LYRPGP+ + +   
Sbjct: 593  MDDQPTYDLLCSGKSAGIFQLESGGMRSLLTKLKPSNFEDIVAVLALYRPGPLGSGMVDD 652

Query: 661  YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKK 720
            + +RK G+ +I+ + P ++P+LK+T GVI+YQEQVMQIA+ + GYSL  AD+LRRAMGKK
Sbjct: 653  FVDRKQGRSEILYLFPELEPILKDTYGVIVYQEQVMQIARTIGGYSLGAADLLRRAMGKK 712

Query: 721  IKEEMDKQKERFIS-------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVIS 773
             +EEM KQKE F+        GA   G     A  +F+L+A FA YGFNKSH+AAYA+++
Sbjct: 713  KEEEMVKQKEIFLHGDGDKVPGAKAMGFDLKKAEQVFDLMAYFAGYGFNKSHSAAYALVA 772

Query: 774  YQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDN 833
            YQTA++K HYP E +AA ++ EMDN +K+ +F  + +   +++ PP +N     F V ++
Sbjct: 773  YQTAYLKAHYPSELMAALLSCEMDNTDKVVQFINECKSMGLEVHPPHINLSGHSFTVDED 832

Query: 834  R--IYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGA 890
               I + L AIK VG+     I++    + PF SL DF  RVD + +N+RV+E+L+  GA
Sbjct: 833  GRSIIFGLTAIKNVGSKAVEAILQERQENGPFTSLYDFTERVDLRSVNKRVVENLIKCGA 892

Query: 891  LDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIF-----AHEKGTFSDKITLEKFSV 945
             D    +R QL+ +LD+     Q ++K+R     ++F            S          
Sbjct: 893  FDSVHANRRQLIGALDHAFSLGQTIQKDREAGQISLFEMEAQDDSSDDLSHHEEYPDVED 952

Query: 946  ENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQ 1005
             N++ R   E+  LGF+ SGHPL+ ++ +L           +   +   +R+A ++ S Q
Sbjct: 953  WNTTTRVAFEKECLGFFVSGHPLEPFQSVLEGY-TTPIASVLEAQKKGRVRIAGVLSSLQ 1011

Query: 1006 QKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
             K T+ G ++  +   +   + E   FP
Sbjct: 1012 PKTTKAGKKMAIIVVEDQTAKLEIPIFP 1039


>gi|315187035|gb|EFU20792.1| DNA polymerase III, alpha subunit [Spirochaeta thermophila DSM 6578]
          Length = 1136

 Score =  819 bits (2115), Expect = 0.0,   Method: Composition-based stats.
 Identities = 420/1032 (40%), Positives = 608/1032 (58%), Gaps = 23/1032 (2%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P FVHL VHS YSLL+G++   +++ ++      A+A+TD  NLF  +EF +KA A
Sbjct: 1    MSTHP-FVHLHVHSDYSLLDGSIKTGDLVKRVKELGMDAVALTDHGNLFGMIEFYKKARA 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            AG+ PI+GC+  +  +                  ++LL     GY  L++LV+  YL   
Sbjct: 60   AGVTPILGCECYVAPESRTLK----DQDHAANYHLILLAENYTGYLNLLKLVTESYLTG- 114

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLY 183
                 RI    L     EGLI L+    G I           A +R   ++ +FG DR Y
Sbjct: 115  FYYKPRID-DGLLAAHHEGLIALSSCLGGEIPSLILGRRIDKARERARFYRDIFGPDRFY 173

Query: 184  VNLQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + LQ H   ++ R    +V+L+   ++PLVATN+  +L +E  EAH+VL+ +  +  +S 
Sbjct: 174  LELQDHGLSEQKRVNKALVELSKELDIPLVATNDVHYLLKEHAEAHEVLLCIGTNKKLSD 233

Query: 243  KDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
            +DR R  T + YLK+  EM  +F  +PEALENTV IA RC+F +    P+LP +   E  
Sbjct: 234  QDRMRFETQEFYLKSPEEMARLFEGIPEALENTVRIAERCAFEIPFPGPLLPEYHIPEGF 293

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
            D     E  LR+    GL+ R  Q         ++ R+R D EL++I +M F+GYFLIV 
Sbjct: 294  D---SPEAYLRHLTYEGLKKRYHQ-------ITREIRERADLELSIIIQMGFTGYFLIVW 343

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DF+ +AK+  IPVGPGRGSGAGS+ AYAL IT+IDPL++ LLFERFLNP+R+SMPDFDID
Sbjct: 344  DFVHFAKEQGIPVGPGRGSGAGSIVAYALGITNIDPLKYGLLFERFLNPERISMPDFDID 403

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FC  RR+EVI YV  KYG +RVAQIITFG+L+ KA ++DV R L +P+++ + L KL+ +
Sbjct: 404  FCYARREEVIDYVTRKYGKDRVAQIITFGTLKPKAVIKDVARVLGIPFAEANELTKLMGD 463

Query: 482  DPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
              +     +AI  + R       D +  RL +I   L+GL RHASTHAAGIVIG   L+ 
Sbjct: 464  ASSVE---EAIQREPRLARLAEEDETYTRLFQIGSVLQGLSRHASTHAAGIVIGREALTN 520

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
             VP+YRD ++    TQ++M+ +E  GL+K DFLGLKTLTL+  + + +       D   I
Sbjct: 521  YVPLYRDPKTGDISTQYSMEHLEDCGLVKMDFLGLKTLTLITHTEELVRTHTPDFDTERI 580

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD +T+ LL    +  +FQ ES GM+  L   +P+ IE++IAL +LYRPGP+  I  +
Sbjct: 581  PEDDAQTFQLLAEGKSTCVFQFESEGMQNILRRAKPESIEELIALNALYRPGPMQFIDQF 640

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
               K G+ KI   HP ++P+LKET GVI+YQEQVMQIAQ ++GY+L  AD+LRRAMGKK 
Sbjct: 641  IEAKQGRRKITYPHPDLEPILKETYGVIVYQEQVMQIAQKIAGYTLGGADILRRAMGKKK 700

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
             E M K+KE+FI GA   G S+  A  +FELL  FA YGFNKSHAAAY+V++Y+TA++K 
Sbjct: 701  PEVMAKEKEKFIKGAVAQGYSRQFAEELFELLIPFAGYGFNKSHAAAYSVLAYKTAYLKA 760

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYP EF+AA++T E+ N +K+ ++  + R   I+++PP +N     F V D +I Y L  
Sbjct: 761  HYPAEFMAANLTNEIGNPDKLAQYIGETRAMGIEVLPPDINASERYFTVRDGKIVYGLVG 820

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IK VGT     I+    + PF S  DF  RVD + +NR+V+E+ + AG  D    +R +L
Sbjct: 821  IKNVGTAAVEEILGKRKEGPFTSFIDFLFRVDLRTVNRKVIETCIQAGVFDSLHPNRAEL 880

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
            + +L+ +  +   +++ +      +F   +    ++         ++  +   E+ +LGF
Sbjct: 881  MHNLEALLAHVNRIKEQQEASQGFLFEETETQIREEFQFTPVEDWDTMEKLRYERELLGF 940

Query: 962  YFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            YFS HPLD  + I  K           T      +L  ++ + ++  T+KG+R+ + T  
Sbjct: 941  YFSSHPLDHLREIWEKGVNLDLSHPERTDPSRTYQLMGVLKTVREITTQKGNRMAFGTIE 1000

Query: 1022 EPAKEYEANFFP 1033
            +     EA FFP
Sbjct: 1001 DYRGSIEAVFFP 1012


>gi|312135078|ref|YP_004002416.1| DNA polymerase III subunit alpha [Caldicellulosiruptor owensensis OL]
 gi|311775129|gb|ADQ04616.1| DNA polymerase III, alpha subunit [Caldicellulosiruptor owensensis
            OL]
          Length = 1140

 Score =  819 bits (2115), Expect = 0.0,   Method: Composition-based stats.
 Identities = 378/1033 (36%), Positives = 598/1033 (57%), Gaps = 30/1033 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL +H+ YSLL+GA  ++ + +++      A+AITD   ++  ++F + A   GI+P
Sbjct: 2    SFVHLHLHTEYSLLDGACRIDRLFERVKELNMNAVAITDHGAMYGVIDFYKAAKENGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +               +  +VLL    +GY+ L  +VS  + ++      
Sbjct: 62   IIGCEVYLAPRTRFDKEA---NIDSDIHHLVLLAMDNDGYRNLSRIVSIGF-VEGFYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            R+    L +  ++GL+ LT   +G I +       +     +  +K++FG+  Y  LQ H
Sbjct: 118  RVDREVLSKY-SKGLVALTSCLAGEIPKFILREQKEKLYDAISFYKEVFGENFYFELQNH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++    +++++L+  +++PLVATN+  +L  ED   HD+L+ +     +S  +R   
Sbjct: 177  YIDEQRFVNNELIRLSKKYQVPLVATNDVHYLKREDRNLHDILLCIQTGKTISDSNRMEF 236

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM  +F  +PEAL+NT+EIA +C+   +     LP+F   E  +   + 
Sbjct: 237  PTDEFYLKSPEEMHQLFGYIPEALKNTLEIAEKCNVEFEFGKINLPKFQLPEGKN---DP 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L+  A  G +              +    RL  EL VI  M F  YFLIV DFI +A
Sbjct: 294  FEYLKELAFEGFKK-------RYSKDDKAAYDRLMMELQVIKDMGFVEYFLIVQDFINYA 346

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K+NNI VGPGRGS AGS+ AY L IT++DP+++ LLFERFLNP+R+SMPD DIDFC  RR
Sbjct: 347  KQNNIMVGPGRGSAAGSIVAYCLGITNVDPIKYDLLFERFLNPERVSMPDIDIDFCYQRR 406

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RV+QIITFG++ A+A++RDVGR L +PYSQVD + K+IP  P   +
Sbjct: 407  QEVIDYVTRKYGEDRVSQIITFGTMAARASIRDVGRVLGIPYSQVDEIAKMIPFSPGMTI 466

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                +  +   ++    + +V ++++ ++ LEG+ RHAS HAAG+VI + P++ LVP+  
Sbjct: 467  DKA-LEINHELKKIYEQNDTVRKIIDTARNLEGMPRHASVHAAGVVISNCPITDLVPL-- 523

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
                D  VTQF M  +E+ GL+K DFLGL+TLT++Q +L+ + + RG+++DL  I ++D 
Sbjct: 524  ARTDDAIVTQFPMTTLEELGLLKMDFLGLRTLTVIQNTLELVKKNRGIEIDLDRIDYNDK 583

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              Y  ++   T G+FQLESSGM+Q ++ ++P+ +EDIIA +SL+RPGP+D I VY   KN
Sbjct: 584  NVYEFISEGNTNGVFQLESSGMKQFMKELKPENLEDIIAGISLFRPGPMDQIPVYIQNKN 643

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
             +EKI  +HP ++P+L  T G I+YQEQVMQI + L+GYSL  AD++RRAM KK  + + 
Sbjct: 644  NREKIEYLHPSLEPILNVTYGCIVYQEQVMQIFRTLAGYSLGRADLVRRAMAKKKADILM 703

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
            ++++RFI GA  NG+++  A  IF ++  FA Y FNKSHAAAYA+++YQTA++K +Y +E
Sbjct: 704  EERDRFIEGAVANGVNRETAEKIFAIIEDFASYAFNKSHAAAYAILAYQTAYLKKYYTIE 763

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            F+ + +T  M++ EK+  + ++ R+F I I+PP +N    DF +  N I + L AIK +G
Sbjct: 764  FMTSLITSVMNSNEKVGMYIEECRRFGISILPPDINKSSYDFTIEGNSIRFGLRAIKSLG 823

Query: 847  TTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSL 905
                 HI+    +   F  L DF  RVD+  +N+R++E+L+ +GA D  G +R  LL S+
Sbjct: 824  ENVIAHILSEREEKGTFKDLYDFIMRVDTNTVNKRIIENLIRSGAFDFTGINRNSLLASV 883

Query: 906  DNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSG 965
            ++I        K +     + F    G  ++    +      +    + E+  +G Y S 
Sbjct: 884  EDIL--VLKQAKKKNANQFSFF-EISGNENESFEYKSLPQPTAQELMKMEKDSIGIYISS 940

Query: 966  HPLDVYKPILRKMGIKGYEESVATIRGNN-----IRLAAMVVSKQQKKTRKGSRIGWVTF 1020
            HPL+ Y   + +  +    E       +      I +  ++   + K T+    + +   
Sbjct: 941  HPLERYTEEISRYNVTPLSEISTMSEEDEYKFEQILVCGILKEVKVKLTKNNQTMAFGKL 1000

Query: 1021 SEPAKEYEANFFP 1033
             +     E  FFP
Sbjct: 1001 EDLTDSVEVLFFP 1013


>gi|167771346|ref|ZP_02443399.1| hypothetical protein ANACOL_02712 [Anaerotruncus colihominis DSM
            17241]
 gi|167665986|gb|EDS10116.1| hypothetical protein ANACOL_02712 [Anaerotruncus colihominis DSM
            17241]
          Length = 1175

 Score =  819 bits (2115), Expect = 0.0,   Method: Composition-based stats.
 Identities = 393/1044 (37%), Positives = 592/1044 (56%), Gaps = 31/1044 (2%)

Query: 1    LTQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQ 60
            L   +     F HL VH+ YSLL+GA  +  +++++ A  Q A+AITD   +F A++F +
Sbjct: 7    LCAVMT---DFAHLHVHTEYSLLDGACRIERLIERVKALGQSAVAITDHGVMFGAVDFYK 63

Query: 61   KACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMY 120
             A   G++PIIGC++ +  +      ++  T   +   ++LL     GYQ LI++VS  +
Sbjct: 64   CAKKHGVKPIIGCEVYVAPRSRFDKQHKIDT---SPYHLILLCKNETGYQNLIKMVSAGF 120

Query: 121  LLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG- 179
             ++      RI  + L++   EGLI L+   +G I R         A++  + ++ LFG 
Sbjct: 121  -VEGFYSKPRIDRALLEQYH-EGLICLSACLAGEIPRMLAQGDYACAKETAVWYRDLFGA 178

Query: 180  DRLYVNLQRHRG-YDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHST 238
            D  Y+ +Q H     +     +V+LA    + LVATN++ ++ + D     VL+ +  +T
Sbjct: 179  DNYYIEIQNHGIRLQQQILPDLVRLAGEIGVGLVATNDAHYIEKADARMQSVLICIQTNT 238

Query: 239  VVSQK-DRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIE 297
             V    D    T + Y+K+R EM  +F + P AL+NT++IA +C+   +     LP F+ 
Sbjct: 239  TVDAPGDLEFETEEFYIKSRDEMDELFGNYPGALDNTLKIAEQCNVEFEFGNTKLPLFVA 298

Query: 298  KECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYF 357
               +D Q       R     GL  R  +             +RL++ELN+I +M +  Y+
Sbjct: 299  PNGEDNQ----AYFRRLCAEGLRRRYGEQPDRS------VTERLEYELNIITKMGYVDYY 348

Query: 358  LIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPD 417
            LIV+DFI +AK   IPVGPGRGSGAGS+ AY + IT IDPLR+SLLFERFLNP+R+SMPD
Sbjct: 349  LIVSDFINYAKSVGIPVGPGRGSGAGSLAAYCIGITGIDPLRYSLLFERFLNPERISMPD 408

Query: 418  FDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCK 477
            FDIDFC +RR EVI YV  KYG + VAQIITFG++ A+ A+RDVGR L M Y QVD + K
Sbjct: 409  FDIDFCYERRQEVIDYVVRKYGADHVAQIITFGTMAARGAIRDVGRVLGMSYQQVDSIAK 468

Query: 478  LIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDR 537
            L+PN+    +    +A  +  +     D  V  LL++++K+EG+ RHASTHAAG+VI   
Sbjct: 469  LVPNELKMTLDKA-LAVSADLKTMCAEDKRVAELLDMARKIEGMPRHASTHAAGVVITRD 527

Query: 538  PLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVD 597
            P+   VP+Y+     +PVTQF M  +E+ GL+K DFLGL+TLT++  +    A+      
Sbjct: 528  PVDSYVPLYKAE-ETMPVTQFTMTTLEELGLLKMDFLGLRTLTVISYAEKEAAKTHPGFS 586

Query: 598  LSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDN 657
               +P DD ET+ +LT    +G+FQ ES+GMR  +  + P  IED+IA++SLYRPGP+++
Sbjct: 587  ADAVPLDDPETFAMLTKGQCVGVFQFESAGMRAVIAQLGPTSIEDLIAVISLYRPGPMES 646

Query: 658  IVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAM 717
            I  Y   ++  E +   HPL+ P+L  T G I+YQEQVMQI + L GYS   AD++RRAM
Sbjct: 647  IPTYIRNRHNPELVTYKHPLLKPILDVTYGCIVYQEQVMQICRALGGYSYGRADLVRRAM 706

Query: 718  GKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
             KK  + M+K++E F++GA +NG+++  A  IF+ ++ FA Y FNKSHAAAYA +SYQTA
Sbjct: 707  SKKKHDVMEKEREAFVAGAQQNGVARETANQIFDEMSSFASYAFNKSHAAAYAFVSYQTA 766

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            ++K HYP EF+AA +T  +DN +K+ ++  +  +  I+++PP VN     F V    I +
Sbjct: 767  YLKCHYPREFMAALLTSVLDNTDKVIEYIGECNRMGIKVLPPDVNVSVEGFTVSGEEIRF 826

Query: 838  SLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
             L A+K +G    R ++        F +  DFC R+  K +N+R +ESL+ +GALDC   
Sbjct: 827  GLLAVKNIGRGFIRELIAERESGGVFQNFSDFCERMYGKDMNKRAVESLIKSGALDCVCK 886

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQ 956
            +R Q+L   + I       +K       N+F    G       L        S     E+
Sbjct: 887  NRNQMLSGYEAILDDIDSAQKRNIAGQINLFDTAAGASKPIHILPNVEELEPSKLLAMEK 946

Query: 957  RVLGFYFSGHPLDVYKPILRKMGIKGYEESVATI-------RGNNIRLAAMVVSKQQKKT 1009
               G Y SGHP+  ++ ++ K       +  +          G  +R+AA+V S++ K T
Sbjct: 947  ETTGLYISGHPMARFQEMVSKNNCTLIADITSAEERGSGVADGTQVRVAAIVNSRRLKST 1006

Query: 1010 RKGSRIGWVTFSEPAKEYEANFFP 1033
            R G  + +V   + +   E   FP
Sbjct: 1007 RGGEMMAFVRLEDTSGSMEMLVFP 1030


>gi|163759322|ref|ZP_02166408.1| DNA polymerase III subunit alpha [Hoeflea phototrophica DFL-43]
 gi|162283726|gb|EDQ34011.1| DNA polymerase III subunit alpha [Hoeflea phototrophica DFL-43]
          Length = 1189

 Score =  819 bits (2115), Expect = 0.0,   Method: Composition-based stats.
 Identities = 605/1031 (58%), Positives = 772/1031 (74%), Gaps = 8/1031 (0%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
            P FVHL+VHSSYSLLEGAL +  ++ +  AD+QPA+AITDTNNLF ALEFS KA  AGIQ
Sbjct: 41   PGFVHLRVHSSYSLLEGALPIKTLIKRALADEQPALAITDTNNLFGALEFSIKAMEAGIQ 100

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPF-PTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQ 127
            P+IGCQLDIDM+D      +        +PSIVL  STA GY+RL  LVSR YL     +
Sbjct: 101  PLIGCQLDIDMEDGAASERRSHRDQLQRLPSIVLYASTATGYERLTALVSRAYLEGDSVE 160

Query: 128  SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQ 187
               I +SWL+E G +GLI LTG   GP+D+    +    A +RL   K +F DR+Y+ LQ
Sbjct: 161  RPHILMSWLEE-GADGLIALTGSVKGPVDQCIRESHPDRAAERLNRLKTVFEDRVYIELQ 219

Query: 188  RHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            R +GYDR  ES+++ LAY  ++PLVATN + F + +D+EAHD LMAVA + V+S   RPR
Sbjct: 220  RQQGYDRAHESKMIALAYAADVPLVATNEAFFPTPDDFEAHDALMAVAANAVMSDDRRPR 279

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFI---EKECDDIQ 304
            ++ D+ LK+R+EM ++F+D+PEAL NT+EIA+RCS I++   PILPRF    E++ D   
Sbjct: 280  LSVDNCLKSRAEMTALFADVPEALRNTIEIAQRCSAIVETRPPILPRFTGGGEEDPDAAL 339

Query: 305  KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
              E  ELR ++  GLE RL +  +A+GY   DYR+RL  EL++I  MKF GYFLIVADFI
Sbjct: 340  AAEAAELRRQSEEGLERRLERIGLAEGYTHDDYRERLKTELDIIENMKFPGYFLIVADFI 399

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
            +WAK ++IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNP R+SMPDFDIDFCQ
Sbjct: 400  KWAKDHDIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPARVSMPDFDIDFCQ 459

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            DRR+EVIRYVQ KYG E+V QIITFGSLQA+AALRDVGR L+MPY  VDR+CKL+PN+PA
Sbjct: 460  DRREEVIRYVQKKYGREQVGQIITFGSLQARAALRDVGRVLEMPYGLVDRICKLVPNNPA 519

Query: 485  HPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
            +P    +AI ++ RF E    +P+V+RLL+I+QKLEGLYRHASTHAAGIVIGDRPLSQLV
Sbjct: 520  NPTPLNKAIEEEPRFAEEMEKEPAVERLLDIAQKLEGLYRHASTHAAGIVIGDRPLSQLV 579

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPF 603
            PMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++ F+A+RG+ +DL  +P 
Sbjct: 580  PMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKTAVGFIAKRGITIDLEGLPL 639

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNN 663
            DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD IEDIIALV+LYRPGP++NI VYN 
Sbjct: 640  DDQPTYEMLSRGETVGVFQVESAGMRKALIGMRPDRIEDIIALVALYRPGPMENIPVYNA 699

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G+E++ SIHP ID +L ETQGVI+YQEQVMQIAQ+L+GYSL EAD+LRRAMGKKIKE
Sbjct: 700  RKHGEEELASIHPKIDGLLAETQGVIVYQEQVMQIAQVLAGYSLGEADLLRRAMGKKIKE 759

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
            EMDKQ+ RF+ GA +  +SK  A  IF+LLAKFA+YGFNKSHAAAY ++SYQTA++K HY
Sbjct: 760  EMDKQRARFVEGAVERDVSKPQADMIFDLLAKFANYGFNKSHAAAYGIVSYQTAYLKAHY 819

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEFLAASMTL+M N +K+  F QDA++  I++ PPSV T    F+ G+NRIYY+LAAIK
Sbjct: 820  PVEFLAASMTLDMSNTDKLNDFRQDAKRLGIEVAPPSVQTSFRHFETGENRIYYALAAIK 879

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
            GVG     HI+E   D  F SLEDFC R+D +++NRRVLESL+ AGALDCFG  R  L+ 
Sbjct: 880  GVGDAAVEHIVEVRGDTEFASLEDFCVRIDPRQVNRRVLESLITAGALDCFGLDRAALVA 939

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
             LD I  +AQ  ++NR +   ++F       ++ I L   +    + +   E + LGFY 
Sbjct: 940  GLDRILGFAQRAQENRISGQSDMFGAGASESAETIHLPDATPWLPAEKLHREYQALGFYL 999

Query: 964  SGHPLDVYKPILRKMGIKGYEESV-ATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            S HPLD Y  +L KM ++ + +   +   G    RLA  V SKQ++KT+ G+++G V FS
Sbjct: 1000 SAHPLDSYADLLNKMRVQNWADFQVSVKAGATAGRLAGTVTSKQERKTKTGNKMGIVAFS 1059

Query: 1022 EPAKEYEANFF 1032
            + + +YEA  F
Sbjct: 1060 DSSGQYEAVLF 1070


>gi|325292654|ref|YP_004278518.1| DNA polymerase III subunit alpha [Agrobacterium sp. H13-3]
 gi|325060507|gb|ADY64198.1| DNA polymerase III alpha subunit [Agrobacterium sp. H13-3]
          Length = 1166

 Score =  819 bits (2114), Expect = 0.0,   Method: Composition-based stats.
 Identities = 628/1032 (60%), Positives = 787/1032 (76%), Gaps = 6/1032 (0%)

Query: 7    KSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAG 66
            K+P FVHL+VHS+YSLLEGAL L  I+ K  AD QPAIAITDTNNLF ALEFS+KA   G
Sbjct: 16   KTPGFVHLRVHSAYSLLEGALPLKKIMSKAVADGQPAIAITDTNNLFVALEFSEKARDEG 75

Query: 67   IQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            +QPIIGCQ+ IDMQD +       +    +P+IVLL + A GY+RL++L+SR YL  +  
Sbjct: 76   LQPIIGCQVSIDMQDAVDDRRNHNSHLAKLPAIVLLAADAGGYERLVDLISRAYLEGESG 135

Query: 127  Q-SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVN 185
              SV I  +WL+E    GLI+LTG S GP+D A     +  A +RLL  K LFGD+LY+ 
Sbjct: 136  GQSVHITRAWLEEASNAGLIVLTGASGGPVDMALKDGHTAQARERLLALKSLFGDKLYIE 195

Query: 186  LQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDR 245
            LQR  G+DR  E +++ LAY H++PLVATN + F S  DYEAHD LMAVAH+ +VS   R
Sbjct: 196  LQRQSGFDRVHERRMIGLAYEHDIPLVATNEAFFPSRADYEAHDALMAVAHNAIVSDDSR 255

Query: 246  PRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
             R+TPDHY+K+R EM  +F+DLPEALENTVEIA RCS++L+   PILPRF     D    
Sbjct: 256  FRLTPDHYMKSREEMAELFADLPEALENTVEIAMRCSYVLKKRGPILPRFTGASDDPEAA 315

Query: 306  EEENE--LRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADF 363
            +      LR +AV GL++RLA   +A GY  Q+YR RLDFEL VI RM F GYFLIVADF
Sbjct: 316  QRAEAEELRRQAVEGLDLRLAALGMAPGYAEQEYRDRLDFELGVIERMGFPGYFLIVADF 375

Query: 364  IQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFC 423
            I+WAK+ +IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNP+R+SMPDFDIDFC
Sbjct: 376  IKWAKQQDIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPERVSMPDFDIDFC 435

Query: 424  QDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDP 483
            QDRR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL+PN+P
Sbjct: 436  QDRREEVIRYVQRKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKLVPNNP 495

Query: 484  AHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQL 542
            A+P    +AI ++ R +E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLS+L
Sbjct: 496  ANPTPLSKAIEEEPRLQEEADKEPVVARLLDIAQKIEGLYRHASTHAAGIVIGDRPLSKL 555

Query: 543  VPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIP 602
            VPMYRD RSD+PVTQFNMKW+E AGL+KFDFLGLKTLT+L+ ++DF+A+RG+KVDL+ IP
Sbjct: 556  VPMYRDPRSDMPVTQFNMKWVESAGLVKFDFLGLKTLTVLKVAVDFVAKRGIKVDLAAIP 615

Query: 603  FDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYN 662
             DD +TY +L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI VYN
Sbjct: 616  LDDAKTYEMLSRGETIGVFQVESAGMRKALIGMRPDCIEDIIALVALYRPGPMENIPVYN 675

Query: 663  NRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIK 722
             RK+G+E++ SIHP ID +LKETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKIK
Sbjct: 676  ARKHGEEELESIHPTIDHLLKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIK 735

Query: 723  EEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTH 782
            EEMD+Q+ERF+ GA +N +SK  A  IF+LLAKFA+YGFNKSHAAAYA++SYQTA+MK H
Sbjct: 736  EEMDQQRERFVDGAIRNSVSKPQANTIFDLLAKFANYGFNKSHAAAYAIVSYQTAYMKAH 795

Query: 783  YPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAI 842
            YPVEFLAASMTL+M N EK+  F QDA +  I+++ PSV T    F+ G+NRIYYSLAAI
Sbjct: 796  YPVEFLAASMTLDMANTEKLNDFRQDASRLGIEVVAPSVQTSFRQFETGENRIYYSLAAI 855

Query: 843  KGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
            KGVG     HI+     KPF SLEDFC R+D K++NRRVLESL+ AG  DCFG  R +++
Sbjct: 856  KGVGEGAVEHIVTVRDGKPFASLEDFCLRIDPKQINRRVLESLINAGGFDCFGRDRAEMI 915

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFY 962
              LD I  Y+Q  +++R     ++F     +  +K+ L  F    +S +   E +VLGFY
Sbjct: 916  GGLDRIIGYSQRAQESRVTGQSDMFGSGGASGPEKLILPAFQPWLASEKLLREYQVLGFY 975

Query: 963  FSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVTF 1020
             + HPLD Y+P+L K+ ++ + +   A  +G    RLA  V  KQ++KTR G+++G VTF
Sbjct: 976  LTAHPLDTYRPVLEKLRVQNFADFSAAVKQGATAGRLAGTVTGKQERKTRTGNKMGIVTF 1035

Query: 1021 SEPAKEYEANFF 1032
            S+ + +YEA  F
Sbjct: 1036 SDASGQYEAVLF 1047


>gi|307718499|ref|YP_003874031.1| DNA polymerase III subunit alpha [Spirochaeta thermophila DSM 6192]
 gi|306532224|gb|ADN01758.1| DNA polymerase III subunit alpha [Spirochaeta thermophila DSM 6192]
          Length = 1136

 Score =  818 bits (2113), Expect = 0.0,   Method: Composition-based stats.
 Identities = 421/1032 (40%), Positives = 609/1032 (59%), Gaps = 23/1032 (2%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P FVHL VHS YSLL+G++   +++ ++      A+A+TD  NLF  +EF +KA A
Sbjct: 1    MSTHP-FVHLHVHSDYSLLDGSIKTGDLVKRVKELDMDAVALTDHGNLFGMIEFYKKARA 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            AG+ PI+GC+  +  +                  ++LL     GY  L++LV+  YL   
Sbjct: 60   AGVTPILGCECYVAPESRTLK----DQDHAANYHLILLAENYTGYLNLLKLVTESYLTG- 114

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLY 183
                 RI    L     EGLI L+    G I           A +R   ++ LFG DR Y
Sbjct: 115  FYYKPRID-DGLLAAHHEGLIALSSCLGGEIPSLILGRQIDKARERARFYRDLFGPDRFY 173

Query: 184  VNLQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + LQ H   ++ R    +V+L+   ++PLVATN+  +L  E  EAH+VL+ +  +  +S 
Sbjct: 174  LELQDHGLPEQKRVNKTLVELSKELDIPLVATNDVHYLLREHAEAHEVLLCIGTNKKLSD 233

Query: 243  KDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
            +DR R  T + YLK+  EM  +F D+PEALENTV IA RC+F +    P+LP +   E  
Sbjct: 234  QDRMRFETQEFYLKSPEEMARLFEDIPEALENTVRIAERCAFEIPFPGPLLPEYHIPEGF 293

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
            D     E  LR+    GL+ R  Q         ++ R+R D EL++I +M F+GYFLIV 
Sbjct: 294  D---SPEAYLRHLTYEGLKKRYHQ-------ITREIRERADLELSIIIQMGFTGYFLIVW 343

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DF+ +AK+  IPVGPGRGSGAGS+ AYAL IT+IDPL++ LLFERFLNP+R+SMPDFDID
Sbjct: 344  DFVHFAKEQGIPVGPGRGSGAGSIVAYALGITNIDPLKYGLLFERFLNPERISMPDFDID 403

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FC  RR+EVI YV  KYG +RVAQIITFG+L+ KA ++DV R L +P+++ + L KL+ +
Sbjct: 404  FCYARREEVIDYVTRKYGKDRVAQIITFGTLKPKAVIKDVARVLGIPFAEANELTKLMGD 463

Query: 482  DPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
              +     +AI  + R       D +  RL +I   L+GL RHASTHAAGIVIG   L+ 
Sbjct: 464  ASSVE---EAIQREPRLARLAEEDETYTRLFQIGSVLQGLSRHASTHAAGIVIGREALTN 520

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
             VP+YRD ++    TQ++M+ +E  GL+K DFLGLKTLTL+  + + +       D   I
Sbjct: 521  YVPLYRDPKTGDISTQYSMEHLEDCGLVKMDFLGLKTLTLITHTEELVRTHTPDFDTERI 580

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD +T+ LL    +  +FQ ES GM+  L   +P+ IE++IAL +LYRPGP+  I  +
Sbjct: 581  PEDDAQTFQLLAEGKSTCVFQFESEGMQNILRRAKPESIEELIALNALYRPGPMQFIDQF 640

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
               K G+ KI   HP ++P+LKET GVI+YQEQVMQIAQ ++GY+L  AD+LRRAMGKK 
Sbjct: 641  IEAKQGRRKITYPHPDLEPILKETYGVIVYQEQVMQIAQKIAGYTLGGADILRRAMGKKK 700

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
             E M K+KE+FI+GA   G S+  A  +F+LL  FA YGFNKSHAAAY+V++Y+TA++K 
Sbjct: 701  PEVMAKEKEKFITGAVAQGYSRQFAEELFDLLIPFAGYGFNKSHAAAYSVLAYKTAYLKA 760

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYP EF+AA++T E+ N +K+ ++  + R   I+++PP +N     F V D +I Y L  
Sbjct: 761  HYPAEFMAANLTNEIGNPDKLAQYIGETRAMGIEVLPPDINASERYFTVRDGKIVYGLVG 820

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IK VGT     I+    + PF S  DF  RVD + +NR+V+E+ + AG  D    +R +L
Sbjct: 821  IKNVGTAAVEEILGKRKEGPFTSFIDFLFRVDLRTVNRKVIETCIQAGVFDSLHPNRAEL 880

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
            + +L+ +  +   +++ +      +F   +    ++         ++  +   E+ +LGF
Sbjct: 881  MHNLEALLAHVNRIKEQQEASQGFLFEETETQIREEFQFTPVEDWDTMEKLRYERELLGF 940

Query: 962  YFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            YFS HPLD  + I  K           T      +L  ++ + ++  T+KG+R+ + T  
Sbjct: 941  YFSSHPLDHLREIWEKGVNLDLSHPERTDPSRTYQLMGVLKTVREITTQKGNRMAFGTIE 1000

Query: 1022 EPAKEYEANFFP 1033
            +     EA FFP
Sbjct: 1001 DYRGSIEAVFFP 1012


>gi|120602759|ref|YP_967159.1| subunit alpha [Desulfovibrio vulgaris DP4]
 gi|120562988|gb|ABM28732.1| DNA polymerase III, alpha subunit [Desulfovibrio vulgaris DP4]
          Length = 1175

 Score =  818 bits (2113), Expect = 0.0,   Method: Composition-based stats.
 Identities = 419/1040 (40%), Positives = 604/1040 (58%), Gaps = 23/1040 (2%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
            E    FVHL  H+ YSLL+GA+ L ++  +       A AITD  NLF A  F     + 
Sbjct: 10   ENMSDFVHLHCHTEYSLLDGAIRLKDLGARAKDYGMTAAAITDHGNLFGAAYFYTTCKSF 69

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQG 125
            GI+PIIGC++ +   D    T++      T   +VLL    EGY  L+ LV+R +  +  
Sbjct: 70   GIKPIIGCEVYVAATDRTDKTSEFAR---TRYHLVLLAQNNEGYHNLVRLVTRGFT-EGF 125

Query: 126  KQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVN 185
                R+    L+E  ++GLI L+   +G + R                +  +F  R Y+ 
Sbjct: 126  HYKPRVDKELLREY-SDGLIALSACLAGEVPRVLMKQGMDAGIATAQEYASIFPGRFYLE 184

Query: 186  LQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
            LQ +   ++     ++++LA    LPLVATN+  +L   D EAHD+L+ +   T V    
Sbjct: 185  LQSNGIKEQEVLNEKLIELAGHTNLPLVATNDCHYLDATDVEAHDILLCIQTQTTVDDPK 244

Query: 245  RPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDI 303
            R R  T + Y K+  EM   F+ +PEA+ NT  IA  C+  +       P +   E    
Sbjct: 245  RMRFETRELYYKSPEEMEKAFAHVPEAIANTGRIAEMCNIEMSFGKYFFPVYELPEGM-- 302

Query: 304  QKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADF 363
                + E +  A  GL+ RL +         + Y  RL++EL VI  M F GYFLIV DF
Sbjct: 303  --TLDTEFQRLAEEGLKKRLEKHPDRDTIDHKAYWDRLEWELKVITDMGFPGYFLIVQDF 360

Query: 364  IQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFC 423
            I WAK N IPVGPGRGS AGS+ A++L IT++DP+ + LLFERFLN +R+SMPD D+DFC
Sbjct: 361  INWAKNNGIPVGPGRGSAAGSLVAWSLRITNLDPIPYDLLFERFLNNERVSMPDIDVDFC 420

Query: 424  QDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDP 483
            + RR EVIRYV  KYG + V+QI TFG ++AKA +RDVGRAL M + + DR+ KLIP D 
Sbjct: 421  ERRRTEVIRYVAEKYGEDSVSQITTFGKMKAKAVVRDVGRALGMSFGETDRIAKLIPEDL 480

Query: 484  AHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
               +  +A+  +         DP + +LL++S +LEGL RHASTHAAG+VI D+P+S+ +
Sbjct: 481  KMTIK-KALEAEPDLATLYRDDPQIRKLLDVSMRLEGLSRHASTHAAGVVISDKPMSEYL 539

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLD-FLAQRGVKVDLSLIP 602
            P+Y+  +    VTQF+MK +EK GL+KFDFLGL+T+TL+Q +LD    Q     DL  + 
Sbjct: 540  PLYKG-KKGETVTQFDMKMVEKVGLVKFDFLGLRTMTLVQDALDEITRQGKTPPDLDTLS 598

Query: 603  FDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVV-- 660
             DD ETY L +   T G+FQ+ESSGMRQ L  ++P C +DIIA+++LYRPGP+ + +V  
Sbjct: 599  LDDAETYELYSRGDTDGVFQVESSGMRQYLRMLRPTCFDDIIAMLALYRPGPLGSGMVDE 658

Query: 661  YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKK 720
            +  RK+G+  +    P ++  L+ T GVI+YQEQVMQIAQ++  Y+L  AD+LRRAMGKK
Sbjct: 659  FIKRKHGEVPVTYPVPSLEACLQPTYGVIVYQEQVMQIAQIVGSYTLGGADLLRRAMGKK 718

Query: 721  IKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMK 780
            I E M +++ +F+ GA KN I K  A  IF+L+ KFA+YGFNKSH+AAYA+ISY TA++K
Sbjct: 719  IAEAMAEERTKFVQGAQKNDIPKEKANEIFDLMEKFAEYGFNKSHSAAYALISYYTAFLK 778

Query: 781  THYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLA 840
             H+PVEF+AA +T EM N +K+ K+    +  +I+++ P+V     +F V + RI + L 
Sbjct: 779  VHFPVEFMAALLTSEMGNQDKLLKYVAACKDMDIEVLRPNVQVSRREFTVHEGRIVFGLG 838

Query: 841  AIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRM 899
             IK VG    R I++A  +  P+ SL D C RV+ +K+ +RV+E+L+  GA DC G +R 
Sbjct: 839  GIKNVGDEAIREIVDAREEGGPYASLLDMCVRVNLRKVTKRVIENLIKGGACDCLGCTRA 898

Query: 900  QLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKI------TLEKFSVENSSVRFE 953
             +L SLD +   AQ   K R +   ++F   K               +         +  
Sbjct: 899  GMLASLDTVVARAQKKLKERDSNQVSLFTMIKEEPKVCPGIGFDCEEQTAPEWPDDQKLR 958

Query: 954  NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGS 1013
             E+  LGF+ + HPL  Y+  L ++ +   EE+     G  IR A +V + ++  T+KG 
Sbjct: 959  FEKEALGFFLTSHPLQPYRKELFRLRLTPLEEARDMPPGAEIRTAVLVTTLKELMTKKGQ 1018

Query: 1014 RIGWVTFSEPAKEYEANFFP 1033
            R+ +    +     E  FFP
Sbjct: 1019 RMAFAGVEDLTASAEVVFFP 1038


>gi|253577284|ref|ZP_04854602.1| DNA polymerase III [Paenibacillus sp. oral taxon 786 str. D14]
 gi|251843288|gb|EES71318.1| DNA polymerase III [Paenibacillus sp. oral taxon 786 str. D14]
          Length = 1110

 Score =  818 bits (2113), Expect = 0.0,   Method: Composition-based stats.
 Identities = 397/1060 (37%), Positives = 594/1060 (56%), Gaps = 47/1060 (4%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL VHS YSLL+GA  L +++ K AA    A+A+TD   ++ A+ F +     GI+P
Sbjct: 38   SFVHLHVHSEYSLLDGAARLEDLVAKAAASGMKALALTDHGVMYGAVPFYKLCKKHGIKP 97

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++        +   +G      +  ++LL     GY+ L++L S  +L +      
Sbjct: 98   IIGCEVYFTAGSRKE---RGSRKDQPIHHLILLAKNETGYRNLMKLCSIGHL-EGFHYKP 153

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            RI    L +   EGL+ L+    G +         + A+K  L ++  FG+  Y+ LQ H
Sbjct: 154  RIDWDAL-QRHREGLVCLSACLGGEVPFHLLRGHYEEAKKAALRYQAAFGEDFYLELQDH 212

Query: 190  RGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR- 247
               ++      +VQLA      LV TN++ +LS+ED E  DVL+ V     V  +DR + 
Sbjct: 213  GIPEQKKVNPLLVQLAGEIGAELVVTNDAHYLSKEDAEVQDVLICVGTGKTVDDEDRLKM 272

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T   YLK   EM  +F  LPEA  NT +IA  C   L+    ILP +            
Sbjct: 273  HTNQLYLKTAEEMAQLFPHLPEAYANTAKIADSCELELEFDRHILPAY---RPIPEGHTA 329

Query: 308  ENELRNKAVAG-LEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
             + L      G ++              +   QRL +EL +IA M FS YFLIV DFI +
Sbjct: 330  GSYLAELCQQGLVDRYGELDVWRDLTEREKLEQRLRYELEIIASMGFSDYFLIVWDFIAF 389

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A +N I  GPGRGS AGS+ AY L ITD+DP++++LLFERFLNP+R++MPD DIDF  +R
Sbjct: 390  AHRNGIATGPGRGSSAGSLVAYVLRITDVDPIKYNLLFERFLNPERVTMPDIDIDFSDER 449

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            RDEVI YV +KYG E VAQIITFG++ A+AA+RDVGRAL +P+ +VD++ KLIP      
Sbjct: 450  RDEVIAYVVDKYGAEHVAQIITFGTMAARAAVRDVGRALNVPFGEVDKVAKLIPGHLGMT 509

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+ +    +        V RLL+++ K+EG+ RHASTHAAG+VI   PL+  VP+ 
Sbjct: 510  IE-RALKESPDLKAMYDGSERVKRLLDMAMKVEGMPRHASTHAAGVVISRDPLTDAVPLQ 568

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-QRGVKVDLSLIPFDD 605
             +      +TQ++M+ +E  GL+K DFLGL+TL+++++ ++++  Q G   D  L+P +D
Sbjct: 569  -EGSEHTALTQYSMENLEAIGLLKMDFLGLRTLSIIERCMNWIKEQSGDAPDFRLVPDND 627

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
              TY +L    T G+FQLES+GMR+ L+ M+P   EDII+L++LYRPGP++ I  Y   K
Sbjct: 628  PATYEMLGRGETTGVFQLESTGMRRVLKEMKPSVFEDIISLLALYRPGPMEFIPKYIAGK 687

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            +G+  +   HP ++P+LK+T G+I+YQEQ+MQIA  ++G+SL EAD+LRRA+ KK +E +
Sbjct: 688  HGQITVEYPHPDLEPILKDTYGIIVYQEQIMQIASRMAGFSLGEADLLRRAVSKKKREVL 747

Query: 726  DKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPV 785
            D+Q+  F+SG+ + G ++  A  +++++ +FADYGF ++HAAAY V+++QTA++K HYPV
Sbjct: 748  DEQRGHFVSGSVQQGYTEDEANVVYDMIVRFADYGFARAHAAAYGVLAFQTAYLKAHYPV 807

Query: 786  EFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR----------- 834
            +F+A+ +T    +  K+ ++  + R+  I ++PP VN   V F                 
Sbjct: 808  QFMASMLTAVTGSHRKVAEYIVECRRMGIVVLPPDVNESSVLFTPQVGAGSADAALSGEA 867

Query: 835  ---------------------IYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVD 873
                                 I + LAAIK VGT     I+    ++PFDSL DFC RVD
Sbjct: 868  KGRDAKDGHAGSGQEPPALGVIRFGLAAIKNVGTQAIESILRERKERPFDSLLDFCRRVD 927

Query: 874  SKKLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGT 933
             +  N+RV+ESL+  GA D     R QLL  LD   + A    K R      +F   +  
Sbjct: 928  LRTCNKRVIESLIQGGAFDSLPGHRAQLLAMLDETVEAALKWRKERDELQIQLFDFVESP 987

Query: 934  FSDKITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGN 993
              D I         ++ + + E+ +LG Y SGHPLD +  +L   G+    +        
Sbjct: 988  NWD-IEYPDVPKFTAAQQLDLERELLGLYLSGHPLDDFDALLEGEGVDRLMDLAEAPDDT 1046

Query: 994  NIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
               +A MVVS +   T++G  + ++   +  +  E   FP
Sbjct: 1047 RTVVAGMVVSVKTITTKQGKAMAFMELEDQIERCEVVLFP 1086


>gi|78357239|ref|YP_388688.1| DNA polymerase III subunit alpha [Desulfovibrio desulfuricans subsp.
            desulfuricans str. G20]
 gi|78219644|gb|ABB38993.1| DNA polymerase III, alpha subunit [Desulfovibrio desulfuricans subsp.
            desulfuricans str. G20]
          Length = 1165

 Score =  818 bits (2113), Expect = 0.0,   Method: Composition-based stats.
 Identities = 415/1037 (40%), Positives = 616/1037 (59%), Gaps = 23/1037 (2%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
            P FVHL  H+ YSLL+GA+ L ++ +K       A+AITD  N++ A+ F Q A   G++
Sbjct: 2    PQFVHLHCHTEYSLLDGAIRLKDLCEKAKEFDMSAVAITDHGNMYGAVYFYQMAQKMGLK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC++ +   D+   T            +VLL     GY  L +LV+R +  +     
Sbjct: 62   PIIGCEVYVAHGDHTDKT---GDMAKKRYHLVLLAQNRTGYHNLAKLVTRGFT-EGFHYK 117

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             R+    L++  +EG+I L+   +G I RA        A +    + +++ DR Y+ +Q 
Sbjct: 118  PRVSKDLLRQY-SEGIIALSACLAGEIPRALLNEGMDRAIELAREYAEIYPDRFYLEVQS 176

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            +   ++     ++++LA    LPLVATN+  +L + D EAHD L+ +     V+ + R R
Sbjct: 177  NGLKEQDELNDKLIELAGITGLPLVATNDCHYLEKTDVEAHDTLLCIQTGAKVTDERRMR 236

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T + Y K+  EM + F+ +PEA+ENTV+IA +    L +     P +   E       
Sbjct: 237  FETTELYYKSPDEMAAAFAHVPEAIENTVKIAGQIDVTLDLGNYYFPNYELPEGM----T 292

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
             E+E R  +  GL+ RL             Y QRL+ EL+VI  M F GYFLIV DFI W
Sbjct: 293  LEDEFRKLSHEGLQKRLEILPYRDQIDEPAYWQRLEKELDVICSMGFPGYFLIVQDFINW 352

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK N IPVGPGRGS AGS+ A+AL IT++DP+ ++LLFERFLN +R+SMPD D+DFC+ R
Sbjct: 353  AKDNKIPVGPGRGSAAGSIVAWALKITNLDPIPYNLLFERFLNNERVSMPDIDVDFCERR 412

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI+YV  KYG + VAQI TFG ++AKA +RDV RAL + +   DR+ KLIP D    
Sbjct: 413  RGEVIQYVGRKYGEDSVAQITTFGKMKAKAVVRDVARALGLSFQDGDRIAKLIPEDLKMT 472

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +   +     DP + +LL+IS +LEGL RHASTHAAG+VI D+P+ + +P+Y
Sbjct: 473  IK-KALDMEPDLKTLYTNDPQIRKLLDISMRLEGLSRHASTHAAGVVISDKPMFEYLPLY 531

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDD 605
            RD +    VTQF+MK +EK GL+KFDFLGL+T+TL+Q +LD +A +G    DL  +  +D
Sbjct: 532  RDKKGG-IVTQFDMKIVEKVGLVKFDFLGLRTMTLVQDALDLIAMQGLTPPDLDTMSLED 590

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVV--YNN 663
             ETY L +   T G+FQ+ESSGMRQ L  ++P C +D+IA+++LYRPGP+ + +V  +  
Sbjct: 591  KETYELYSRGETDGVFQVESSGMRQYLRMLRPSCFDDVIAMLALYRPGPLGSGMVDEFIK 650

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G+  +      +   L++T GVI+YQEQVMQIAQ+++ Y+L  AD+LRRAMGKK  E
Sbjct: 651  RKHGEVAVTYPLESLKDCLRDTYGVIVYQEQVMQIAQIVANYTLGGADLLRRAMGKKNAE 710

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             M +++ +F  GA +N + +  A  IF+L+ KFA+YGFNKSH+AAYA+ISY TA++K HY
Sbjct: 711  AMAEERIKFTKGAKENNVPEAKATEIFDLMEKFAEYGFNKSHSAAYALISYYTAYLKVHY 770

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEF+AA MT EM+N EK+ K+    +   ++++ P+V     +F V D ++ Y L  IK
Sbjct: 771  PVEFMAALMTSEMNNQEKVLKYVACCKDMGVEVLAPNVQISRREFSVLDGKVTYGLGGIK 830

Query: 844  GVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG    R I+ A   D PF S+ D C RV+ +K+ +RVLE+L+ +GA DC G +R  ++
Sbjct: 831  NVGDEAIREIVRAREEDGPFQSMLDLCMRVNLRKVTKRVLENLIKSGACDCLGCTRQGMV 890

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITL------EKFSVENSSVRFENEQ 956
              LD +   AQ   K + +   ++F+  +        L      +     +   +   E+
Sbjct: 891  AGLDTVVARAQKKAKEKASNQISMFSVMEQEPQTCPGLGFDCPEQSMEEWDDEEKLRKEK 950

Query: 957  RVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIG 1016
              LGFY S HPL  Y+  + ++ +   E+        + + A +V S ++  T+KG R+ 
Sbjct: 951  EALGFYLSSHPLQPYRKEIFRLRLTPLEDCREMGPEQSFKSAVLVTSIKEILTKKGHRMA 1010

Query: 1017 WVTFSEPAKEYEANFFP 1033
            +    +     E  FFP
Sbjct: 1011 FCQVEDLTASGECIFFP 1027


>gi|312127676|ref|YP_003992550.1| DNA polymerase III subunit alpha [Caldicellulosiruptor hydrothermalis
            108]
 gi|311777695|gb|ADQ07181.1| DNA polymerase III, alpha subunit [Caldicellulosiruptor
            hydrothermalis 108]
          Length = 1140

 Score =  818 bits (2113), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/1033 (37%), Positives = 600/1033 (58%), Gaps = 30/1033 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL +H+ YSLL+GA  ++ + +++      A+AITD   ++  ++F + A   GI+P
Sbjct: 2    SFVHLHLHTEYSLLDGACRIDRLFERVKELNMNAVAITDHGAMYGVIDFYKAAKENGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +               +  +VLL    +GY+ L ++VS  + ++      
Sbjct: 62   IIGCEVYLAPRTRFDKEP---NIDNDIHHLVLLAMDNDGYRNLSKIVSIGF-VEGFYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            R+    L +  ++GL+ LT   +G I +       +     +  +K++FG+  Y  LQ H
Sbjct: 118  RVDREVLSKY-SKGLVALTSCLAGEIPKLILREQKEKLYDAISFYKEVFGENFYFELQYH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++    +++++L+  +++PLVATN+  +L  ED   HD+L+ +     +S  +R   
Sbjct: 177  YIDEQRFVNNELMRLSKKYQIPLVATNDVHYLRREDRNLHDILLCIQTGKTISDSNRMEF 236

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM  +F  +PEAL+NT+EIA +C+   +     LP+F   E  +   + 
Sbjct: 237  PTDEFYLKSPEEMQQLFGYIPEALKNTLEIAEKCNVEFEFGKINLPKFQLPEGKN---DA 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L+  A+ G + R            +    RL  EL VI  M F  YFLIV DFI +A
Sbjct: 294  FEYLKELALEGFKKRYKNDD-------KAAYDRLMMELQVIKDMGFVEYFLIVQDFINYA 346

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K+NNI VGPGRGS AGS+ AY L IT++DP+++ LLFERFLNP+R+SMPD DIDFC  RR
Sbjct: 347  KQNNIMVGPGRGSAAGSIVAYCLGITNVDPIKYDLLFERFLNPERVSMPDIDIDFCYQRR 406

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RV+QIITFG++ A+A++RDVGR L +PYSQVD + K++P  P   +
Sbjct: 407  QEVIDYVTRKYGEDRVSQIITFGTMAARASIRDVGRVLGVPYSQVDEIAKMVPFSPGMTI 466

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                +  +   ++    + +V R+++ ++ LEG+ RHAS HAAG+VI   P++ LVP+  
Sbjct: 467  DKA-LEINHDLKKIYEQNDTVRRIIDTARNLEGMPRHASVHAAGVVISSCPITDLVPL-- 523

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
                D  VTQF M  +E+ GL+K DFLGL+TLT++Q +L+ + + RG+++DL  I ++D 
Sbjct: 524  ARTDDAIVTQFPMTTLEELGLLKMDFLGLRTLTVIQNTLELVKKNRGIEIDLDRIDYNDK 583

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              Y  ++   T G+FQLESSGM+Q +  ++P+ +EDIIA +SL+RPGP+D I VY   KN
Sbjct: 584  NVYEFISEGNTNGVFQLESSGMKQFMRELKPENLEDIIAGISLFRPGPMDQIPVYIQNKN 643

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
             +EKI  +HP ++P+L  T G I+YQEQVMQI + L+GYSL  AD++RRAM KK  + + 
Sbjct: 644  NREKIEYLHPSLEPILNVTYGCIVYQEQVMQIFRTLAGYSLGRADLVRRAMAKKKADILM 703

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
            ++K+RFI GA  NGI K  A  IF ++  FA Y FNKSHAAAYA+++YQTA++K +Y +E
Sbjct: 704  EEKDRFIEGAMANGIDKETAEKIFAIIEDFASYAFNKSHAAAYAILAYQTAYLKKYYTIE 763

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            F+ + +T  M++ EK+  + ++ R+F I I+PP +N    DF +  N I + L AIK +G
Sbjct: 764  FMTSLITSVMNSNEKVGMYIEECRKFGISILPPDINKSSYDFTIEGNSIRFGLRAIKSLG 823

Query: 847  TTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSL 905
                 HI++   +   F  L DF  RVD+  +N+R++E+L+ +GA D  G +R  LL S+
Sbjct: 824  ENVIAHILKEREEKGEFKDLYDFIMRVDTNTVNKRIIENLIRSGAFDFTGINRNSLLASV 883

Query: 906  DNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSG 965
            ++I        K +     + F    G  ++    +      +    + E+  +G Y S 
Sbjct: 884  EDIL--VIKQAKKKNANQFSFF-EISGNENESFEYKNMPQPTAQELMKMEKDTIGIYISS 940

Query: 966  HPLDVYKPILRKMGIKGYEESVATIRGNN-----IRLAAMVVSKQQKKTRKGSRIGWVTF 1020
            HPL+ Y   + K  +    E  A    +      I +  ++   + K T+    + +   
Sbjct: 941  HPLERYTEEISKYNVTPLSEISAMSEEDEYKFEQILVCGILKEVKVKLTKNNQTMAFAKL 1000

Query: 1021 SEPAKEYEANFFP 1033
             +     E  FFP
Sbjct: 1001 EDLTDSVEVLFFP 1013


>gi|146296832|ref|YP_001180603.1| DNA polymerase III DnaE [Caldicellulosiruptor saccharolyticus DSM
            8903]
 gi|145410408|gb|ABP67412.1| DNA polymerase III catalytic subunit, DnaE type [Caldicellulosiruptor
            saccharolyticus DSM 8903]
          Length = 1141

 Score =  818 bits (2112), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/1033 (36%), Positives = 600/1033 (58%), Gaps = 30/1033 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL VH+ YSLL+GA+ + ++ +++      +IAITD   ++  ++F + A   GI+P
Sbjct: 2    SFVHLHVHTEYSLLDGAVRIESLFERVRQLNMHSIAITDHGAMYGVVDFYKAAKENGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +               +  +VLL    EGY+ L ++VS  + ++      
Sbjct: 62   IIGCEVYLAPRSRFDKEP---NIDNDIHHLVLLAIDNEGYKNLSKIVSIGF-VEGFYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            R+    L +  ++GLI LT   +G I +    +  +     +  +K +FG   Y  LQ H
Sbjct: 118  RVDREILSKY-SKGLIALTSCLAGEIPKFILRDQKEKLMDAIGFYKDVFGCNFYFELQYH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++    S++++L+  +++P+VATN+  +L  ED E HD+L+ +     +   +R   
Sbjct: 177  GIDEQRFVNSELIRLSKKYQIPVVATNDVHYLKREDREIHDILLCIQTGKTIHDSNRMEF 236

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM  +F  +PE+L+NT+EIA +C+   +     LP+F   E    + + 
Sbjct: 237  PTSEFYLKSAQEMEEVFGYIPESLKNTLEIAEKCNVEFEFGKINLPKFQLPEG---KSDA 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L+  A AG E              +    RL  ELNVI  M F+ YFLIV DFI +A
Sbjct: 294  FEYLKELAFAGFEK-------RYSKENKAAYDRLLMELNVIKDMGFTEYFLIVHDFINYA 346

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K+NNI VGPGRGS AGS+ AY L IT++DP++++LLFERFLNP+R+SMPD DIDFC  RR
Sbjct: 347  KQNNIMVGPGRGSAAGSIVAYCLGITNVDPIKYNLLFERFLNPERVSMPDIDIDFCYQRR 406

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV NKYG ++V+QIITFG++ A+A++RDVGR L +PY+QVD + K++P  P   +
Sbjct: 407  QEVIDYVTNKYGKDKVSQIITFGTMAARASIRDVGRVLGVPYAQVDEIAKMVPFSPGMTI 466

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                +  +   ++    + +V R+++ ++ +EG+ RH S HAAG+VI   P++ LVP+  
Sbjct: 467  DKA-LEVNHDLKKIYEQNETVKRIIDTARSIEGMPRHTSVHAAGVVISSCPITDLVPL-- 523

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSLIPFDDH 606
                D  VTQF M  +E+ GL+K DFLGL+TLT++Q +L+     R +++DL  I ++D 
Sbjct: 524  ARTEDAIVTQFPMTTLEELGLLKMDFLGLRTLTVIQNTLELIKKHRKIEIDLDKIDYNDR 583

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              Y  ++   T G+FQLESSGM+Q ++ ++P+ +EDIIA +SL+RPGP+D I VY   KN
Sbjct: 584  SVYQFISEGNTNGVFQLESSGMKQFMKELKPENLEDIIAGISLFRPGPMDQIPVYIQNKN 643

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
             KEKI  +HP ++P+L  T G I+YQEQVMQI + L+GYSL  AD++RRAM KK  + + 
Sbjct: 644  NKEKIEYLHPKLEPILNVTYGCIVYQEQVMQIFRELAGYSLGRADLVRRAMAKKKADILM 703

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
            ++++RFI GA  NG+ +  A  IFE++  FA Y FNKSHAAAYA+++YQTA++K ++ +E
Sbjct: 704  EERDRFIEGAVANGVDRQTAEKIFEIIEDFASYAFNKSHAAAYAILAYQTAYLKKYFTIE 763

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            F+ + +T  M++ EK+  + ++ R+F I I+PP +N    DF +  N I + L AIK +G
Sbjct: 764  FMTSLITSVMNSNEKVGMYIEECRRFGISILPPDINKSSYDFTIEGNSIRFGLRAIKSLG 823

Query: 847  TTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSL 905
                 HI++    +  F  L DF  RVD+  +N+R++E+L+ +GA D    +R  LL S+
Sbjct: 824  ENVISHILKEREQNGEFKDLYDFVMRVDTNTVNKRIIENLIKSGAFDFTKINRNSLLASV 883

Query: 906  DNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSG 965
            ++I    Q  +KN        F       +   + +      +    + E+  +G Y SG
Sbjct: 884  EDILTIKQSQKKN--ANQITFF-EISDDQTKIFSYKDLPEPTTEELLQMEKDTIGIYISG 940

Query: 966  HPLDVYKPILRKMGIKGYEESVATIRG-----NNIRLAAMVVSKQQKKTRKGSRIGWVTF 1020
            HPL+ Y  ++ K  +    E              I +  ++   + K T+    + +   
Sbjct: 941  HPLEKYGDLISKYNVVSLAELSNMTEDDEYKYQQILVCGILKEVKIKLTKNNQTMAFAKI 1000

Query: 1021 SEPAKEYEANFFP 1033
             +     E  FFP
Sbjct: 1001 EDLTDTLEVLFFP 1013


>gi|46579764|ref|YP_010572.1| DNA polymerase III subunit alpha [Desulfovibrio vulgaris str.
            Hildenborough]
 gi|46449179|gb|AAS95831.1| DNA polymerase III, alpha subunit [Desulfovibrio vulgaris str.
            Hildenborough]
 gi|311233555|gb|ADP86409.1| DNA polymerase III, alpha subunit [Desulfovibrio vulgaris RCH1]
          Length = 1164

 Score =  818 bits (2112), Expect = 0.0,   Method: Composition-based stats.
 Identities = 418/1037 (40%), Positives = 603/1037 (58%), Gaps = 23/1037 (2%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL  H+ YSLL+GA+ L ++  +       A AITD  NLF A  F     + GI+
Sbjct: 2    SDFVHLHCHTEYSLLDGAIRLKDLGARAKDYGMTAAAITDHGNLFGAAYFYTTCKSFGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC++ +   D    T++      T   +VLL    EGY  L+ LV+R +  +     
Sbjct: 62   PIIGCEVYVAATDRTDKTSEFAR---TRYHLVLLAQNNEGYHNLVRLVTRGFT-EGFHYK 117

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             R+    L+E  ++GLI L+   +G + R                +  +F  R Y+ LQ 
Sbjct: 118  PRVDKELLREY-SDGLIALSACLAGEVPRVLMKQGMDAGIATAQEYASIFPGRFYLELQS 176

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            +   ++     ++++LA    LPLVATN+  +L   D EAHD+L+ +   T V    R R
Sbjct: 177  NGIKEQEVLNEKLIELAGHTNLPLVATNDCHYLDATDVEAHDILLCIQTQTTVDDPKRMR 236

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T + Y K+  EM   F+ +PEA+ NT  IA  C+  +       P +   E       
Sbjct: 237  FETRELYYKSPEEMEKAFAHVPEAIANTGRIAEMCNIEMSFGKYFFPVYELPEGM----T 292

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
             + E +  A  GL+ RL +         + Y  RL++EL VI  M F GYFLIV DFI W
Sbjct: 293  LDTEFQRLAEEGLKKRLEKHPDRDTIDHKAYWDRLEWELKVITDMGFPGYFLIVQDFINW 352

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK N IPVGPGRGS AGS+ A++L IT++DP+ + LLFERFLN +R+SMPD D+DFC+ R
Sbjct: 353  AKNNGIPVGPGRGSAAGSLVAWSLRITNLDPIPYDLLFERFLNNERVSMPDIDVDFCERR 412

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVIRYV  KYG + V+QI TFG ++AKA +RDVGRAL M + + DR+ KLIP D    
Sbjct: 413  RTEVIRYVAEKYGEDSVSQITTFGKMKAKAVVRDVGRALGMSFGETDRIAKLIPEDLKMT 472

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +         DP + +LL++S +LEGL RHASTHAAG+VI D+P+S+ +P+Y
Sbjct: 473  IK-KALEAEPDLATLYRDDPQIRKLLDVSMRLEGLSRHASTHAAGVVISDKPMSEYLPLY 531

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLD-FLAQRGVKVDLSLIPFDD 605
            +  +    VTQF+MK +EK GL+KFDFLGL+T+TL+Q +LD    Q     DL  +  DD
Sbjct: 532  KG-KKGETVTQFDMKMVEKVGLVKFDFLGLRTMTLVQDALDEITRQGKTPPDLDTLSLDD 590

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVV--YNN 663
             ETY L +   T G+FQ+ESSGMRQ L  ++P C +DIIA+++LYRPGP+ + +V  +  
Sbjct: 591  AETYELYSRGDTDGVFQVESSGMRQYLRMLRPTCFDDIIAMLALYRPGPLGSGMVDEFIK 650

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G+  +    P ++  L+ T GVI+YQEQVMQIAQ++  Y+L  AD+LRRAMGKKI E
Sbjct: 651  RKHGEVPVTYPVPSLEACLQPTYGVIVYQEQVMQIAQIVGSYTLGGADLLRRAMGKKIAE 710

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             M +++ +F+ GA KN I K  A  IF+L+ KFA+YGFNKSH+AAYA+ISY TA++K H+
Sbjct: 711  AMAEERTKFVQGAQKNDIPKEKANEIFDLMEKFAEYGFNKSHSAAYALISYYTAFLKVHF 770

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEF+AA +T EM N +K+ K+    +  +I+++ P+V     +F V + RI + L  IK
Sbjct: 771  PVEFMAALLTSEMGNQDKLLKYVAACKDMDIEVLRPNVQVSRREFTVHEGRIVFGLGGIK 830

Query: 844  GVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG    R I++A  +  P+ SL D C RV+ +K+ +RV+E+L+  GA DC G +R  +L
Sbjct: 831  NVGDEAIREIVDAREEGGPYASLLDMCVRVNLRKVTKRVIENLIKGGACDCLGCTRAGML 890

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKI------TLEKFSVENSSVRFENEQ 956
             SLD +   AQ   K R +   ++F   K               +         +   E+
Sbjct: 891  ASLDTVVARAQKKLKERDSNQVSLFTMIKEEPKVCPGIGFDCEEQTAPEWPDDQKLRFEK 950

Query: 957  RVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIG 1016
              LGF+ + HPL  Y+  L ++ +   EE+     G  IR A +V + ++  T+KG R+ 
Sbjct: 951  EALGFFLTSHPLQPYRKELFRLRLTPLEEARDMPPGAEIRTAVLVTTLKELMTKKGQRMA 1010

Query: 1017 WVTFSEPAKEYEANFFP 1033
            +    +     E  FFP
Sbjct: 1011 FAGVEDLTASAEVVFFP 1027


>gi|222085600|ref|YP_002544130.1| DNA polymerase III alpha subunit protein [Agrobacterium radiobacter
            K84]
 gi|221723048|gb|ACM26204.1| DNA polymerase III alpha subunit protein [Agrobacterium radiobacter
            K84]
          Length = 1187

 Score =  817 bits (2111), Expect = 0.0,   Method: Composition-based stats.
 Identities = 633/1032 (61%), Positives = 808/1032 (78%), Gaps = 7/1032 (0%)

Query: 7    KSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAG 66
             +P FVHL+VHS+YSLLEGAL L  IL K A D QPAIA+TDTNNLF ALEFSQKA   G
Sbjct: 38   DTPEFVHLRVHSAYSLLEGALPLKKILAKAAGDNQPAIAVTDTNNLFVALEFSQKAMDEG 97

Query: 67   IQPIIGCQLDIDMQDNLKMTNQG-KTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQG 125
            +QPIIGCQ+ IDM+D ++   +G +     +PSIVL  +T  GY+RL++LVSR YL  +G
Sbjct: 98   LQPIIGCQVSIDMEDGVEGEKRGPQQALAKLPSIVLFAATERGYERLVDLVSRAYLGGEG 157

Query: 126  KQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVN 185
             Q+V I  SWL+EIGTEG+I LTG   GP+D A     +  A  RLL  K+LFGDRLY+ 
Sbjct: 158  NQAVHITASWLEEIGTEGMIALTGSLGGPVDMALKEGHAPQALSRLLALKRLFGDRLYIE 217

Query: 186  LQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDR 245
            LQRH  YDR  E +++ LAY HELPLVATN + F + +DY+AHD LMAVAH+ +VS   R
Sbjct: 218  LQRHGTYDRRHEQKMIALAYEHELPLVATNEAFFPTRDDYDAHDALMAVAHNAIVSDDTR 277

Query: 246  PRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFI--EKECDDI 303
             R+TPDHYLK+R++M  +F++LPEALENTVEIARRCSF+L+   PILPRF     + ++ 
Sbjct: 278  FRLTPDHYLKSRADMAKLFANLPEALENTVEIARRCSFVLKTRKPILPRFTGAADDEEEA 337

Query: 304  QKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADF 363
             + E  ELR +A+ GL+ RLA   +A GY  +DYR+RL+FEL+VI RMKF GYFLIVADF
Sbjct: 338  DRAESAELRAQAIEGLDQRLASLGMAPGYVEKDYRERLEFELSVIERMKFPGYFLIVADF 397

Query: 364  IQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFC 423
            I+WAK+++IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNP+R+SMPDFDIDFC
Sbjct: 398  IKWAKRHDIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPERVSMPDFDIDFC 457

Query: 424  QDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDP 483
            QDRR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL+PN+P
Sbjct: 458  QDRREEVIRYVQAKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKLVPNNP 517

Query: 484  AHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQL 542
            A+P    QAI ++ R +E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLS+L
Sbjct: 518  ANPTPLHQAIKEEPRLQEEADKEPVVARLLDIAQKIEGLYRHASTHAAGIVIGDRPLSKL 577

Query: 543  VPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIP 602
            VPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++DF+A+RG+ +DL+ IP
Sbjct: 578  VPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKTAVDFVAKRGISIDLASIP 637

Query: 603  FDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYN 662
             DD +TY +L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI VYN
Sbjct: 638  LDDKKTYDMLSRGETVGVFQVESAGMRKALIGMRPDCIEDIIALVALYRPGPMENIPVYN 697

Query: 663  NRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIK 722
             RK+G+E+I SIHP ID +LKETQGVI+YQEQVMQ+AQ+LSGYSL EAD+LRRAMGKKIK
Sbjct: 698  ARKHGEEEIESIHPTIDYLLKETQGVIVYQEQVMQVAQVLSGYSLGEADLLRRAMGKKIK 757

Query: 723  EEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTH 782
             EMD+Q+ERF+ GA KNG+SK  +  IF+LLAKFA+YGFNKSHAAAYA++SYQTA+MK H
Sbjct: 758  AEMDQQRERFVDGAVKNGVSKGQSDVIFDLLAKFANYGFNKSHAAAYAIVSYQTAYMKAH 817

Query: 783  YPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAI 842
            YPVEFLAASMTL+M N EK+  F QDA++  I+++ PS+ T    F+ G+NRIYY+LAA+
Sbjct: 818  YPVEFLAASMTLDMANTEKVNDFRQDAKRLGIEVIAPSIQTSFRRFETGENRIYYALAAL 877

Query: 843  KGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
            KGVG +   HI+E   D+PF  +EDFC R+D K++NRRVLESL+ AGA DCF   R QL+
Sbjct: 878  KGVGESAVDHIVEVRGDQPFAGIEDFCLRIDPKQINRRVLESLIAAGAFDCFEIDRAQLI 937

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFY 962
              +D I  YAQ  ++N+ +   ++F     +  +KI+   F+   +S R   E +VLGFY
Sbjct: 938  GGIDRIMGYAQVAQENKRSGQHDMFG-SAASGPEKISFPPFTPWLASERLLREFQVLGFY 996

Query: 963  FSGHPLDVYKPILRKMGIKGYEESVATIRG--NNIRLAAMVVSKQQKKTRKGSRIGWVTF 1020
             + HPLD YK +L KM ++ + +  A ++   +N RLA  V+SKQ++KTR G+++G   F
Sbjct: 997  LTAHPLDTYKSVLDKMRVQNFADFSAAVKQGASNGRLAGTVISKQERKTRTGNKMGIFVF 1056

Query: 1021 SEPAKEYEANFF 1032
            S+ + ++EA  F
Sbjct: 1057 SDASGQFEAVLF 1068


>gi|312622501|ref|YP_004024114.1| DNA polymerase III subunit alpha [Caldicellulosiruptor kronotskyensis
            2002]
 gi|312202968|gb|ADQ46295.1| DNA polymerase III, alpha subunit [Caldicellulosiruptor
            kronotskyensis 2002]
          Length = 1139

 Score =  817 bits (2111), Expect = 0.0,   Method: Composition-based stats.
 Identities = 386/1033 (37%), Positives = 599/1033 (57%), Gaps = 30/1033 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL +H+ YSLL+GA  ++ + +++      A+ ITD   ++  ++F + A   GI+P
Sbjct: 2    SFVHLHLHTEYSLLDGACRIDRLFERVKDLNMNAVGITDHGAMYGVIDFYKTAKENGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +               +  +VLL    +GY+ L ++VS  + ++      
Sbjct: 62   IIGCEVYLAPRTRFDKEP---NIDNDIHHLVLLAMDNDGYRNLSKIVSIGF-VEGFYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            R+    L +  ++GLI LT   +G I +       +     +  +K++FG+  Y  LQ H
Sbjct: 118  RVDREVLSKY-SKGLIALTSCLAGEIPKLILREQKEKLYDAINFYKEVFGENFYFELQYH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++    +++++L+  +++PLVATN+  +L  ED   HD+L+ +     +S  +R   
Sbjct: 177  YIDEQRFVNNELMRLSKKYQIPLVATNDVHYLRREDRNLHDILLCIQTGKTISDSNRMEF 236

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM  +F  +PEAL+NT+EIA +C+   +     LP+F   E    + + 
Sbjct: 237  PTDEFYLKSPEEMQQLFGYIPEALKNTLEIAEKCNVEFEFGKINLPKFQLPEG---KSDA 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L+  A+ G + R            +    RL  EL VI  M F  YFLIV DFI +A
Sbjct: 294  FEYLKELALEGFKKRYKNDD-------KAAYDRLMMELQVIKDMGFVEYFLIVQDFINYA 346

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K+NNI VGPGRGS AGS+ AY L IT++DP+++ LLFERFLNP+R+SMPD DIDFC  RR
Sbjct: 347  KQNNIMVGPGRGSAAGSIVAYCLGITNVDPIKYDLLFERFLNPERVSMPDIDIDFCYQRR 406

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RV+QIITFG++ A+A++RDVGR L +PYSQVD + K+IP  P   +
Sbjct: 407  QEVIDYVTRKYGEDRVSQIITFGTMAARASIRDVGRVLGVPYSQVDEIAKMIPFSPGMTI 466

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                +  +   ++    +  V ++++ ++ LEG+ RHAS HAAG+VI   P++ LVP+  
Sbjct: 467  DKA-LEINHELKKIYEQNDMVRKIIDTARNLEGMPRHASVHAAGVVISSCPITDLVPL-- 523

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
                D  VTQF M  +E+ GL+K DFLGL+TLT++Q +L+ + + RG+++DL  I ++D 
Sbjct: 524  ARTDDAIVTQFPMTTLEELGLLKMDFLGLRTLTVIQNTLELVKKNRGIEIDLDRIDYNDK 583

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              Y  ++   T G+FQLESSGM+Q ++ ++P+ +EDIIA +SL+RPGP+D I VY   KN
Sbjct: 584  NVYEFISEGNTNGVFQLESSGMKQFMKELKPENLEDIIAGISLFRPGPMDQIPVYIQNKN 643

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
             +EKI  +HP ++P+L  T G I+YQEQVMQI + L+GYSL  AD++RRAM KK  + + 
Sbjct: 644  NREKIGYLHPSLEPILNVTYGCIVYQEQVMQIFRTLAGYSLGRADLVRRAMAKKKADILM 703

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
            ++K+RFI GA  NGI K  A  IF ++  FA Y FNKSHAAAYA+++YQTA++K +Y +E
Sbjct: 704  EEKDRFIEGAMANGIDKETAEKIFAIIEDFASYAFNKSHAAAYAILAYQTAYLKKYYTIE 763

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            F+A+ +T  M++ EK+  + ++ R+F I I+PP +N    DF +  N I + L AIK +G
Sbjct: 764  FMASLITSVMNSNEKVGMYIEECRKFGISILPPDINKSSYDFTIEGNSIRFGLRAIKSLG 823

Query: 847  TTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSL 905
                 HI++       F  L DF  RVD+  +N+R++E+L+ +GA D  G +R  LL S+
Sbjct: 824  ENVIAHILKEREKKGEFKDLYDFIMRVDTNTVNKRIIENLIRSGAFDFTGLNRNSLLASV 883

Query: 906  DNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSG 965
            ++I   A    K +     + F    G  ++    +      +    + E+  +G Y S 
Sbjct: 884  EDIL--AIKQAKKKNANQFSFF-EISGNENESFVYKNMPQPTAQELMKMEKDTIGVYISS 940

Query: 966  HPLDVYKPILRKMGIKGYEESVATIRGNN-----IRLAAMVVSKQQKKTRKGSRIGWVTF 1020
            HPL+ Y   + K  I    E       +      I +  ++   + K T+    + +   
Sbjct: 941  HPLEKYTEEISKYNITPLSEISGMSEEDEYKFEQILVCGILKEVKVKLTKNNQTMAFAKL 1000

Query: 1021 SEPAKEYEANFFP 1033
             +     E  FFP
Sbjct: 1001 EDLTDSVEVLFFP 1013


>gi|257439793|ref|ZP_05615548.1| DNA polymerase III, alpha subunit [Faecalibacterium prausnitzii
            A2-165]
 gi|257197702|gb|EEU95986.1| DNA polymerase III, alpha subunit [Faecalibacterium prausnitzii
            A2-165]
          Length = 1171

 Score =  817 bits (2111), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/1046 (36%), Positives = 588/1046 (56%), Gaps = 41/1046 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
             FVHL +H+ YSLL+GA  ++ ++D++    Q AIA TD   ++  ++F + A  AGI+P
Sbjct: 13   DFVHLHIHTEYSLLDGACRIDQLMDRVKECGQTAIACTDHGVMYGCVQFYKAAKKAGIKP 72

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +      N+          ++LL     GY+ L +LVS  ++ +      
Sbjct: 73   IIGCEVYVATRTRFDKVNK----IDGNNHLILLCKNETGYKNLAKLVSAAFI-EGFYSKP 127

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYVNLQR 188
            R+    L++   EGLI L+   +G I +A      + A+   L ++ LFG+   Y+ LQ 
Sbjct: 128  RVDKQLLEQYH-EGLICLSACLAGEIPQAILSGDYERAKASALWYRDLFGEGNYYIELQD 186

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP- 246
            H   +      Q+++LA    +P+ ATN+S +L +ED +   +L+ +     +   DR  
Sbjct: 187  HGLEEDNIVLPQLIKLARETGIPMAATNDSHYLRKEDAKMQAILLCIQTGKTMQDADRME 246

Query: 247  RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T + Y+K   EM  +F+ +P+A  NT  IA +C+F  +     +P +      D Q  
Sbjct: 247  FQTDEFYVKTTDEMYDLFAMVPDACANTRIIADQCNFDFEFGNTKIPYYKAPGGMDNQ-- 304

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                       GLE R            Q  + RL++E++VI  M ++ Y+LIV D++ +
Sbjct: 305  --AFFEKLCWEGLERRYGSNV------PQANKDRLNYEISVIKTMGYTNYYLIVWDYVNY 356

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK   IPVGPGRGSGAGS+ AY++ ITDIDP+R++L+FERFLNP+R+SMPDFD+DFC +R
Sbjct: 357  AKSQGIPVGPGRGSGAGSIAAYSVGITDIDPIRYNLIFERFLNPERVSMPDFDVDFCYER 416

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG + VAQI+TFG++ A+ A+RDVGR + MPY +VD + K +P +    
Sbjct: 417  RQEVIDYVNRKYGADHVAQIVTFGTMAARNAIRDVGRVMGMPYQEVDVVAKQVPAELKMT 476

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +   A+      R     DP V  LL+ + K+EG+ RHASTHAAG+VI   P    +P+ 
Sbjct: 477  IK-HALEVSPELRRMYETDPKVTELLDTAMKVEGMPRHASTHAAGVVITPEPTDYYLPL- 534

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
                  LPVTQFNM  IE+ GL+K DFLGL+TLT+++ +   + ++     ++ + +DD 
Sbjct: 535  -ATNDGLPVTQFNMTEIEELGLLKMDFLGLRTLTVIRDAELAIQKKEPDFSIAKLDYDDP 593

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            ETY +L+   T G+FQLESSGM+Q L G+QP  +ED+IAL+SLYRPGP+D+I  Y   ++
Sbjct: 594  ETYKMLSRGETEGVFQLESSGMKQVLVGLQPQNLEDVIALISLYRPGPMDSIPTYLRNRH 653

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              +KI    P +  +L  T G I+YQEQVMQI + L+G+S  +AD +RRAM KK    M+
Sbjct: 654  EPDKISYKTPQLAHILDVTNGCIVYQEQVMQIFRELAGFSFGQADNVRRAMSKKKHAVME 713

Query: 727  KQKERF----------ISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQT 776
             ++E F            G   NGIS+ IA  I++ ++ FA Y FNKSHAA YA +++QT
Sbjct: 714  AEREHFVHGCTDPGNECPGCVANGISEKIANEIYDEMSSFASYAFNKSHAACYAYVAFQT 773

Query: 777  AWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGD-NRI 835
            A++K HYP EF+AA +T  +DN  K+ ++  +  +  I+++PP +N     F   D  RI
Sbjct: 774  AYLKCHYPSEFMAALLTSVLDNTGKVIEYSGECARLGIKVLPPDINISGSGFTAEDSGRI 833

Query: 836  YYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFG 895
             + L A+K VGT      +E   +KP+ SL DFC R+   +LNRR +ESL+ AGA D  G
Sbjct: 834  RFGLNAVKNVGTRLIERSVEERQEKPYTSLYDFCKRMHGTELNRRTVESLIKAGAFDNLG 893

Query: 896  YSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKG----TFSDKITLEKFSVENSSVR 951
             +R  L+++ + + K  +   +   +   ++F+   G    + +D   ++       +  
Sbjct: 894  SNRRSLVEATEGVLKSIESDSRKNLDGQIDLFSMMSGTDNTSAADSYEIKPCPEYTHAEL 953

Query: 952  FENEQRVLGFYFSGHPLDVYKPILRKMGIKGYE----ESVATIRGNNIRLAAMVVSKQQK 1007
             + E+ V G Y SGHPLD Y+    +      +    E       +++R+   +V  +  
Sbjct: 954  LQQEKEVSGLYLSGHPLDAYREQSAQFATHTIKALTGEDANVPDNSHVRIVCTIVKSKMV 1013

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             T+  S + + +  +     E   FP
Sbjct: 1014 TTKTNSMMAYTSVEDLTGTMEVIVFP 1039


>gi|284047929|ref|YP_003398268.1| DNA polymerase III, alpha subunit [Acidaminococcus fermentans DSM
            20731]
 gi|283952150|gb|ADB46953.1| DNA polymerase III, alpha subunit [Acidaminococcus fermentans DSM
            20731]
          Length = 1138

 Score =  817 bits (2110), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/1036 (36%), Positives = 586/1036 (56%), Gaps = 31/1036 (2%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL  H+ YSLL+G+  +  ++        PA+AITD   ++  +EF Q+   AGI+PI
Sbjct: 4    FVHLHTHTQYSLLDGSCRIPELVQYAKELGMPALAITDHGVMYGVIEFYQECEKAGIKPI 63

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ I    +L  + + ++    +  ++LL     GYQ L++LVS    ++      R
Sbjct: 64   IGCEVYITSGSHLDKSLETRS---KLYHLILLAENRTGYQNLMKLVSIG-EVEGFYYKPR 119

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            I    L+   +EGLI L+   +G + R       + AEK +L +  +FG D  Y+ +Q H
Sbjct: 120  IDKDVLRRY-SEGLICLSACIAGEVPRHILRGELETAEKTMLEYLDIFGRDHYYLEIQNH 178

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               +      ++ +LA  H + LVATN+  ++ +ED    D+L+ +  +T      R R 
Sbjct: 179  GLPEEATVRQELRRLAQKHGIKLVATNDLHYIRKEDASGQDILLCIQTNTRYLDPQRMRF 238

Query: 249  TPD-HYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
              D +YLK+R EM  +F +  EAL+NT+EIA RC+  L+    +LP F     +      
Sbjct: 239  NNDSYYLKSREEMEELFPEDQEALDNTLEIAERCNVQLEFGHLLLPEFPLPPGE----TM 294

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            +  LR     G   R  +            R+R+++EL +I +M +SGYFLIV DFI ++
Sbjct: 295  DGYLRKLCEEGFPSRYPEDDGTA-------RKRMEYELGIIRQMGYSGYFLIVWDFINYS 347

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            ++++IPVGPGRGS AGS+ AY   IT IDPL+++L+FERFLNP+R+SMPD D D C  +R
Sbjct: 348  RRHDIPVGPGRGSAAGSIVAYLTGITSIDPLKYNLIFERFLNPERVSMPDIDTDICYVKR 407

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
              V+ Y+  KYG   VAQIITFG+L AKAA++DVGRA+ +P + V+++ KLIPN P   +
Sbjct: 408  HLVVDYLARKYGESHVAQIITFGTLAAKAAVKDVGRAMDIPLNVVNQVNKLIPNTPGTTL 467

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                +      RE R  DPS+ +LL+ +QK+EG+ RH STHAAG+VI    L+  VP+  
Sbjct: 468  KGA-LEGSRELRELRDGDPSIAQLLDFAQKVEGMPRHTSTHAAGVVITPGELTDYVPLQI 526

Query: 548  DVRSD----LPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIP 602
               SD       TQ++    E  GL+K D LGL+TLT++  +L  + +    +VD+  I 
Sbjct: 527  TSSSDDEHEYICTQYDKDRSESLGLLKMDLLGLRTLTVIDDALKMIKKNQGTEVDIRTID 586

Query: 603  FDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--V 660
              D +T  +L    T  +FQ+ES GM + ++ + P+  ED+I LV+LYRPGP+ + +   
Sbjct: 587  LHDPKTCRMLCKGDTAAVFQMESDGMTRLMKQLAPEGFEDLIPLVALYRPGPLGSGMAED 646

Query: 661  YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKK 720
            +   ++G+     +HPL++P++ +T GVI+YQEQVMQI   L G++L EAD+LRRAMGKK
Sbjct: 647  FIAGRHGRRTAQVLHPLMEPIVADTYGVILYQEQVMQIVSALGGFTLGEADILRRAMGKK 706

Query: 721  IKEEMDKQKERFISGA-SKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWM 779
              + +D  KE+F+ GA   +GIS+ +   IF LL  FA YGFNKSH+AAYA+++Y TAW+
Sbjct: 707  KAKLLDSMKEKFLDGAQKLHGISRELGSEIFALLQHFAGYGFNKSHSAAYALVAYHTAWL 766

Query: 780  KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSL 839
            K +YPVE++AA +   +   +K+  +    R   IQ++PP +NT    F V  + I + L
Sbjct: 767  KANYPVEYMAAFLNSIITVADKVSWYIGVCRDMGIQVLPPDINTSEAGFSVDGHTIRFGL 826

Query: 840  AAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSR 898
             AIK VG      I+E      PF    DF  RVD  K+N+RV+E+L+  G+++ FG  R
Sbjct: 827  GAIKSVGDAAVTVILEERKKRGPFRDFFDFTRRVDLSKVNKRVVEALIKCGSMNGFGLRR 886

Query: 899  MQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRV 958
             QLL  +D   + A   +++R      +F  E    ++ I +        +     E+ +
Sbjct: 887  SQLLAIMDPALEAAASEQRDRITGQLGLFGEEDIASANTIPIPNLPEIPKAEILRLEREL 946

Query: 959  LGFYFSGHPLDVYKPILRKMG-IKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGW 1017
            +GFY +GHPLD Y+  LR++  +    E      G  I +  ++   + + T+ G R+  
Sbjct: 947  IGFYVTGHPLDAYRNALRRLTPLIRCTE-ENYKDGERIAVGGIITDLRLRSTKNGDRMAS 1005

Query: 1018 VTFSEPAKEYEANFFP 1033
                +         FP
Sbjct: 1006 FVLEDLTGSLTVIAFP 1021


>gi|164686689|ref|ZP_02210717.1| hypothetical protein CLOBAR_00284 [Clostridium bartlettii DSM 16795]
 gi|164604079|gb|EDQ97544.1| hypothetical protein CLOBAR_00284 [Clostridium bartlettii DSM 16795]
          Length = 1178

 Score =  817 bits (2109), Expect = 0.0,   Method: Composition-based stats.
 Identities = 386/1061 (36%), Positives = 595/1061 (56%), Gaps = 54/1061 (5%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            S  F HL VH+ YSLL+G   +  ++ +       ++AITD  N+F  ++F ++A   GI
Sbjct: 2    SSEFAHLHVHTEYSLLDGFSRVKKLIKRTKELGMKSVAITDHGNMFGVIDFYKEAKKQGI 61

Query: 68   QPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQ 127
            +P+IGC+L    +    +T++          ++LL     GYQ LI+LVS  Y +D    
Sbjct: 62   KPVIGCELYTAQRS---LTDKDPNFDKRYGHLILLAENMTGYQNLIKLVSISY-VDGFYY 117

Query: 128  SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNL 186
              R+ +  L+E  +EG+I L+   +G +  A    + + A++  LT+ ++FG    Y+ L
Sbjct: 118  KPRVDIEALRE-HSEGIICLSACLAGDVSNALMNRNYEKAKEIALTYNEIFGQGNFYLEL 176

Query: 187  QRHRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDR 245
            Q H   ++    + +V+L+    +PLVATN+  ++ + D +AHDVL+ +     ++   R
Sbjct: 177  QDHNLPEQKEVNASLVKLSKELNIPLVATNDIHYVDKADSKAHDVLLCIQMGKTLNDPAR 236

Query: 246  PRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQ 304
             R  T + YLK+R EM  +F    EAL+NT +IA RC+     +   LP +   E     
Sbjct: 237  MRFGTEEFYLKSREEMEELFPYALEALDNTAKIAERCNVEFDFNTIHLPNYEVPEG---- 292

Query: 305  KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
                  L      GL  R           +Q+   RL +EL VI +M +  YFLI  DFI
Sbjct: 293  YTTSGYLEELCYKGLYERYEN-------PSQEILDRLKYELGVINKMGYVEYFLITWDFI 345

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
             +AK+N I VGPGRGS AGS+ AY L ITDIDP++++LLFERFLNP+R+SMPD DIDFC 
Sbjct: 346  NFAKENGIMVGPGRGSAAGSIVAYTLKITDIDPIKYNLLFERFLNPERVSMPDIDIDFCY 405

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            +RR+EVI YV+ KYG + VAQIITFG++ AK A+RDVGR L +PY++VD++ K IPN   
Sbjct: 406  ERREEVIDYVKRKYGEDHVAQIITFGTMGAKLAIRDVGRVLDIPYNKVDKIAKEIPNALG 465

Query: 485  HPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
              +  +A+  +   +     D     ++ IS++LEG+ RHASTHAAG+VI   P+ + VP
Sbjct: 466  MTID-KALETNPNLKSLYEQDQETKTIINISKELEGMLRHASTHAAGVVISKNPIDEYVP 524

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSLIPF 603
            +Y+    D   TQF M  +E+ GL+K DFLGL+TLT+++ +LD      G K+D S + +
Sbjct: 525  LYK--HQDAISTQFTMTTLEELGLLKMDFLGLRTLTVIRDALDLIEKNHGRKIDFSKMDY 582

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNN 663
            DD + + LL++  TLG+FQ+ES+GMR  ++ ++P   EDI+A +SLYRPGP+D+I  Y  
Sbjct: 583  DDPKVFELLSSGNTLGVFQMESAGMRSFMKQLKPSNFEDIVAGISLYRPGPMDSIPTYLE 642

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
             K+  EKI  IH  + P+++ T G +IYQEQVM++ + L GYS   +D++RRAMGKK  +
Sbjct: 643  YKHNPEKITYIHEKLKPIMEVTYGCLIYQEQVMEVVRELGGYSYGRSDLVRRAMGKKKMD 702

Query: 724  EMDKQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAV 771
             M+++++ FI             G  +NG+ +  A  IF+ +  FA Y FNKSHAAAY V
Sbjct: 703  VMEEERQYFIHGKTDENGNIEIAGCVRNGVDEQTANKIFDDMIDFAKYAFNKSHAAAYGV 762

Query: 772  ISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVG 831
            I+Y+TA++K HYPVEF+AA +T  M N +K+ ++ ++    NI+++ P +N     F V 
Sbjct: 763  IAYETAYLKAHYPVEFMAALITSVMGNTDKVVEYIRECNALNIKVLKPDINKSFAKFSVE 822

Query: 832  DNRIYYSLAAIKGVGTTTARHIM-EASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGA 890
            DN I + LAA+K VG     +I+ E   +  F    +   R+DSK +N+RV+ESL+  G 
Sbjct: 823  DNNIRFGLAAVKNVGVNIINNIVIEREQNGEFTDFINLIKRLDSKDINKRVIESLIKCGG 882

Query: 891  LDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKI---------TLE 941
             D  GY+R  L+   + + +      K       ++F    G   ++          ++ 
Sbjct: 883  FDEMGYNRASLMMGYEKVLESVSLERKKNIKGQISLFDGLDGLGQNEEIDRFENSTTSIA 942

Query: 942  KFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRG--------- 992
                     +   E+ VLG Y SGHPL  Y+  L        ++                
Sbjct: 943  SIQEFEEREKLALEKEVLGMYVSGHPLSEYEKELETRTSLNTKKLNEVKENLDKYLAMDQ 1002

Query: 993  NNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
             N+ +  M+ +K+ + T++   + ++   +     E   FP
Sbjct: 1003 ENVIIGGMISNKRIQTTKRNEIMAFLEVEDLYGSIEVIVFP 1043


>gi|108762214|ref|YP_633981.1| DNA polymerase III subunit alpha [Myxococcus xanthus DK 1622]
 gi|108466094|gb|ABF91279.1| DNA polymerase III, alpha subunit [Myxococcus xanthus DK 1622]
          Length = 1185

 Score =  816 bits (2107), Expect = 0.0,   Method: Composition-based stats.
 Identities = 410/1048 (39%), Positives = 612/1048 (58%), Gaps = 37/1048 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL +H+ YSLL+GA+ + +++  +      ++A+TD  N+F A++F +KA  AGI+P
Sbjct: 2    SFTHLHLHTLYSLLDGAIRMKDLIKTVKEKGMSSVAVTDHGNMFGAIDFYKKAKDAGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+G +  +          +          ++L+    EGY  L  L S  Y+        
Sbjct: 62   ILGMEAYVA-----GPKGREDRSEKVSHHLILVAKNEEGYANLRYLSSTAYMHG-FYYHP 115

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLF-GDRLYVNLQR 188
            RI    L E  ++GL  LT    G +  A F      A +    +K +F     ++ +Q 
Sbjct: 116  RIDKKVLAE-HSKGLFALTACLGGEVTSACFRGDMDHARRAAQEYKDIFDPGHFFLEVQS 174

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            +   ++ +    + QL+   ++PL AT ++ ++  ED  AH++LM +A    ++   R +
Sbjct: 175  NGMPEQDKANENLKQLSRDLDIPLCATADAHYIKREDARAHELLMCIASGKTLADGKRMK 234

Query: 248  VTPDH-YLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
             + D  Y+ + +EM+  F D+PEA+ NT  IA +C+  L++  P+LP F   +       
Sbjct: 235  HSTDKLYVTSPTEMLEFFKDIPEAVHNTQRIAEQCNLELKLGKPMLPTFKVPD----SHT 290

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYH--AQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
             ++ +   A  GL  R  + A    Y    + Y+ RL  E+ VI +M F GYFLIV DFI
Sbjct: 291  PDSYMAELAYEGLRERFTELAATVTYPIDREQYQARLALEIGVIQKMGFCGYFLIVQDFI 350

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
             WAKK NIPVGPGRGSGAGS+ AYAL ITD+DP+ ++LLFERFLNP+R+SMPDFDIDFCQ
Sbjct: 351  NWAKKMNIPVGPGRGSGAGSLVAYALRITDVDPIPYNLLFERFLNPERVSMPDFDIDFCQ 410

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            DRRDEVI+YV  KYG   V QIITFGSL+AK+ LRDV R   +P+S+ DR+ KL+P    
Sbjct: 411  DRRDEVIQYVGRKYGEMNVGQIITFGSLKAKSVLRDVCRVFALPFSEGDRIAKLVPEVLN 470

Query: 485  HPVSLQAIADDSRFREARLADPSV----------DRLLEISQKLEGLYRHASTHAAGIVI 534
              +  +AI  + R +E      ++            +LEI+  LEGL+R    HAAG+VI
Sbjct: 471  ITL-REAIEMEPRLKEMMETPSNIGEVEGKPVTTRDVLEIALALEGLHRQPGMHAAGVVI 529

Query: 535  GDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGV 594
             D+PL + VP+Y+       +TQF    +E AGL+KFDFLGLKTLT++Q +LD + +   
Sbjct: 530  ADKPLWEFVPVYQPPGEKTLITQFAKDEVEAAGLVKFDFLGLKTLTVIQHALDLVKRNHG 589

Query: 595  KVDLSL-IPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPG 653
            K      IP +D +T+ L+    T GIFQ+ESSG  + +  ++P+C ED+IA  +LYRPG
Sbjct: 590  KDIPRHEIPLNDEKTWELMAKGDTAGIFQMESSGFTEMVVKLKPNCFEDVIAAGALYRPG 649

Query: 654  PIDNIVV--YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEAD 711
            P+D+ +V  + NRK+G+EK+   HP ++P+LK+T GVI+YQEQVMQI+Q+L GY+L  AD
Sbjct: 650  PLDSGMVDVFINRKHGREKVSYPHPALEPVLKDTYGVIVYQEQVMQISQVLGGYTLGRAD 709

Query: 712  VLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAV 771
            +LRRAMGKK  E M  ++  F+ G +KN +   +A  IF+L+ KFA+YGFNKSH+AAY +
Sbjct: 710  LLRRAMGKKKAEVMQAERAGFLEGCAKNNVDLKVAGEIFDLMEKFAEYGFNKSHSAAYGL 769

Query: 772  ISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVG 831
            ++  TAW+K HYP EF+AA ++ E DN +K+ K   +AR+  ++++PP VN   ++F   
Sbjct: 770  VTIHTAWLKAHYPCEFMAALLSSEKDNTDKVVKHIGEARESGLEVLPPDVNQSDMEFGAV 829

Query: 832  DNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGAL 891
              +I + L AIKGVG      I+EA  D  F SL DFC RVDS+K+NR+V+E+LV AG+ 
Sbjct: 830  SGKIRFGLGAIKGVGEGAIESILEARKDGSFKSLFDFCERVDSRKVNRKVMEALVKAGSF 889

Query: 892  DCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD------KITLEKFSV 945
            D    SR Q+  +++         +K++     ++F    G  SD      K    +   
Sbjct: 890  DFEKRSRRQIFDTIEKAMNRGSASQKDKAAGQSSLFGMLAGPSSDGGGGGLKDDYVEVED 949

Query: 946  ENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQ 1005
             +   R   E+  +GFY SGHPL  Y   L++   +         + + + +A +V   +
Sbjct: 950  WSEKERLSLEKEAIGFYVSGHPLHQYDKELKRYA-RPITAVQRARKDDKLTVAGIVTVLR 1008

Query: 1006 QKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            ++ T+ G R+ WVT  + +   E   FP
Sbjct: 1009 ERPTKTGKRMAWVTIEDLSGSIELVCFP 1036


>gi|327194832|gb|EGE61666.1| DNA polymerase III protein, alpha subunit [Rhizobium etli CNPAF512]
          Length = 1165

 Score =  816 bits (2107), Expect = 0.0,   Method: Composition-based stats.
 Identities = 643/1031 (62%), Positives = 810/1031 (78%), Gaps = 6/1031 (0%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            +P F+HL+VHS+YSLLEGAL L  IL K A D QPAIAITDTNNLF ALEFSQKA   G+
Sbjct: 16   TPGFIHLRVHSAYSLLEGALPLKKILYKAAGDNQPAIAITDTNNLFVALEFSQKAMDDGL 75

Query: 68   QPIIGCQLDIDMQDNLKMTNQGKT-PFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            QPIIGCQ+ IDM+D L+   +G       +PSIVLL +T  GY+RL++LVSR YL     
Sbjct: 76   QPIIGCQVSIDMEDGLETEKRGGQQALVKLPSIVLLAATEAGYERLVDLVSRAYLGGDSN 135

Query: 127  QSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNL 186
            Q++ I  SWL+E GTEGLI LTG  +GP+D A        AE RLLT K+LFGDRLYV L
Sbjct: 136  QAIHIRASWLEEAGTEGLIALTGALTGPVDAAIREGHPAQAEARLLTLKRLFGDRLYVEL 195

Query: 187  QRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
            QRH  YD+  E ++V LAY H+LPLVATN + F + +DY+AHD LMAVAH+ +VS   R 
Sbjct: 196  QRHGTYDKRHEQKIVGLAYAHDLPLVATNEAFFPTRDDYDAHDALMAVAHNAIVSDDSRF 255

Query: 247  RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFI--EKECDDIQ 304
            R+TPDHYLK+R+EM  +F+DLPEALENT+EIARRCSF+L+   PILPRF     + ++ +
Sbjct: 256  RLTPDHYLKSRAEMAKLFADLPEALENTIEIARRCSFVLKTRKPILPRFTGATDDAEEAE 315

Query: 305  KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
            + E  ELR +AV GL++RL+   ++ GY  +DYR+RL+FEL+VI RM+F GYFLIVADFI
Sbjct: 316  RAEAGELRRQAVEGLDMRLSTLGMSPGYEEKDYRERLEFELSVIERMRFPGYFLIVADFI 375

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
            +WAK+++IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNP+R+SMPDFDIDFCQ
Sbjct: 376  KWAKQHDIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPERVSMPDFDIDFCQ 435

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            DRR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL+PN+PA
Sbjct: 436  DRREEVIRYVQAKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKLVPNNPA 495

Query: 485  HPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
            +P    +AI ++ + +E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLS+LV
Sbjct: 496  NPTPLSKAIEEEPKLQEEAAKEPVVARLLDIAQKIEGLYRHASTHAAGIVIGDRPLSKLV 555

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPF 603
            PMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++DF+A+RG+ VDL+ IP 
Sbjct: 556  PMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKVAVDFVAKRGISVDLAAIPL 615

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNN 663
            DD +TY +L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI  YN 
Sbjct: 616  DDKKTYEMLSRGETVGVFQVESAGMRKALIGMKPDCIEDIIALVALYRPGPMENIPTYNA 675

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G E++ SIHP+ID +LKETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKIK 
Sbjct: 676  RKHGDEELESIHPMIDHLLKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIKA 735

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
            EMD+Q+ERF+ GA KNG+SK  A NIFELLAKFA+YGFNKSHAAAYA++SYQTA+MK HY
Sbjct: 736  EMDQQRERFVDGAVKNGVSKPQADNIFELLAKFANYGFNKSHAAAYAIVSYQTAYMKAHY 795

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEFLAASMTL+M N EK+  F QDA++  I+++ PSV T    F+ GDNRIYY+LAA+K
Sbjct: 796  PVEFLAASMTLDMSNTEKVNDFRQDAKRLGIEVIAPSVQTSFRQFETGDNRIYYALAALK 855

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
            GVG +   HI+E   D PF  +EDFC R+D +++NRRVLESL++AGA DCFG  R QL  
Sbjct: 856  GVGESAVDHIVEVRGDTPFAGIEDFCLRIDPRQVNRRVLESLIYAGAFDCFGTDRAQLSA 915

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
             LD I  YAQ  ++N+ +   +IF     +  +KI L  FS   +S R   E +VLGFY 
Sbjct: 916  GLDRILGYAQRAQENKLSGQSDIFGSTLTSGPEKIALPPFSPWLASERLLKEFQVLGFYL 975

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIRG--NNIRLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            + HPLD Y  IL+KM ++ + E  A I+   +N RLA  V+SKQ++KTR G+++G + FS
Sbjct: 976  TAHPLDSYSNILQKMRVQTFAEFSAAIKQGASNARLAGTVISKQERKTRTGNKMGIIVFS 1035

Query: 1022 EPAKEYEANFF 1032
            + + ++EA  F
Sbjct: 1036 DSSGQFEAVLF 1046


>gi|153009730|ref|YP_001370945.1| DNA polymerase III subunit alpha [Ochrobactrum anthropi ATCC 49188]
 gi|151561618|gb|ABS15116.1| DNA polymerase III, alpha subunit [Ochrobactrum anthropi ATCC 49188]
          Length = 1163

 Score =  815 bits (2106), Expect = 0.0,   Method: Composition-based stats.
 Identities = 594/1031 (57%), Positives = 772/1031 (74%), Gaps = 8/1031 (0%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   G+
Sbjct: 16   TPRFVHLRVHSAYSLLEGALPLGKIIKQAIADEAPAIAVTDTNNLFGALEFAQKASKDGL 75

Query: 68   QPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            QPIIGCQ+DI   D+        +     +  +VLL +T EGY  ++ LVSR +L     
Sbjct: 76   QPIIGCQVDIAFGDHNDNGRSVNRRVALDLAPVVLLAATEEGYANIVRLVSRAFLETPAG 135

Query: 127  QSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNL 186
              V +  SWL  + ++ +I+L+GG+ GPI RAF  +    AE RL   ++ FGDRLYV L
Sbjct: 136  DPVHVEASWLPPL-SKDVIVLSGGALGPIGRAFAADRPDRAEARLGFLREAFGDRLYVEL 194

Query: 187  QRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
            QR  GY+R  E++ V LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  DR 
Sbjct: 195  QRQAGYNRALEAKTVALAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDDRR 254

Query: 247  RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD--IQ 304
            R+TPDH++K+R+EM ++F+DLPEAL+NTVEIA RCS+  Q  APILPRF  +  D     
Sbjct: 255  RLTPDHHMKSRAEMAALFADLPEALDNTVEIAERCSWYTQTRAPILPRFTGESDDAEAAV 314

Query: 305  KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
            +EE +EL  +A  GL++RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVADFI
Sbjct: 315  QEEADELARQAREGLKMRLETVGLAEGYTTEQYAERLEYEIGIITRMKFPGYFLIVADFI 374

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
            +WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDFCQ
Sbjct: 375  KWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDFCQ 434

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            DRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +PA
Sbjct: 435  DRREEVIRYVQGKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQNPA 494

Query: 485  HPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
            +PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+LV
Sbjct: 495  NPVSLAQAIDTEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSELV 554

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPF 603
            PMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++  +A++GV++DLS +P 
Sbjct: 555  PMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLETAVKLVARKGVEIDLSHVPL 614

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNN 663
            DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD IEDIIALV+LYRPGP++NI  YN 
Sbjct: 615  DDELTYEMLSRGETVGVFQVESAGMRKALLGMRPDRIEDIIALVALYRPGPMENIPTYNA 674

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI+E
Sbjct: 675  RKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIRE 734

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
            EMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK HY
Sbjct: 735  EMDKQRVRFVDGAIEGGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKAHY 794

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEF+AASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAAIK
Sbjct: 795  PVEFIAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVMTSFRPFEVGEKQIFYSLAAIK 854

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
            GVG     HI++  A+KPF+SLEDFC RVD + +NRRVLESL+ AGA+DCFG  R  +  
Sbjct: 855  GVGEAAVDHIVDVRAEKPFESLEDFCERVDPRIVNRRVLESLINAGAMDCFGRERPAMSA 914

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
             +D I  +AQ  ++N  +   +IF    G   + + L + +    S     E + +GFY 
Sbjct: 915  GMDRIMGFAQRTQENAASGQSDIFG-LSGAPKETLILPQAAPWLPSEMLHREFQAVGFYL 973

Query: 964  SGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            S HPLD Y+ +L +M ++ + +   A  RG N  RLA  V ++Q++KTR G+++G V  S
Sbjct: 974  SAHPLDEYRDVLNRMRVQSWADFSAAVKRGANAGRLAGTVTARQERKTRTGNKMGIVQLS 1033

Query: 1022 EPAKEYEANFF 1032
            + + ++EA  F
Sbjct: 1034 DASGQFEAVLF 1044


>gi|330837734|ref|YP_004412375.1| DNA polymerase III, alpha subunit [Spirochaeta coccoides DSM 17374]
 gi|329749637|gb|AEC02993.1| DNA polymerase III, alpha subunit [Spirochaeta coccoides DSM 17374]
          Length = 1170

 Score =  815 bits (2105), Expect = 0.0,   Method: Composition-based stats.
 Identities = 394/1029 (38%), Positives = 603/1029 (58%), Gaps = 23/1029 (2%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL  H+ YSLL+GA S+   + K       A+AITD  N+F A +F +   AA I+
Sbjct: 2    SGFVHLHNHTDYSLLDGAGSIPKYIAKAKELGMNALAITDHGNMFGAHKFYKACKAADIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC+  +  + +     +G    P    ++LL    +GY  L+EL S  Y ++     
Sbjct: 62   PIIGCEFYVAPESHT--LREGVEGKPRAYHLILLAMNEKGYHNLMELNSISY-VEGFYYK 118

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLF-GDRLYVNLQ 187
             RI    L E   EG++ L+    G I      N  + A+K  L    +F G R Y+ +Q
Sbjct: 119  PRIDHE-LIEQHNEGVLCLSACLGGEIASLLKDNRYEDAKKAALWHASVFDGGRYYLEIQ 177

Query: 188  RHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
             H   ++      + +L+    +PLVATN+  ++++ D  AHD+L+ +      ++ DR 
Sbjct: 178  DHGLPEQKTVNQALARLSTETGIPLVATNDIHYINKSDANAHDILLCIGMGKKKNEADRM 237

Query: 247  R-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
            R  + ++Y+K+  EM   F   P+A+ENTV+IA  C+  +    P LPRF   +      
Sbjct: 238  RFHSAEYYMKSAEEMEKQFLWCPQAVENTVKIADLCNLEIHFPGPRLPRFRVPKGF---- 293

Query: 306  EEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
             +++ LR+ +  GL  R A+          D  +RLD+EL+VI +M F GYFLIV D+I 
Sbjct: 294  TDDSYLRHLSHEGLARRYAE-------VTPDLEKRLDYELDVIIQMGFQGYFLIVRDYIY 346

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            WAK+ +IPVGPGRGSGAGS+ AY   ITD+DP++++LLFERFLNP+R +MPDFDIDFC +
Sbjct: 347  WAKQRDIPVGPGRGSGAGSLVAYCTEITDVDPIKYNLLFERFLNPERKTMPDFDIDFCFE 406

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
             R EVI YV   YG + VAQI TFG+L+AKA ++DV R L +P+ + +R+ K+IP+DP  
Sbjct: 407  HRQEVIEYVTEHYGEDHVAQIATFGTLKAKAVVKDVARVLDIPFEESNRIAKMIPDDPKM 466

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
             +    +      ++   A      L + + +LEGL RH STHAAG+VIG++ L   VP+
Sbjct: 467  TLKKA-LEQSPELKQVADAGGIYGELFDAAFRLEGLNRHTSTHAAGVVIGEKKLLTYVPL 525

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDD 605
            YRD ++    TQF M  +E+ GL+K D LGLKTLTL++ ++D + +      +  I  +D
Sbjct: 526  YRDAKTGAISTQFTMDQLEENGLVKMDLLGLKTLTLIKHTVDLVHKTNPGFSIEDINEED 585

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
             +T+ +L    +  +FQ ES+GM++ L    P+ IED++AL +LYRPGP+D I  +   K
Sbjct: 586  EKTFDMLRRGDSACVFQFESTGMQKILRDALPNSIEDLVALNALYRPGPMDYIPQFVESK 645

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            NG+  I   HP ++  LK T GVI+YQEQVM++AQ++ GY+L  AD+LRR M KK  EE+
Sbjct: 646  NGRMPITYAHPDLEETLKTTYGVIVYQEQVMKVAQIIGGYTLGAADILRRIMSKKKAEEL 705

Query: 726  DKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPV 785
              Q+ +F+ GA   G  + +A  IF++L  FA YGFNKSHA AY+VI+YQTA++K +YP 
Sbjct: 706  AAQEVKFVEGALAKGYQEKLARYIFKMLEPFAGYGFNKSHAVAYSVIAYQTAFLKANYPA 765

Query: 786  EFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGV 845
            EF+AA++T E++N +K  ++ ++A+   I+++PPS+N     F   + +I Y LA IK V
Sbjct: 766  EFMAANLTNEINNPDKFSEYLREAKHMGIEVLPPSINYSERQFNAVEGKIVYGLAGIKNV 825

Query: 846  GTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQS 904
            G   A  I+       P++S  DF  RVDS+ +N ++LESL+ AG  D    +R  L+++
Sbjct: 826  GEGVADLIIRERNEHGPYESFIDFLVRVDSRAMNSKLLESLIKAGTFDSMEENRPTLIEN 885

Query: 905  LDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFS 964
            ++    YAQ  ++++ +   ++F   +G   D  T+ +        + E E+ +LGFY S
Sbjct: 886  MEAAVIYAQKQKESKESGQSSLF---EGDDIDSFTMTRHPDWEMREKLEIEKALLGFYIS 942

Query: 965  GHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPA 1024
            GHPLD+Y+   ++  +  +       R   I L AM+   +   T+K + +G++   + +
Sbjct: 943  GHPLDLYRDAWKRSVLVDFSRPERFPRNRQISLVAMITDIRTLMTKKQTMMGFLELVDFS 1002

Query: 1025 KEYEANFFP 1033
               EA  FP
Sbjct: 1003 GTLEATCFP 1011


>gi|222148298|ref|YP_002549255.1| DNA polymerase III subunit alpha [Agrobacterium vitis S4]
 gi|221735286|gb|ACM36249.1| DNA polymerase III alpha chain [Agrobacterium vitis S4]
          Length = 1179

 Score =  815 bits (2105), Expect = 0.0,   Method: Composition-based stats.
 Identities = 643/1029 (62%), Positives = 793/1029 (77%), Gaps = 6/1029 (0%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
            P FVHL+VHS+YSLLEGAL L  IL K+A+DQQPAIAITDTNNLF ALEFSQKA + G+Q
Sbjct: 33   PGFVHLRVHSAYSLLEGALPLKKILSKVASDQQPAIAITDTNNLFIALEFSQKALSDGLQ 92

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGCQL IDM+D  +   +G +     P+IVLL +   GY+RL++LVSR YL     QS
Sbjct: 93   PIIGCQLSIDMEDANE-EKRGNSSLAKYPAIVLLAADPAGYERLVDLVSRAYLQGDNTQS 151

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
            V I  SWL+EIGT+GLI LTG + GP+D          A  RL T K LFGDRLY+ LQR
Sbjct: 152  VHITASWLEEIGTDGLIALTGATGGPVDLPVKDGHHAQALSRLQTLKSLFGDRLYIELQR 211

Query: 189  HRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
            H+GYDR  ES+++ LAY H++PLVATN + F S +DY+AHD LMAVAH+ +VS   R R+
Sbjct: 212  HQGYDRVHESRMIALAYDHDIPLVATNEAFFPSRDDYDAHDALMAVAHNAIVSDDRRFRL 271

Query: 249  TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEE 308
            TPDHYLK+R EM ++F DLPEALENTVEIA RCSF+L    PILPRF     D  + E  
Sbjct: 272  TPDHYLKSRKEMQTLFRDLPEALENTVEIASRCSFVLDTRNPILPRFTGGSDDPEEAERA 331

Query: 309  NE--LRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                LR +A+ GL+ RLA+  +A GY  ++YR RLDFEL VI RMKF GYFLIVADFI+W
Sbjct: 332  EAGELRRQAIEGLDDRLAKLGMAPGYDEKEYRDRLDFELGVIERMKFPGYFLIVADFIKW 391

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK  +IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNP+R+SMPDFDIDFCQDR
Sbjct: 392  AKSQDIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPERVSMPDFDIDFCQDR 451

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVDR+CKL+PN+PA+P
Sbjct: 452  REEVIRYVQRKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDRICKLVPNNPANP 511

Query: 487  VS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
                +AI ++ +F+E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLS+LVPM
Sbjct: 512  TPLSKAIEEEPKFQEEAEKEPVVARLLDIAQKIEGLYRHASTHAAGIVIGDRPLSKLVPM 571

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDD 605
            YRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++DF   R +++DL+ IP DD
Sbjct: 572  YRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKTAVDFCRLRDIEIDLATIPLDD 631

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
             +TY +L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI VYN RK
Sbjct: 632  EKTYQMLSRGETVGVFQVESAGMRKALIGMRPDCIEDIIALVALYRPGPMENIPVYNARK 691

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            +G+E+I SIHP ID +LKETQGVI+YQEQVMQ+AQ+LSGYSL EAD+LRRAMGKKIKEEM
Sbjct: 692  HGEEEIESIHPTIDYLLKETQGVIVYQEQVMQVAQVLSGYSLGEADLLRRAMGKKIKEEM 751

Query: 726  DKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPV 785
            DKQ+ RF+ GA KNG+SK  A NIF+LLAKFA+YGFNKSHAAAYA++SYQTA+MK HYPV
Sbjct: 752  DKQRARFVDGAVKNGVSKPQADNIFDLLAKFANYGFNKSHAAAYAIVSYQTAYMKAHYPV 811

Query: 786  EFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGV 845
            EFLAASMTL+M N EK+  F QDA +  I+++PPSV T    F+ G NRIYYSLAA+KGV
Sbjct: 812  EFLAASMTLDMANTEKLVDFRQDAGRLGIEVVPPSVQTSFRHFQTGPNRIYYSLAALKGV 871

Query: 846  GTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSL 905
            G     HI+    D PF  LEDFC R+D K++NRRV ESL+FAGA DCFG  R +LL  +
Sbjct: 872  GDAAVEHIVTVRGDTPFADLEDFCLRIDPKQINRRVFESLIFAGAFDCFGRDRPELLAGM 931

Query: 906  DNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSG 965
            D I  YAQ  ++N  +   ++F     T  ++I+   ++    S +   E +VLGFY S 
Sbjct: 932  DRIIGYAQRAQENAVSGQSDMFGSGGATGPERISFPTYTPWLPSEKLMREFQVLGFYLSA 991

Query: 966  HPLDVYKPILRKMGIKGYEESV-ATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVTFSEP 1023
            HPLD YKP+L KM ++ + +   A  +G    RLA  V+SKQ++KTR G+++G VTFS+ 
Sbjct: 992  HPLDTYKPLLEKMRVQNFVDFSGAVRQGATAGRLAGTVISKQERKTRTGNKMGIVTFSDA 1051

Query: 1024 AKEYEANFF 1032
              ++EA  F
Sbjct: 1052 TGQFEAVLF 1060


>gi|302337842|ref|YP_003803048.1| DNA polymerase III subunit alpha [Spirochaeta smaragdinae DSM 11293]
 gi|301635027|gb|ADK80454.1| DNA polymerase III, alpha subunit [Spirochaeta smaragdinae DSM 11293]
          Length = 1141

 Score =  815 bits (2105), Expect = 0.0,   Method: Composition-based stats.
 Identities = 405/1029 (39%), Positives = 603/1029 (58%), Gaps = 20/1029 (1%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
            P FVHL  H+ YSLL+GA  ++ +++K  +     +AITD  N+F  L F +   A  I 
Sbjct: 2    PDFVHLHNHTDYSLLDGAAPIDKMVEKAVSFGMKHLAITDHGNMFGVLRFYKACKAHEIN 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            P+IGC++ +           G         +VLL   +EGY+ LI+L SR Y  +     
Sbjct: 62   PLIGCEVYVAPGSRHVKN--GSEKGNRYQHLVLLARNSEGYKNLIQLCSRGYT-EGFYYK 118

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQ 187
             RI    L++    GL  L+   +G I        ++ AE++   +++LFG +  ++ +Q
Sbjct: 119  PRIDDELLEQY-NGGLTALSACLAGAIPSMIMNGKAEEAEQKANYYRELFGKEHFFLEMQ 177

Query: 188  RHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
             H   ++     ++V+++    +PLVATN+  +L   D  A D+L+ +  +    ++DR 
Sbjct: 178  DHGIPEQKTVNKELVRISKKTGIPLVATNDIHYLDRADASAQDILLCIGTNRKRREQDRM 237

Query: 247  R-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
            R  +   Y+K++ EM   F ++PEAL NT+ +A +C+  + +  PILP +         +
Sbjct: 238  RFHSDQFYMKSQEEMAETFREIPEALSNTLRVAEQCNLEIDLPGPILPEYEIP---PEFE 294

Query: 306  EEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
               + LR+    GL+ R             +  QR + EL +I  M F GYFLIV DFI 
Sbjct: 295  NLGDYLRHLTFEGLKKRYP-------SLTDEIVQRAEKELGIINSMHFPGYFLIVWDFIH 347

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            +AK+++IPVGPGRGSGAGS+ AYALTITDIDPL++ LLFERFLNP+R+SMPDFD+DFC +
Sbjct: 348  YAKQHDIPVGPGRGSGAGSIVAYALTITDIDPLKYQLLFERFLNPERVSMPDFDVDFCFE 407

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RR EVI YV  KYG ++V QIITFG+L+AKA ++DV R L +P+++ D++ KLIPND   
Sbjct: 408  RRQEVIDYVNRKYGKDKVGQIITFGTLKAKAVVKDVARVLDIPFAEADKISKLIPNDLKI 467

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
             +    +  + + +E          L++ +++LEGL RHASTHAAG+VIG + L++ VP+
Sbjct: 468  TIDKA-LEQEPQLKELMDQGGVYGELIDAARRLEGLSRHASTHAAGVVIGRKALTEYVPL 526

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDD 605
            YRD ++    TQF M  +E+ GL+K DFLGLKTLTL++ + D + +R    D+  +P DD
Sbjct: 527  YRDSKTGSISTQFTMDQLEECGLVKMDFLGLKTLTLIKHTEDLIHRRDKDFDIERVPEDD 586

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
              T+ LL    +  +FQ ESSGM+  L+   P  IED+IAL +LYRPGP+  I  Y   K
Sbjct: 587  PATFTLLGEGKSTCVFQFESSGMQNILKQAHPTSIEDLIALNALYRPGPMQYIPQYIASK 646

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            +G+++I    P ++ +LK T GVI+YQEQVMQ+AQ++ G+SL +AD+LRRAMGKK  +EM
Sbjct: 647  SGEQEIRYPDPSLEEVLKPTYGVIVYQEQVMQVAQIIGGFSLGKADILRRAMGKKKVKEM 706

Query: 726  DKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPV 785
             K K  FI GA K G +K  A  IFE+L  FA YGFNKSHAAAY+V++Y+TA++K +YP 
Sbjct: 707  AKMKLEFIEGAVKKGHTKEHADEIFEMLVPFAGYGFNKSHAAAYSVVAYKTAYLKANYPA 766

Query: 786  EFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGV 845
            EF+AA++T E++N +K+  +  +A+   I ++PP VN    +F V D +I Y L  IK V
Sbjct: 767  EFMAANLTNEINNPDKLAFYIGEAKTMGIDLLPPEVNISEKNFSVSDGKIVYGLIGIKNV 826

Query: 846  GTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQS 904
            GT     I+ A  +  PF+ + D   RVD K +NR+VLE+L+  GALD FG +R  LL++
Sbjct: 827  GTNAVEEIVRAREEGGPFEDIFDLLDRVDMKTVNRKVLETLIECGALDSFGINRSTLLEN 886

Query: 905  LDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFSVENSSVRFENEQRVLGFYF 963
            L+ + +     ++       ++F          K  L              E+ +LGFYF
Sbjct: 887  LERVMEVVSKKKEGEQFGQSSLFDDGNEEEMPWKTDLTPAEPLPKMEVLRRERELLGFYF 946

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEP 1023
            SGHP+D +K   +             I      L AMV S +   T+KG  + ++   + 
Sbjct: 947  SGHPMDDFKDRWKSAVNIDLSRPDRFIPERTYTLIAMVTSLRTIITKKGRPMAFLQLEDY 1006

Query: 1024 AKEYEANFF 1032
              + E+  F
Sbjct: 1007 NGKIESVVF 1015


>gi|206602357|gb|EDZ38838.1| DNA polymerase III, alpha subunit [Leptospirillum sp. Group II '5-way
            CG']
          Length = 1201

 Score =  814 bits (2102), Expect = 0.0,   Method: Composition-based stats.
 Identities = 414/1045 (39%), Positives = 611/1045 (58%), Gaps = 21/1045 (2%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +  +  FVHL VH+ YSLL+GA  ++ ++ K  A+  PAIA+TD  NLF A+EF Q A  
Sbjct: 1    MSSTDQFVHLHVHTQYSLLDGANKIDPLIRKARAENMPAIAMTDHGNLFGAIEFFQTAKK 60

Query: 65   AGIQPIIGCQLDIDMQDNLKM---------TNQGKTPFPTVPSIVLLVSTAEGYQRLIEL 115
             G++PIIGC++ I  +               +QG+        ++LL     GY+ L+++
Sbjct: 61   HGVKPIIGCEVYITPRSRFDRSDLYFGGDGPHQGRKINNASFHLILLAENDTGYRNLLKI 120

Query: 116  VSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFK 175
            VS  +L +      RI L  L     EGLI L+G   G I        +  A      F+
Sbjct: 121  VSLSHL-EGFYYRPRIDLELLSRYH-EGLIALSGCLKGQISYMLTRGDTDRAYATAGLFR 178

Query: 176  KLFG-DRLYVNLQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMA 233
            ++FG +  +  +Q +   D+     +++ L+    +PLVATN+  +L  ED   HD+L+ 
Sbjct: 179  EIFGPENYFFEVQANGLEDQRIANREIIGLSKKLSIPLVATNDCHYLEREDSVPHDILLC 238

Query: 234  VAHSTVVSQKDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPIL 292
            +     +    R R  + + YLK   EM+  F +LPEA+ENT+ IA R    + +    +
Sbjct: 239  LQTGKTLEDPARLRFGSDEFYLKTPREMIRSFEELPEAIENTLRIAERIDVSIDLQTTHM 298

Query: 293  PRFIEKECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMK 352
            P +   E               +  GL+ R  + A +       Y +RL+ E+ VI +M 
Sbjct: 299  PSYRLDEIQGQTTTVPELFVRTSREGLDARFLENAFSDAEKT-LYLERLEREIQVIQKMG 357

Query: 353  FSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDR 412
            + GYFLIV DFI+ A++  IPVGPGRGS AGSV A++L IT+IDP+RF LLFERFLNP+R
Sbjct: 358  YEGYFLIVWDFIRKAREMGIPVGPGRGSAAGSVVAWSLRITNIDPIRFGLLFERFLNPER 417

Query: 413  MSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQV 472
            +S+PD D+DFC +RR EVI+YV ++YG +RVA I TFG++ AK ++RDVGR L M Y++V
Sbjct: 418  VSLPDIDVDFCMNRRGEVIQYVVDRYGMDRVAMIATFGTMGAKGSIRDVGRVLGMTYAEV 477

Query: 473  DRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGI 532
            DR+ K+IPN     +    + ++   R     DP ++ L  +S+KLEG+ RH+S HAAG+
Sbjct: 478  DRVAKMIPNSLDMTLEKA-LEENPDLRSLLEKDPRMEELFSLSRKLEGITRHSSIHAAGV 536

Query: 533  VIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR 592
            VI   PL + VP+ +   +   VTQF    +EK GL+KFDFLGL TLTL+  + + +   
Sbjct: 537  VISREPLLEHVPLMKGA-NGEIVTQFTKDDVEKVGLVKFDFLGLTTLTLIHGAENRIRAH 595

Query: 593  GVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRP 652
                    IP DD  TY LL+   TLGIFQLES GM   +  MQP+  ED+IAL++LYRP
Sbjct: 596  TPDFSADRIPLDDPRTYRLLSEGKTLGIFQLESRGMTDLIMKMQPETFEDLIALLALYRP 655

Query: 653  GPIDNIV--VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEA 710
            GPI++ +   +  RK    +I    P ++P+L+ET GVI+YQEQVMQIA +L+G+SL EA
Sbjct: 656  GPINSGMVDDFIKRKKNPREIRYELPELEPVLRETYGVIVYQEQVMQIANVLAGFSLGEA 715

Query: 711  DVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYA 770
            D+LRRAMGKK  EEM K +++F+ GA + G  K  A ++FEL+A FA YGFNKSH+AAYA
Sbjct: 716  DLLRRAMGKKKPEEMAKMQDKFVEGAVRKGFPKEKATHVFELMAYFAGYGFNKSHSAAYA 775

Query: 771  VISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKV 830
            +ISYQTA++KTHYP+E  AA +T  +D+ EKI  F   A+   I+++ P +N    DF +
Sbjct: 776  LISYQTAYLKTHYPLELWAALLTNALDDTEKIGVFLAGAKDMGIEVLAPDINQSEFDFAI 835

Query: 831  -GDNRIYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFA 888
               +RI + L A+K VG      I+EA A D PF    DF  R+  KK+NRRV+E+L+ A
Sbjct: 836  LPGSRILFGLGAVKNVGKQAVDCILEARAQDGPFTDFPDFLKRIVGKKVNRRVIEALIRA 895

Query: 889  GALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENS 948
            GA    G  R   ++SLD++  +A+  +  + +  +++F+ ++G  S    L +    + 
Sbjct: 896  GAFRSLGIRRAVAMESLDDLLAWAEKQKSGKGSMQKSLFSEDQGGRSFGPPLREVPEWDE 955

Query: 949  SVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKK 1008
             +    E+  LGFY + HP+  Y  +L K+  +      A   G  +R+ A+V + ++ K
Sbjct: 956  RMLLREEKNALGFYLTSHPMARYADLLLKLDTRSTRSLEAISEGETVRVFAVVSALREVK 1015

Query: 1009 TRKGSRIGWVTFSEPAKEYEANFFP 1033
            T+KG ++  +T  +     EA  FP
Sbjct: 1016 TKKGDKMAQLTLLDMEGTIEAVLFP 1040


>gi|291086960|ref|ZP_06345005.2| DNA polymerase III alpha subunit [Clostridium sp. M62/1]
 gi|291076483|gb|EFE13847.1| DNA polymerase III alpha subunit [Clostridium sp. M62/1]
          Length = 1197

 Score =  814 bits (2102), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/1054 (36%), Positives = 579/1054 (54%), Gaps = 45/1054 (4%)

Query: 3    QYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKA 62
            +Y+    +F HL VH+ YSLL+ +  +  ++ +       ++AITD   ++  ++F + A
Sbjct: 37   EYM----AFTHLHVHTEYSLLDASSKIKELVARAKELGMDSLAITDHGVMYGVIDFYRAA 92

Query: 63   CAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLL 122
              AGI+P++GC++ +          +          ++LL    EGYQ L+++VS  + +
Sbjct: 93   REAGIKPVLGCEIYVAPGSRFDR--EIGAGEDKYYHLILLAENNEGYQNLMKIVSTGF-V 149

Query: 123  DQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-R 181
            +      R+    L+     GLI L+   +G + R       +  +K  L ++ +FG+  
Sbjct: 150  EGFYYKPRVDFETLERYSR-GLICLSACLAGEVQRNLARGMYEEGKKAALRYQSIFGEGN 208

Query: 182  LYVNLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVV 240
             ++ LQ H    +      +++++    +PLVATN+  ++  ED ++HD+L+ +     V
Sbjct: 209  FFLELQDHGIPLQKTVNQGLLRMSQDTGIPLVATNDCHYIYREDEKSHDILLCIQTGKKV 268

Query: 241  SQKDRPRVT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKE 299
            + ++R R     +YLK+  EM SIF    EALENT +IA RC+  ++     +P+F    
Sbjct: 269  ADENRMRYEGGQYYLKSEEEMKSIFPYALEALENTHKIAERCNVEIEFGVTKIPQFDVPG 328

Query: 300  CDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
                 K     L      G   R               R+RLD+EL+VI  M +  YFLI
Sbjct: 329  G----KTSWEYLNELCEEGFRTRYPDDDGTL-------RKRLDYELSVIQSMGYVDYFLI 377

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V DFI +A+ ++I VGPGRGS AGS+ +Y L ITDIDP+R++LLFERFLNP+R+SMPD D
Sbjct: 378  VWDFIHFARSHDIMVGPGRGSAAGSIVSYCLRITDIDPIRYNLLFERFLNPERVSMPDID 437

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            IDFC +RR EVI YV  KYG +RV QI+TFG+L AK  +RDVGR L MPY++ D + K+I
Sbjct: 438  IDFCFERRQEVIDYVVQKYGRDRVVQIVTFGTLAAKGVVRDVGRVLDMPYAKCDAVAKMI 497

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P D    +           REA  +DP +  L+++S++LEGL RH S HAAG+VI    +
Sbjct: 498  PGDLGMTLDKAL--KTPELREAYDSDPEIKYLIDMSRRLEGLPRHTSMHAAGVVISRNKV 555

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDL 598
             + VP+ R        TQF M  +E+ GL+K DFLGL+TLT++Q ++    +   +K+DL
Sbjct: 556  DEYVPLSRAA-DGSITTQFTMTTLEELGLLKMDFLGLRTLTVIQNAVRQAEKTHHIKIDL 614

Query: 599  SLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNI 658
            + I ++D      L T    G+FQLESSGM+  ++ ++P+ +EDIIA +SLYRPGP+D I
Sbjct: 615  NKIDYNDKAVLESLGTGKNDGVFQLESSGMKSFMKELKPENLEDIIAGISLYRPGPMDFI 674

Query: 659  VVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMG 718
              Y   KN +  I    P ++P+L  T G I+YQEQVMQI + L+GY+L  +D++RRAM 
Sbjct: 675  PKYLKGKNDRASITYDCPQLEPILSPTYGCIVYQEQVMQIVRDLAGYTLGRSDLVRRAMS 734

Query: 719  KKIKEEMDKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYA 770
            KK    M+K+++ F+         G   NGI +  A  I++ +  FA Y FNKSHAAAYA
Sbjct: 735  KKKAAVMEKERQNFVYGNPEEGVKGCIANGIDEKTANIIYDEMIDFAKYAFNKSHAAAYA 794

Query: 771  VISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKV 830
            V+SYQTA++K +YPVEF+AA MT   DNV K+ ++    RQ  ++IMPP +N     F V
Sbjct: 795  VVSYQTAYLKYYYPVEFMAALMTSVKDNVSKVSEYILTCRQMGMKIMPPDINEGEGGFSV 854

Query: 831  GDNRIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAG 889
             +  I Y L+A+K +G T    I++      PF SL DF  R+ +K++N+R +ES + +G
Sbjct: 855  SNGAIRYGLSALKSIGQTVVDEIVKERTERGPFVSLADFIDRMSNKEVNKRTIESFIKSG 914

Query: 890  ALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVEN 947
            ALD    +R Q       + +     +KN      ++F    E+     +IT        
Sbjct: 915  ALDSLPGTRKQKFLVSAALLEQKNKEKKNSMEGQMSLFDFVEEEEKEQFQITFPDVGEYT 974

Query: 948  SSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEES--------VATIRGNNIRLAA 999
                   E+ +LG Y SGHPL+ Y  + +K       +              G+ + +  
Sbjct: 975  KEELLAFEKEMLGVYVSGHPLEEYMDLWKKNVTAVSSDFIVDEEEGHAKVRDGSYVTIGG 1034

Query: 1000 MVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            M+  K  K TR+   + ++T  + A   E   FP
Sbjct: 1035 MITEKTVKTTRQNKMMAFITVEDLAGTVEVLIFP 1068


>gi|295091058|emb|CBK77165.1| DNA polymerase III catalytic subunit, DnaE type [Clostridium cf.
            saccharolyticum K10]
          Length = 1159

 Score =  814 bits (2102), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/1047 (36%), Positives = 576/1047 (55%), Gaps = 41/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            +F HL VH+ YSLL+ +  +  ++ +       ++AITD   ++  ++F + A  AGI+P
Sbjct: 2    AFTHLHVHTEYSLLDASSKIKELVARAKELGMDSLAITDHGVMYGVIDFYRAAREAGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            ++GC++ +          +          ++LL    EGYQ L+++VS  + ++      
Sbjct: 62   VLGCEIYVAPGSRFDR--EIGAGEDKYYHLILLAENNEGYQNLMKIVSTGF-VEGFYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYVNLQR 188
            R+    L+     GLI L+   +G + R       +  +K  L ++ +FG+   ++ LQ 
Sbjct: 119  RVDFETLERYSR-GLICLSACLAGEVQRNLARGMYEEGKKAALRYQSIFGEGNFFLELQD 177

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H    +      +++++    +PLVATN+  ++  ED ++HD+L+ +     V+ ++R R
Sbjct: 178  HGIPLQKTVNQGLLRMSQDTGIPLVATNDCHYIYREDEKSHDILLCIQTGKKVADENRMR 237

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +YLK+  EM SIF    EALENT +IA RC+  ++     +P+F         K 
Sbjct: 238  YEGGQYYLKSEEEMKSIFPYALEALENTHKIAERCNVEIEFGVTKIPQFDVPGG----KT 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                L      G   R               R+RLD+EL+VI  M +  YFLIV DFI +
Sbjct: 294  SWEYLNELCEEGFRTRYPDDDGTL-------RKRLDYELSVIQSMGYVDYFLIVWDFIHF 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+ ++I VGPGRGS AGS+ +Y L ITDIDP+R++LLFERFLNP+R+SMPD DIDFC +R
Sbjct: 347  ARSHDIMVGPGRGSAAGSIVSYCLRITDIDPIRYNLLFERFLNPERVSMPDIDIDFCFER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG +RV QI+TFG+L AK  +RDVGR L MPY++ D + K+IP D    
Sbjct: 407  RQEVIDYVVQKYGRDRVVQIVTFGTLAAKGVVRDVGRVLDMPYAKCDAVAKMIPGDLGMT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +           REA  +DP +  L+++S++LEGL RH S HAAG+VI    + + VP+ 
Sbjct: 467  LDKAL--KTPELREAYDSDPEIKYLIDMSRRLEGLPRHTSMHAAGVVISRNKVDEYVPLS 524

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDD 605
            R        TQF M  +E+ GL+K DFLGL+TLT++Q ++    +   +K+DL+ I ++D
Sbjct: 525  RAA-DGSITTQFTMTTLEELGLLKMDFLGLRTLTVIQNAVRQAEKTHHIKIDLNKIDYND 583

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
                  L T    G+FQLESSGM+  ++ ++P+ +EDIIA +SLYRPGP+D I  Y   K
Sbjct: 584  KAVLESLGTGKNDGVFQLESSGMKSFMKELKPENLEDIIAGISLYRPGPMDFIPKYLKGK 643

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            N +  I    P ++P+L  T G I+YQEQVMQI + L+GY+L  +D++RRAM KK    M
Sbjct: 644  NDRASITYDCPQLEPILSPTYGCIVYQEQVMQIVRDLAGYTLGRSDLVRRAMSKKKAAVM 703

Query: 726  DKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            +K+++ F+         G   NGI +  A  I++ +  FA Y FNKSHAAAYAV+SYQTA
Sbjct: 704  EKERQNFVYGNPEEGVKGCIANGIDEKTANTIYDEMIDFAKYAFNKSHAAAYAVVSYQTA 763

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            ++K +YPVEF+AA MT   DNV K+ ++    RQ  ++IMPP +N     F V +  I Y
Sbjct: 764  YLKYYYPVEFMAALMTSVKDNVSKVSEYILTCRQMGMKIMPPDINEGEGGFSVSNGAIRY 823

Query: 838  SLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
             L+A+K +G T    I++      PF SL DF  R+ +K++N+R +ES + +GALD    
Sbjct: 824  GLSALKSIGQTVVDEIVKERTERGPFVSLADFIDRMSNKEVNKRTIESFIKSGALDSLPG 883

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFEN 954
            +R Q       + +     +KN      ++F    E+     +IT               
Sbjct: 884  TRKQKFLVSAALLEQKNKEKKNSMEGQMSLFDFVEEEEKEQFQITFPDVGEYTKEELLAF 943

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEES--------VATIRGNNIRLAAMVVSKQQ 1006
            E+ +LG Y SGHPL+ Y  + +K       +              G+ + +  M+  K  
Sbjct: 944  EKEMLGVYVSGHPLEEYMDLWKKNVTAVSSDFIVDEEEGHAKVRDGSYVTIGGMITEKTV 1003

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K TR+   + ++T  + A   E   FP
Sbjct: 1004 KTTRQNKMMAFITVEDLAGTVEVLIFP 1030


>gi|227821642|ref|YP_002825612.1| DNA polymerase III subunit alpha [Sinorhizobium fredii NGR234]
 gi|227340641|gb|ACP24859.1| DNA polymerase III, alpha subunit [Sinorhizobium fredii NGR234]
          Length = 1165

 Score =  814 bits (2102), Expect = 0.0,   Method: Composition-based stats.
 Identities = 645/1037 (62%), Positives = 799/1037 (77%), Gaps = 8/1037 (0%)

Query: 2    TQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQK 61
               ++  P FVHL+VHS++SLLEGAL L  I+ K  AD+QPAI I DTNNLF+ALEFSQK
Sbjct: 12   AGAMD--PQFVHLRVHSAFSLLEGALPLKKIIAKAVADEQPAIGIADTNNLFAALEFSQK 69

Query: 62   ACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPF-PTVPSIVLLVSTAEGYQRLIELVSRMY 120
            A   G+QPIIGCQL IDM+D  +   +        +PSIVL+ +T  GY RL++LVSR Y
Sbjct: 70   AADDGLQPIIGCQLSIDMEDEAEGERRSHAQQLAKLPSIVLIAATDAGYTRLVDLVSRAY 129

Query: 121  LLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD 180
            L  +G Q+VR+  SWL   GTEGLI LTG  SGP+D A     + +AE RL T  +LFGD
Sbjct: 130  LEGEGHQAVRVTRSWLAAGGTEGLIALTGAGSGPVDLALKAGLAALAEARLKTLVELFGD 189

Query: 181  RLYVNLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVV 240
            RLYV LQRH  YDR +E+++V LAY H++PLVATN + F S  DY+AHD LMAVAH+ VV
Sbjct: 190  RLYVELQRHGSYDRRQENRLVDLAYRHDIPLVATNEAFFPSPADYDAHDALMAVAHNAVV 249

Query: 241  SQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKEC 300
            S   R R+T DHYLK+R EM ++F+DLPEALENTVEIARRCSF+L+   PILPRF     
Sbjct: 250  SDDRRFRLTSDHYLKSRKEMAALFADLPEALENTVEIARRCSFMLKTRGPILPRFTGASD 309

Query: 301  DDIQKE--EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFL 358
            D ++ E  E  ELR +A  GLE RL++  +A GY  +DYR+RL FEL VI RMKF GYFL
Sbjct: 310  DPVEAERAESAELRRQAEEGLEQRLSRLGMAPGYKEEDYRERLAFELGVIERMKFPGYFL 369

Query: 359  IVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDF 418
            IVADFI+WAK+++IPVGPGRGSGAGS+ AYALTITD+DP+RFSLLFERFLNP+R+SMPDF
Sbjct: 370  IVADFIKWAKQHDIPVGPGRGSGAGSLVAYALTITDVDPMRFSLLFERFLNPERVSMPDF 429

Query: 419  DIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKL 478
            DIDFCQDRR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL
Sbjct: 430  DIDFCQDRREEVIRYVQQKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKL 489

Query: 479  IPNDPAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDR 537
            +PN+PA+P    +AI ++ R +E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDR
Sbjct: 490  VPNNPANPTPLSKAIEEEPRLQEEAEKEPVVGRLLDIAQKIEGLYRHASTHAAGIVIGDR 549

Query: 538  PLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVD 597
            PLSQLVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++DF+A+RG+ VD
Sbjct: 550  PLSQLVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKTAVDFVAKRGIAVD 609

Query: 598  LSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDN 657
            L+ IP DD +TY +L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++N
Sbjct: 610  LASIPLDDPKTYEILSRGETVGVFQVESAGMRKALIGMRPDCIEDIIALVALYRPGPMEN 669

Query: 658  IVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAM 717
            I VYN RK+G+E+I SIHP ID +LKETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAM
Sbjct: 670  IPVYNARKHGEEEIESIHPKIDHLLKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAM 729

Query: 718  GKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            GKKIKEEMDKQ+ RF+ GA  NG+ K  A  IF+LLAKFA+YGFNKSHAAAYA++SYQTA
Sbjct: 730  GKKIKEEMDKQRARFVEGAVGNGVVKPQADLIFDLLAKFANYGFNKSHAAAYAIVSYQTA 789

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            +MK HYPVEFLAASMTL+M N EKI  F QDA +  IQ++ PSV T    F+ GDNRIYY
Sbjct: 790  YMKAHYPVEFLAASMTLDMSNTEKINDFRQDAIRLGIQVIAPSVQTSFRLFETGDNRIYY 849

Query: 838  SLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            SLAAIKGVG +   HI+    D+PF SLEDFC R+D K LNRRV ESL+ AGA DCFGY 
Sbjct: 850  SLAAIKGVGESAVEHIVAVRGDRPFASLEDFCLRIDPKLLNRRVFESLIAAGAFDCFGYD 909

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQR 957
            R +L+  LD I  +AQ  ++N+ +   ++F     T  +KI L  ++   +S +   E +
Sbjct: 910  RAELIGGLDRILGFAQRAQENKLSGQSDMFGAGAATGPEKIALPVYTPWLASEKLHREFQ 969

Query: 958  VLGFYFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRI 1015
            VLGFY S HPLD Y  +L KM ++ + +   A  +G +  RLA  V SKQ++KTR G+++
Sbjct: 970  VLGFYLSAHPLDTYNKLLAKMRVQTFADFSAAVKKGASAGRLAGTVTSKQERKTRTGNKM 1029

Query: 1016 GWVTFSEPAKEYEANFF 1032
            G V FS+ + ++EA  F
Sbjct: 1030 GIVAFSDASGQFEAVLF 1046


>gi|260439212|ref|ZP_05793028.1| DNA polymerase III, alpha subunit [Butyrivibrio crossotus DSM 2876]
 gi|292808227|gb|EFF67432.1| DNA polymerase III, alpha subunit [Butyrivibrio crossotus DSM 2876]
          Length = 1155

 Score =  814 bits (2101), Expect = 0.0,   Method: Composition-based stats.
 Identities = 390/1047 (37%), Positives = 590/1047 (56%), Gaps = 40/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL VH+ YSLL+G+  +  I  +       ++AITD   ++  ++F + A   GI+P
Sbjct: 2    SFTHLHVHTEYSLLDGSGKIEEITARAKELGMDSLAITDHGVMYGVIDFYRAARNVGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +      +              ++LL     GY  L+++VS+ + +D      
Sbjct: 62   ILGCEVYVAPGSRFEKEP--GISDDRYYHLILLAENNTGYANLMKIVSKGF-VDGFYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L+E  +EG+I L+   +G + +    N  + A K  L ++ +FG    ++ LQ 
Sbjct: 119  RVDYEVLEEY-SEGIICLSACLAGEVQKLLARNLYEEACKAALKYEAIFGKGNYFLELQD 177

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H    +      +V+++    + LVATN+  +  E+D EAHD+L+ +     V+ +DR R
Sbjct: 178  HGIPTQKLVNRLLVRMSRELNIELVATNDVHYTYEDDAEAHDILLCIQTGKKVNDEDRMR 237

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +YLK+  EM  +FS  P+AL+NT +IA+RC+  ++     LP++   E       
Sbjct: 238  YEGGQYYLKSEEEMRELFSYAPQALDNTHKIAKRCNVEIEFGVTKLPKYDVPEGF----T 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
             E+ L +  + GL           G  A +  +RLD+EL+VI +M +  YFLIV DFI +
Sbjct: 294  SESYLEHLCMEGLVK-------RYGERAAELEERLDYELSVIKKMGYVDYFLIVWDFINY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK N I VGPGRGS AGS+ AY L ITDIDP++++L+FERFLNP+R+SMPD DIDFC +R
Sbjct: 347  AKSNGIAVGPGRGSAAGSIVAYCLEITDIDPIKYNLIFERFLNPERVSMPDIDIDFCYER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG +RV QI+TFG+L AK  ++DVGR L MPYS  D L K+IPN+    
Sbjct: 407  RPEVIDYVMKKYGKDRVVQIVTFGTLAAKGVIKDVGRVLDMPYSVTDSLSKMIPNEIGMT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  ++ FR     +P V  L++I ++LEGL RH S HAAG+VIG RPL + VP+ 
Sbjct: 467  LD-KALNANNEFRTRYETEPEVKYLIDICKRLEGLPRHTSMHAAGVVIGSRPLDEFVPLS 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-GVKVDLSLIPFDD 605
            R        TQF M  IE+ GL+K DFLGL+TLT++Q +   + +R  V  D+S I ++D
Sbjct: 526  RAS-DGTITTQFTMTTIEELGLLKMDFLGLRTLTVIQDAERLINKRGDVSFDISKIDYND 584

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
                 ++    T G+FQLES+GM+  ++ ++PD IED+IA +SLYRPGP+D I  Y   K
Sbjct: 585  RNVLEMIGQGKTEGVFQLESTGMKNFMKELKPDGIEDLIAGISLYRPGPMDFIPQYIAGK 644

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            N K  I      ++P+LKET G I+YQEQVMQI + L+GY+L  +D++RRAM KK +  M
Sbjct: 645  NDKTSITYACKELEPILKETYGCIVYQEQVMQIVRDLAGYTLGRSDLVRRAMSKKKQAVM 704

Query: 726  DKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            +K++  FI         G    GI +++A +I++ +  FA Y FNKSHAA YA ++++TA
Sbjct: 705  EKERHNFIYGNEEENVAGCIAKGIDESVASHIYDTMMDFAKYAFNKSHAACYAFVAFRTA 764

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFK-VGDNRIY 836
            ++K +YPVEF+AA MT  +DN  K+ ++    R   I+I+PP +N     F    D+ I 
Sbjct: 765  YLKYYYPVEFMAALMTSVLDNTTKVAQYIVTCRNMGIEILPPDINEGEGTFTAASDSSIR 824

Query: 837  YSLAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFG 895
            Y L+AIK +G      I+E  A+   F  ++DF SR+  K++N+R +ES + +GA D FG
Sbjct: 825  YGLSAIKSLGRPVIEAIVEERANGGRFKDIKDFISRLSGKEVNKRTVESFIKSGAFDSFG 884

Query: 896  YSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAH-EKGTFSDKITLEKFSVENSSVRFEN 954
             +R Q++    +I        K   +   ++F         D+IT+        S     
Sbjct: 885  LTRKQMMLVYGDIMDKVSSERKTEISGQMSLFDMFAPDEKPDEITIPDVGEYTKSELLAM 944

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVA--------TIRGNNIRLAAMVVSKQQ 1006
            E+ VLG Y SGHPLD Y+ +L K       + +               + +  M+     
Sbjct: 945  EKEVLGIYASGHPLDEYEGLLNKNVTCTTADFIPDDETGMPKVNDDERVIVGGMIAECSV 1004

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K TR+G  + ++   +     E   FP
Sbjct: 1005 KNTRQGQNMAFLKLEDRVGTVEVIVFP 1031


>gi|121602736|ref|YP_989159.1| DNA polymerase III subunit alpha [Bartonella bacilliformis KC583]
 gi|120614913|gb|ABM45514.1| DNA polymerase III, alpha subunit [Bartonella bacilliformis KC583]
          Length = 1161

 Score =  814 bits (2101), Expect = 0.0,   Method: Composition-based stats.
 Identities = 593/1029 (57%), Positives = 758/1029 (73%), Gaps = 7/1029 (0%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
            P F+HL+VHS+YSLLEGA+ +  I+    +D  PAIAITDTNNLF ALEFSQ   A GIQ
Sbjct: 16   PRFIHLRVHSAYSLLEGAIKIPQIVQHAVSDNAPAIAITDTNNLFGALEFSQYCFAEGIQ 75

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFP-TVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQ 127
            PIIGCQ+ ID  D    +   K  +P   PS+VL  ++  GY  L+ LVSR YL +    
Sbjct: 76   PIIGCQIAIDFGDKDDHSRLAKYHYPSDFPSVVLFAASKTGYACLVRLVSRAYLDEHNTN 135

Query: 128  SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQ 187
               I   WL    +EG+I LTGGS GPI+ A   +  + A +RL+  K++FGDRLY+ LQ
Sbjct: 136  FPHIKADWLLS-QSEGIIALTGGSGGPINLALAEDKKEWAIERLMDLKRIFGDRLYIELQ 194

Query: 188  RHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            RH  YDR  E++++ LAY H++PLVATN + FL+++ YEAHD LMAVA   VVS  +R R
Sbjct: 195  RHGSYDRKVEAELIDLAYVHQIPLVATNEAFFLNKKGYEAHDALMAVAEGQVVSNPNRKR 254

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD-DIQKE 306
            VTPDHYLK++ EMV++FSDLPEALEN+VEIA RC     + +PILPRF E+  D +   E
Sbjct: 255  VTPDHYLKSQDEMVTLFSDLPEALENSVEIALRCHAFTPMRSPILPRFTERSVDSNAALE 314

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
            E+ EL N+A  GL++RL    +A+GY   DY QRLD+E+ VI RM+FSGYFLIV+DFI+W
Sbjct: 315  EDKELINQAKDGLKIRLETIGLAEGYTLADYEQRLDYEIAVITRMQFSGYFLIVSDFIKW 374

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDFCQDR
Sbjct: 375  AKLHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRISMPDFDIDFCQDR 434

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R+EVI YVQ KYG ++VAQIITFG LQA+A LRDVGR L++PY QVD L KL+   P + 
Sbjct: 435  REEVIHYVQKKYGCDQVAQIITFGKLQARAVLRDVGRVLEVPYRQVDYLTKLVSATPGNN 494

Query: 487  VS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
            +   QAI D+ +F E    +P + R+L+I+ +LEGLYRHASTHAAGIVIGDRPLS+LVPM
Sbjct: 495  IELAQAIKDEPKFAEEAKKEPVIGRMLDIALQLEGLYRHASTHAAGIVIGDRPLSELVPM 554

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDD 605
            YRD RSD+PVTQFNMK++E+AGL+KFDFLGLKTLT+L+ ++DF+A++GVK+DLS I  +D
Sbjct: 555  YRDPRSDMPVTQFNMKYVEQAGLVKFDFLGLKTLTVLKMAVDFVARKGVKIDLSCISLND 614

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
             ETY +L    T+G+FQ+ES GMR+AL GM+PDCIEDIIALV+LYRPGP++NI  YN RK
Sbjct: 615  EETYAMLARGNTVGVFQVESPGMRKALIGMKPDCIEDIIALVALYRPGPMENIPTYNARK 674

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            +G+EKI SIHP ID ++KETQGVI+YQEQVMQIAQ LSGYSL EAD+LRRAMGKKI +EM
Sbjct: 675  HGQEKITSIHPKIDHLVKETQGVIVYQEQVMQIAQELSGYSLGEADLLRRAMGKKIHKEM 734

Query: 726  DKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPV 785
             KQ+ RF+SGA   GI K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK HYPV
Sbjct: 735  QKQRTRFVSGAVDRGIDKDQADMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKAHYPV 794

Query: 786  EFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGV 845
            EFLAASMT +M N +K+  F ++A +  IQ++ P V T    F++G+N IYYSL+AIKGV
Sbjct: 795  EFLAASMTYDMMNADKLNDFRREALRLEIQVIAPCVQTSHRIFEIGENCIYYSLSAIKGV 854

Query: 846  GTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSL 905
            G +   HI+    +KPF  LEDFC R+D + +N+R +ESL++AGA DCFG +R  LL SL
Sbjct: 855  GDSVVDHIVACRGNKPFKDLEDFCGRIDPRVINKRAMESLIYAGAFDCFGIAREVLLASL 914

Query: 906  DNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSG 965
            + +   A  +  N ++   +IF    G     I L + +  + + +  +E +V+GFYFS 
Sbjct: 915  ETLNARAIRIFDNNSSGQTDIFGMVDGPKEPFI-LSQATPWSLAEKLHHEFQVIGFYFSA 973

Query: 966  HPLDVYKPILRKMGIKGYEESVATIRG--NNIRLAAMVVSKQQKKTRKGSRIGWVTFSEP 1023
            HPLD Y+ IL K  ++ +      ++G     RLA  VV+KQ +KT+ G +IG + FS+ 
Sbjct: 974  HPLDEYQTILAKKRVQTWNNFSNAVKGGATAARLAGTVVTKQIRKTKSGKKIGIIQFSDT 1033

Query: 1024 AKEYEANFF 1032
            + +YE   F
Sbjct: 1034 SGQYETVMF 1042


>gi|190891309|ref|YP_001977851.1| DNA polymerase III protein, alpha subunit [Rhizobium etli CIAT 652]
 gi|190696588|gb|ACE90673.1| DNA polymerase III protein, alpha subunit [Rhizobium etli CIAT 652]
          Length = 1165

 Score =  814 bits (2101), Expect = 0.0,   Method: Composition-based stats.
 Identities = 642/1031 (62%), Positives = 809/1031 (78%), Gaps = 6/1031 (0%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            +P F+HL+VHS+YSLLEGAL L  IL K A D QPAIAITDTNNLF ALEFSQKA   G+
Sbjct: 16   TPGFIHLRVHSAYSLLEGALPLKKILYKAAGDNQPAIAITDTNNLFVALEFSQKAMDDGL 75

Query: 68   QPIIGCQLDIDMQDNLKMTNQGKT-PFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            QPIIGCQ+ IDM+D L+   +G       +PSIVLL +T  GY+RL++LVSR YL     
Sbjct: 76   QPIIGCQVSIDMEDGLETEKRGGQQALVKLPSIVLLAATEAGYERLVDLVSRAYLGGDSN 135

Query: 127  QSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNL 186
            Q++ I  SWL+E GTEGLI LTG  +GP+D A     +  AE RLL  K+LFGDRLYV L
Sbjct: 136  QAIHIRASWLEEAGTEGLIALTGALTGPVDAAIREGHTAQAEARLLMLKRLFGDRLYVEL 195

Query: 187  QRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
            QRH  YD+  E ++V LAY H+LPLVATN + F + +DY+AHD LMAVAH+ +VS   R 
Sbjct: 196  QRHGTYDKPHEQKIVGLAYAHDLPLVATNEAFFPTRDDYDAHDALMAVAHNAIVSDDSRF 255

Query: 247  RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFI--EKECDDIQ 304
            R+TPDHYLK+R+EM  +F+DLPEALENT+EIARRCSF+L+   PILPRF     + ++ +
Sbjct: 256  RLTPDHYLKSRAEMAKLFADLPEALENTIEIARRCSFVLKTRKPILPRFTGATDDAEEAE 315

Query: 305  KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
            + E  ELR +AV GL+ RL+   ++ GY  +DYR+RL+FEL+VI RM+F GYFLIVADFI
Sbjct: 316  RAEAGELRRQAVEGLDRRLSTLGMSPGYEEKDYRERLEFELSVIERMRFPGYFLIVADFI 375

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
            +WAK+++IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNP+R+SMPDFDIDFCQ
Sbjct: 376  KWAKQHDIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPERVSMPDFDIDFCQ 435

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            DRR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL+PN+PA
Sbjct: 436  DRREEVIRYVQAKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKLVPNNPA 495

Query: 485  HPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
            +P    +AI ++ + +E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLS+LV
Sbjct: 496  NPTPLSKAIEEEPKLQEEAAKEPVVARLLDIAQKIEGLYRHASTHAAGIVIGDRPLSKLV 555

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPF 603
            PMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++DF+A+RG+ VDL+ IP 
Sbjct: 556  PMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKVAVDFVAKRGISVDLAAIPL 615

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNN 663
            DD +TY +L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI  YN 
Sbjct: 616  DDKKTYEMLSRGETVGVFQVESAGMRKALIGMKPDCIEDIIALVALYRPGPMENIPTYNA 675

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G E++ SIHP+ID +LKETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKIK 
Sbjct: 676  RKHGDEELESIHPMIDHLLKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIKA 735

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
            EMD+Q+ERF+ GA KNG+SK  A NIFELLAKFA+YGFNKSHAAAYA++SYQTA+MK HY
Sbjct: 736  EMDQQRERFVDGAVKNGVSKPQADNIFELLAKFANYGFNKSHAAAYAIVSYQTAYMKAHY 795

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEFLAASMTL+M N EK+  F QDA++  I+++ PSV T    F+ GDNRIYY+LAA+K
Sbjct: 796  PVEFLAASMTLDMSNTEKVNDFRQDAKRLGIEVIAPSVQTSFRQFETGDNRIYYALAALK 855

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
            GVG +   HI+E   D PF  +EDFC R+D +++NRRVLESL++AGA DCFG  R QL  
Sbjct: 856  GVGESAVDHIVEVRGDTPFAGIEDFCLRIDPRQVNRRVLESLIYAGAFDCFGTDRAQLSA 915

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
             LD I  YAQ  ++N+ +   +IF     +  +KI L  FS   +S R   E +VLGFY 
Sbjct: 916  GLDRILGYAQRAQENKLSGQSDIFGSTLTSGPEKIALPPFSPWLASERLLKEFQVLGFYL 975

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIRG--NNIRLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            + HPLD Y  IL+KM ++ + E  A I+   +N RLA  V+SKQ++KTR G+++G + FS
Sbjct: 976  TAHPLDSYNNILQKMRVQTFAEFSAAIKQGASNARLAGTVISKQERKTRTGNKMGIIVFS 1035

Query: 1022 EPAKEYEANFF 1032
            + + ++EA  F
Sbjct: 1036 DSSGQFEAVLF 1046


>gi|222529253|ref|YP_002573135.1| DNA polymerase III DnaE [Caldicellulosiruptor bescii DSM 6725]
 gi|222456100|gb|ACM60362.1| DNA polymerase III, alpha subunit [Caldicellulosiruptor bescii DSM
            6725]
          Length = 1139

 Score =  813 bits (2100), Expect = 0.0,   Method: Composition-based stats.
 Identities = 388/1033 (37%), Positives = 601/1033 (58%), Gaps = 30/1033 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL +H+ YSLL+GA  ++ + +++      A+ ITD   ++  ++F + A   GI+P
Sbjct: 2    SFVHLHLHTEYSLLDGACRIDRLFERVKDLNMNAVGITDHGAMYGVIDFYKTAKENGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +               +  +VLL    +GY+ L ++VS  + ++      
Sbjct: 62   IIGCEVYLAPRTRFDKEP---NIDNDIHHLVLLAMDNDGYRNLSKIVSIGF-VEGFYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            R+    L +  ++GLI LT   +G I +       +     +  +K++FG+  Y  LQ H
Sbjct: 118  RVDREVLSKY-SKGLIALTSCLAGEIPKLILREQKEKLYDAINFYKEVFGENFYFELQYH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++    +++++L+  +++PLVATN+  +L  ED   HD+L+ +     +S  +R   
Sbjct: 177  YIDEQRFVNNELMRLSKKYQIPLVATNDVHYLRREDRNLHDILLCIQTGKTISDSNRMEF 236

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM  +F  +PEAL+NT+EIA +C+   +     LP+F   E    + + 
Sbjct: 237  PTDEFYLKSPEEMQQLFGYIPEALKNTLEIAEKCNVEFEFGKINLPKFQLPEG---KSDA 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L+  A+ G + R            +    RL  EL VI  M F  YFLIV DFI +A
Sbjct: 294  FEYLKELALEGFKKRYKNDD-------KAAYDRLMMELQVIKDMGFVEYFLIVQDFINYA 346

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K+NNI VGPGRGS AGS+ AY L IT++DP+++ LLFERFLNP+R+SMPD DIDFC  RR
Sbjct: 347  KQNNIMVGPGRGSAAGSIVAYCLGITNVDPIKYDLLFERFLNPERVSMPDIDIDFCYQRR 406

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RV+QIITFG++ A+A++RDVGR L +PYSQVD + K+IP  P   +
Sbjct: 407  QEVIDYVTRKYGEDRVSQIITFGTMAARASIRDVGRVLGVPYSQVDEIAKMIPFSPGMTI 466

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                +  +   ++    + +V R+++ ++ LEG+ RHAS HAAG+VI   P++ LVP+  
Sbjct: 467  DKA-LEINHDLKKIYEQNDTVRRIIDTARNLEGMPRHASVHAAGVVISSCPITDLVPL-- 523

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
                D  VTQF M  +E+ GL+K DFLGL+TLT++Q +L+ + + RG+++DL  I ++D 
Sbjct: 524  ARTDDAIVTQFPMTTLEELGLLKMDFLGLRTLTVIQNTLELVKKNRGIEIDLDRIDYNDK 583

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              Y  ++   T G+FQLESSGM+Q ++ ++P+ +EDIIA +SL+RPGP+D I VY   KN
Sbjct: 584  NVYEFISEGNTNGVFQLESSGMKQFMKELKPENLEDIIAGISLFRPGPMDQIPVYIQNKN 643

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
             +EKI  +HP ++P+L  T G I+YQEQVMQI + L+GYSL  AD++RRAM KK  + + 
Sbjct: 644  NREKIEYLHPSLEPILNVTYGCIVYQEQVMQIFRTLAGYSLGRADLVRRAMAKKKADILM 703

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
            ++K+RFI GA  NGI K  A  IF ++  FA Y FNKSHAAAYA+++YQTA++K +Y +E
Sbjct: 704  EEKDRFIEGAMANGIDKETAEKIFAIIEDFASYAFNKSHAAAYAILAYQTAYLKKYYTIE 763

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            F+A+ +T  M++ EK+  + ++ R+F I I+PP +N    DF +  N I + L AIK +G
Sbjct: 764  FMASLITSVMNSNEKVGMYIEECRKFGISILPPDINKSSYDFTIEGNSIRFGLRAIKSLG 823

Query: 847  TTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSL 905
                 HI++       F  L DF  RVD+  +N+R++E+L+ +GA D  G +R  LL S+
Sbjct: 824  ENVIAHILKEREKKGEFKDLYDFIMRVDTNTVNKRIIENLIRSGAFDFTGLNRNSLLASV 883

Query: 906  DNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSG 965
            ++I   A    K +     + F    G  ++    +      +    + E+  +G Y S 
Sbjct: 884  EDIL--AIKQTKKKNANQFSFF-EISGNENESFVYKNMPQPTAQELMKMEKDTIGVYISS 940

Query: 966  HPLDVYKPILRKMGIKGYEESVATIRGNN-----IRLAAMVVSKQQKKTRKGSRIGWVTF 1020
            HPL+ Y   + K  I    E  A    +      I +  ++   + K T+    + +   
Sbjct: 941  HPLEKYTEEISKYNITPLSEISAMSEEDEYKFEQILVCGILKEVKVKLTKNNLTMAFAKL 1000

Query: 1021 SEPAKEYEANFFP 1033
             +     E  FFP
Sbjct: 1001 EDLTDSVEVLFFP 1013


>gi|158521896|ref|YP_001529766.1| DNA polymerase III, alpha subunit [Desulfococcus oleovorans Hxd3]
 gi|158510722|gb|ABW67689.1| DNA polymerase III, alpha subunit [Desulfococcus oleovorans Hxd3]
          Length = 1182

 Score =  813 bits (2100), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/1035 (36%), Positives = 583/1035 (56%), Gaps = 23/1035 (2%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
            P FVHL VH++YSLL+G + +  ++ +       A+AITD   +F  + F ++A  AGI+
Sbjct: 8    PDFVHLHVHTAYSLLDGIIRIEALMKRAVEYGMGAVAITDHGTMFGVVSFYKEAVKAGIK 67

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            P+IGC+  +  +     T         +  +VLL  T EGY+ L  L S   L       
Sbjct: 68   PVIGCECYVAPRSITDRTPMDH---DGLSHLVLLAETMEGYRNLCHLASIASLK-GFYHK 123

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDR-LYVNLQ 187
             RI    L++ G  GLI L+    G + +     +++ A++    +++  G+   ++ +Q
Sbjct: 124  PRIDKELLKQYGN-GLIGLSACLKGEVAQRLLEGNTEAADRAARFYQEALGENSFFLEVQ 182

Query: 188  RHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
             +   ++ R  + + +++    +PLV TN+  +L  ED+  HD+ + +     +   DR 
Sbjct: 183  NNGIPEQTRLNAALREMSDRLSIPLVGTNDCHYLDREDHNIHDLSLCLQTGKTIHDADRF 242

Query: 247  RV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
            R  T     K + EM +     P A  NTV IA RC+  L       P F         K
Sbjct: 243  RFETDQLNFKPKHEMCTFLEPFPNAATNTVAIADRCNVELDFKTLHFPVFATPPG----K 298

Query: 306  EEENELRNKAVAGLEVRLAQGAIAK-GYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
              +         G   RL   A     +  + Y +RL+FEL+VI  M F  YFLIVADFI
Sbjct: 299  TVDQLFEETVREGFARRLKAVARKNPDFDREAYDRRLEFELSVITDMGFPSYFLIVADFI 358

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
              AK+N IP+GPGRGS AGS+ +YA+ ITD+DP+   LLFERFLNP+R SMPD D+D C 
Sbjct: 359  AHAKENGIPIGPGRGSAAGSIVSYAMGITDLDPIEHGLLFERFLNPERKSMPDIDVDICI 418

Query: 425  DRRDEVIRYVQNKY-GHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDP 483
              R+ V  Y+  KY G + VAQIITFGS++++A +RDVGR + +P S VDR+ KLI   P
Sbjct: 419  IGRERVYHYLVEKYGGSDYVAQIITFGSMKSRAVIRDVGRVMGIPLSDVDRIAKLI---P 475

Query: 484  AHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
             +    +A+A++   ++   + P    L+   + LEG+ RHASTHAAG+VIGD+PL++ +
Sbjct: 476  MNKSLDEALAEEPDLKKLVDSRPDFAELVAAGRALEGMPRHASTHAAGVVIGDKPLTEYL 535

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-GVKVDLSLIP 602
            P+Y  V+ +  +TQ++MK +E  GL+K D LGL+ LT++  +L  L Q+     D+S + 
Sbjct: 536  PLY-AVKENEALTQYDMKCVEAIGLVKLDLLGLRNLTVIADTLKILQQQGRQVPDMSHLD 594

Query: 603  FDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--V 660
              D +TY LL    T G+FQLES+GM++ L  ++P    DI ALV+LYRPGP+ + +   
Sbjct: 595  LADEKTYQLLCAGKTTGVFQLESTGMKELLLKLKPTTFADITALVALYRPGPMGSGMLVD 654

Query: 661  YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKK 720
            +   ++G++++  + P ++P+LKET GVI+YQEQVMQIAQ ++GY++  AD LR+AMGKK
Sbjct: 655  FVECRHGRKRVEYLIPELEPILKETYGVIVYQEQVMQIAQAVAGYTMGTADDLRKAMGKK 714

Query: 721  IKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMK 780
            I  +M + +  FI GA   GI K  A  ++E +  F +YGFNKSH+AAYA++++QTA++K
Sbjct: 715  IAAKMAEHQATFIEGALARGIDKAKAETLYEQIKFFGEYGFNKSHSAAYALVAFQTAYLK 774

Query: 781  THYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLA 840
             H+PVE +AA +T   +    + KF  + R  +I+++PP +N   V F V  +R+ + L 
Sbjct: 775  AHFPVELMAALLTSSTNKTIDVVKFIAECRALDIEVLPPDINESEVAFSVVGDRLRFGLL 834

Query: 841  AIKGVGTTTARHIM-EASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRM 899
            A+K VG      I+ E  A+  F S+ D C RV   K+N++VLESLV  GALD  G  R 
Sbjct: 835  AVKNVGEGAIEAIVEERRANGRFVSIFDLCERVPLTKVNKKVLESLVKCGALDSTGAGRA 894

Query: 900  QLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFS-DKITLEKFSVENSSVRFENEQRV 958
            Q+   L++   + Q V++ + +   ++F       + +  TL      +   R   E+ V
Sbjct: 895  QMTAVLEDALAHGQTVQREKNDSQMSLFDMPGADAALNAPTLPDMPEWSDRQRLAFEKEV 954

Query: 959  LGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWV 1018
            LGFY SGHPL  Y+ +LRK               +N+ +   +    +K T++G ++  V
Sbjct: 955  LGFYVSGHPLAAYRDVLRKYANTDALTLKEIADQSNVIIGGGITVVNRKTTKRGDQMAIV 1014

Query: 1019 TFSEPAKEYEANFFP 1033
            T  +     E   FP
Sbjct: 1015 TIEDMYGTVEVVVFP 1029


>gi|114567554|ref|YP_754708.1| DNA polymerase III DnaE [Syntrophomonas wolfei subsp. wolfei str.
            Goettingen]
 gi|114338489|gb|ABI69337.1| DNA-directed DNA polymerase [Syntrophomonas wolfei subsp. wolfei str.
            Goettingen]
          Length = 1130

 Score =  812 bits (2098), Expect = 0.0,   Method: Composition-based stats.
 Identities = 400/1030 (38%), Positives = 618/1030 (60%), Gaps = 25/1030 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL  HS YSLL+GA  + +++++    + PA+AITD   L+  ++F ++A   GI+P
Sbjct: 4    SFVHLHNHSEYSLLDGACRIKDLVNRAVELEMPAVAITDHGVLYGVIDFYREARKRGIKP 63

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            +IGC+L +  +  L    +       +  + LL     GY+ L++LVSR +L +      
Sbjct: 64   LIGCELYVAPRSRLDKEAR---IDDNLYHLTLLCKNELGYRNLVQLVSRAFL-EGFYYKP 119

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L++   EGLI L+G   G I R       + A ++ L +++LFG    Y+ LQ 
Sbjct: 120  RVDQELLEKYH-EGLIALSGCVVGEIPRLLQNGDYRGAREKALYYQELFGSGNFYLELQD 178

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   +       +++L+    +PL A+N+  +L ++D + HDVL+ +   +VV+ + R R
Sbjct: 179  HGLQEEKASLPGLLRLSREDSIPLAASNDCHYLRKKDAQVHDVLLCIQTGSVVNDEKRLR 238

Query: 248  VTPDHYLKN-RSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
             +   +    R EM ++F D PEALENT++IA  C+         LP F           
Sbjct: 239  FSGSEFYMKSREEMAALFPDYPEALENTLKIAGECNLDFTFGEYHLPVFELPPG----HS 294

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
             E+ L          +            +   +RL++EL VI  M F+ YFLIV D + W
Sbjct: 295  AESFLSEMVHEKFRRKYPD-------AQEKIIERLEYELRVINEMGFAAYFLIVQDLVNW 347

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            +++N IPVGPGRGS AGS+ +Y L IT IDPLR+ LLFERFLNP+R+SMPD DIDFC ++
Sbjct: 348  SRQNGIPVGPGRGSAAGSLVSYVLDITTIDPLRYDLLFERFLNPERVSMPDIDIDFCFEK 407

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            RD VI Y+ +KYG +RVAQIITFG++ A+AA+RDVGRAL +PY QVDR+ K++P +    
Sbjct: 408  RDRVIDYIISKYGADRVAQIITFGTMAARAAIRDVGRALDVPYGQVDRIAKMVPAELGVS 467

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +    +        A  +D +   +L+I+Q +EG+ RHAS HAAG+VIG + LS+++P+ 
Sbjct: 468  LERA-LEISPDLFTAYQSDYNTRNILDIAQAIEGMPRHASIHAAGVVIGRQSLSEILPLQ 526

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDD 605
            +       +TQF  + +E  GL+K D LGL+TLT++ ++L+ + + R   +D+S IP DD
Sbjct: 527  KTP-EGHVLTQFTKETVEDIGLLKMDILGLRTLTVIDRALEIIRKTRDEDIDISSIPLDD 585

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNN 663
               Y LL+   T G+FQLES G+R+ L  M+PD  EDIIA+++LYRPGP+ + +   + N
Sbjct: 586  EAVYKLLSAGDTAGVFQLESDGLRRLLCEMKPDRFEDIIAVIALYRPGPLGSGMVEDFIN 645

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RKNG+++I  I PL++ +LKET GVI+YQEQVM++A  L+ +++ EADVLRRAMGKK  E
Sbjct: 646  RKNGRQEIEYIDPLLEDILKETYGVILYQEQVMRVASELADFTMGEADVLRRAMGKKKAE 705

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
            E+  Q+++FI+GA++NGI    A ++F+L+  FA YGFNKSH+AAYA+ISYQTA++K HY
Sbjct: 706  ELMAQRDKFIAGAARNGIGLATASHLFDLMESFAGYGFNKSHSAAYALISYQTAYLKAHY 765

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVE+L A ++  +DN +K+  + ++ R+  I+++PP +N    +F V  + I + L AIK
Sbjct: 766  PVEYLCAFLSSVIDNQDKVVSYIKECRRLGIKVLPPDINESYENFSVARDAIRFGLGAIK 825

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
             VG    ++I+EA     + SL DFC RVD  +LN+R+LE+L+ AG  D  G+SR   L 
Sbjct: 826  NVGQNAVKNIVEARKQGFYTSLFDFCRRVDLGQLNKRMLENLILAGCFDSLGFSRKGALS 885

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
             ++     +  +++N  ++  ++F  E     + I ++      S  R   E+ VLGF+ 
Sbjct: 886  IMEECVNISLAIKQNECSQQGSLFGDEMEMVEEPI-IKLKGEYESRERLLKEKEVLGFFV 944

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEP 1023
            S  PLD ++ +L  +     E+       + +R+A +VV+  ++ +RKG         + 
Sbjct: 945  SESPLDEFRSLLPLISTHCLEDINLWEEESYVRVAGIVVNLSRRVSRKGESYARFVLEDL 1004

Query: 1024 AKEYEANFFP 1033
                E   FP
Sbjct: 1005 GGRIEVLVFP 1014


>gi|304436411|ref|ZP_07396386.1| DNA-directed DNA polymerase III alpha subunit [Selenomonas sp. oral
            taxon 149 str. 67H29BP]
 gi|304370575|gb|EFM24225.1| DNA-directed DNA polymerase III alpha subunit [Selenomonas sp. oral
            taxon 149 str. 67H29BP]
          Length = 1142

 Score =  812 bits (2098), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/1034 (36%), Positives = 600/1034 (58%), Gaps = 30/1034 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            +F HL VH+ YSLL+GA  + +++ +       A+A+TD   ++ A+ F ++A A GI P
Sbjct: 14   AFAHLHVHTEYSLLDGASRIKDLVRRTKELGMDAVAMTDHGVMYGAVAFYKEAKAQGIHP 73

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +   +      T       ++LL     GY+ L++L+S   + +      
Sbjct: 74   IIGCEVYLAPRQRQERAEVNGTR---YYHLILLAENECGYRNLVQLISLANI-EGYYYKP 129

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            RI    L     +GLI L+   +G I +A      ++A++ +  ++ +FG D  ++ +Q 
Sbjct: 130  RIDKELLHRFH-DGLIALSACVAGEIPQAILRGDMELADQLVREYRDIFGKDNFFLEVQN 188

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   +       +  LA  +++ L ATN+  ++  ED E HD+L+ V     ++  DR R
Sbjct: 189  HGLPEEMTVNRALRDLAKKYDIGLTATNDVHYVHAEDSEFHDILLCVQTGRTLNDPDRMR 248

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
             + PD+YLK+  EM  +F+D P A+ENT +IA RC          LP +      D    
Sbjct: 249  FSGPDYYLKSEEEMSDLFTDYPGAIENTAKIAARCQVDFTFGELQLPYYPLP---DGYTT 305

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
            ++  LR   +  L  R             + RQRLD+EL VI +M ++ YFLIV DFI +
Sbjct: 306  DDAYLRALCIERLPARYP-------TARDEVRQRLDYELGVIHKMGYASYFLIVWDFINY 358

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+ + + VGPGRGS AGS+ AY L IT+IDPL+++LLFERFLNP+R+SMPD DIDF    
Sbjct: 359  ARGHGVAVGPGRGSAAGSIVAYLLGITNIDPLQYALLFERFLNPERVSMPDIDIDFDDIN 418

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R  VI YV+ +YG + VAQI TFG++ AK A+RDV R L+MP+ +V  + KL+P +    
Sbjct: 419  RGRVISYVKERYGEDHVAQIATFGTMGAKGAIRDVARVLEMPFGEVSTITKLVPAELNIT 478

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+ + + FR+    D    R++++++K+EGL R+ S HAAG+VI   PL++ VP++
Sbjct: 479  LD-RALEESADFRKRYEEDEKTHRVIDLARKIEGLPRNTSIHAAGVVIAKSPLTRQVPVW 537

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDD 605
              V     VT+++   +E  GL+K DFLGL+TLT++  ++  + Q  G+++D+  IP  D
Sbjct: 538  --VSDGTLVTEYDKDDVEALGLLKMDFLGLRTLTIIDDAVKNIRQSHGIELDVDKIPLVD 595

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNN 663
             +T  +L    T  +FQ+ES+GM   ++ +QP    D+I  V+LYRPGP+ + +   + +
Sbjct: 596  EKTSRMLCAGDTGAVFQMESTGMTNLVKDLQPKGFVDLIPTVALYRPGPLGSGMVTDFID 655

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
              +GK+++V +HPL++P+LKET GV++YQEQVMQI Q+L+G++L +AD+LRRAMGKK  E
Sbjct: 656  GLHGKKEVVYLHPLLEPILKETFGVVLYQEQVMQIVQVLAGFTLGQADLLRRAMGKKKHE 715

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             +  QKE F+ G  KNGI   +A +IF+LL  FADYGFNKSH+AAY ++++QTA++K HY
Sbjct: 716  LLMAQKEIFLQGCEKNGIEAALANHIFDLLTHFADYGFNKSHSAAYGLLAWQTAYLKAHY 775

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEF+A  +T  MD  +KI  + Q   Q NI+I+PP +N     F +    I + LAA++
Sbjct: 776  PVEFMAGVLTSIMDKTDKIPVYIQLCHQMNIKILPPDINASTAGFSIESGAIRFGLAAVR 835

Query: 844  GVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG T    + +   A+  F SL DFC+R+D + LN+R +ESL+  GA D  G  R QLL
Sbjct: 836  NVGETAIESMEQVRSANGSFRSLIDFCARIDVRILNKRAIESLIKCGAFDSLGTERNQLL 895

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKIT-LEKFSVENSSVRFENEQRVLGF 961
             SLD+  + A   +++R +    +F  +      ++    +        R   E+   GF
Sbjct: 896  SSLDSAMQDAARTQRDRISGQMGLFGQDTMESIHQVQNAVEVPPSTPRERLMWEKEATGF 955

Query: 962  YFSGHPLDVYKPILRKMGIKGYEESVA--TIRGNNIRLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y +GHPLD Y+  L    +    + +         +R+  ++ + ++  T+KG  + +  
Sbjct: 956  YITGHPLDDYRDTLS--CLLPISDILTGLCKDRQLVRIGGILTNTKRYTTKKGDTMLFAE 1013

Query: 1020 FSEPAKEYEANFFP 1033
              + +   E   FP
Sbjct: 1014 MEDYSGHIELTVFP 1027


>gi|255281425|ref|ZP_05345980.1| DNA polymerase III, alpha subunit [Bryantella formatexigens DSM
            14469]
 gi|255267913|gb|EET61118.1| DNA polymerase III, alpha subunit [Bryantella formatexigens DSM
            14469]
          Length = 1150

 Score =  812 bits (2098), Expect = 0.0,   Method: Composition-based stats.
 Identities = 373/1046 (35%), Positives = 580/1046 (55%), Gaps = 39/1046 (3%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL VH+ YSLL+G+  +   + ++      + AITD   ++  ++F + A A GI+PI
Sbjct: 3    FTHLHVHTEYSLLDGSNKIKEYVARVKELGMNSAAITDHGAMYGVIDFYRAARAEGIKPI 62

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +         N G         +VLL     GY  LI++VS  + ++      R
Sbjct: 63   LGCEVYVAPNSRFDRENTGGE--DRYYHLVLLAENNTGYANLIKIVSAGF-VEGYYYKPR 119

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +    L++   EG+I L+   +G I R       +  +K  L ++++FG    ++ LQ H
Sbjct: 120  VDKELLRQYH-EGIIALSACLAGEIPRYLVRGLYEEGKKVALEYQEIFGKGNFFLELQDH 178

Query: 190  RGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++     Q+++++    + LVATN+  +    D E HD+L+ +     +  +DR R 
Sbjct: 179  GIANQQIVNQQLLRMSAETGIELVATNDVHYTLASDAEPHDILLCIQTGKKLQDEDRMRY 238

Query: 249  T-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
                +Y+K+  EM  +F    +ALENT +IA RC+  ++     LPRF   E        
Sbjct: 239  EGGQYYVKSPEEMAQLFPYALQALENTQKIADRCNVEIEFGVTKLPRFDVPEG----YTS 294

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L      GL +R           A++ ++RL++EL +I +M +  YFLIV DFI++A
Sbjct: 295  WEYLNKLCFDGLALRYPP------EQAEELKERLNYELGIIQKMGYVDYFLIVWDFIRYA 348

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            + ++I VGPGRGS AGS+ +Y L IT +DP++++LLFERFLNP+R+SMPD DIDFC +RR
Sbjct: 349  RDHDISVGPGRGSAAGSLVSYTLGITKLDPIKYNLLFERFLNPERVSMPDIDIDFCFERR 408

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RV QI+TFG+L A+  +RDVGR + +PYS VD + K++P +    +
Sbjct: 409  QEVIDYVVRKYGKDRVVQIVTFGTLAARGVIRDVGRVMDIPYSVVDSVAKMVPQELNITL 468

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+ ++S  R+    DP + RL++++++LEGL RH S HAAG+VI  +   + VP+ R
Sbjct: 469  D-KALQENSELRKIYEEDPQMHRLIDMAKRLEGLPRHTSMHAAGVVICQKAADEYVPLSR 527

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSLIPFDDH 606
                    TQF M  +E+ GL+K DFLGL+TLT++Q ++       GV +D+  I +DD 
Sbjct: 528  GS-DGSITTQFTMTTLEELGLLKMDFLGLRTLTVIQDAVKLVQKDTGVLLDMDKIDYDDK 586

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
               + L T  T G+FQLES+GM+  ++ ++P  +ED+IA +SLYRPGP+D I  Y   KN
Sbjct: 587  AVLNSLGTGKTDGVFQLESAGMQNFMKELKPQSLEDLIAGISLYRPGPMDFIPQYIRGKN 646

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E I    P + P+L+ T G I+YQEQVMQI + L GY+L  +D+LRRAM KK    M+
Sbjct: 647  HPETITYDCPQLKPILEPTYGCIVYQEQVMQIVRDLGGYTLGRSDLLRRAMSKKKASVME 706

Query: 727  KQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            K++  F+         G  KNGIS+ +A  I++ +  FA Y FNKSHAAAYAV+SYQTAW
Sbjct: 707  KERRNFVYGNEEEGVPGCIKNGISEQVANKIYDDMIDFAKYAFNKSHAAAYAVVSYQTAW 766

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K +YP+EF+A+ MT  +DN  K+  +    R+  I+I+PP VN     F V + +I Y 
Sbjct: 767  LKYYYPLEFMASLMTSVIDNPPKVAAYHMTCRKMGIEILPPDVNCGEGGFSVENGKIRYG 826

Query: 839  LAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            L+AIK +G      ++E    +  + SL++   R+  K +N+R LES + +GALD  G +
Sbjct: 827  LSAIKSIGRPVIAALVEEREKNGRYTSLKNLVERMSGKDINKRTLESFIKSGALDSLGAT 886

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFENE 955
            R Q++     +        K       ++F    E+     +I++              E
Sbjct: 887  RRQMMTVYSQVCDAVNQERKTSLAGQMSLFDFVGEEEKKHYEISMPDVGEYEKEQLLAYE 946

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATI--------RGNNIRLAAMVVSKQQK 1007
            + VLGFY SGHPL+ Y+ + RK       +               + + +  M+ +K  K
Sbjct: 947  KEVLGFYVSGHPLEAYEELWRKRITNVTTDFQPDEETGIPLVQDQSRVTVGGMITAKTIK 1006

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             T+    + ++T  +     E   FP
Sbjct: 1007 YTKTNKTMAFLTLEDLLGTVEVVVFP 1032


>gi|120553848|ref|YP_958199.1| DNA polymerase III subunit alpha [Marinobacter aquaeolei VT8]
 gi|120323697|gb|ABM18012.1| DNA polymerase III, alpha subunit [Marinobacter aquaeolei VT8]
          Length = 1162

 Score =  812 bits (2097), Expect = 0.0,   Method: Composition-based stats.
 Identities = 412/1051 (39%), Positives = 617/1051 (58%), Gaps = 41/1051 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +  + +FVHL+VHS YS+++G + +  ++ ++A    PA+ +T+ +N+ S + F + A  
Sbjct: 1    MTMANTFVHLRVHSEYSMVDGLVRVKPLIGRVAELGMPAVGLTEQSNMCSLVRFYKAAMG 60

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            AG++PIIG  + ++  D  +              + LL    +GY  L E++S  Y   Q
Sbjct: 61   AGVKPIIGADIWLENPDEPE----------NPFRLTLLARDNDGYLNLTEVISLGYTEGQ 110

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                  +  SWL E   +GLI+L+G   G + +A      ++A +R   ++ L+ D  Y+
Sbjct: 111  RYGKPIVQKSWL-ESRAKGLIVLSGAKMGDVGKALLAGKPELARERADYWRNLYPDSYYL 169

Query: 185  NLQRHR-GYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             LQR     D       V+LA    LP+VATN+  FL  +D+EAH+  + +  S  +   
Sbjct: 170  ELQRTGRAGDEDCLHMSVELAAELGLPVVATNDVHFLEADDFEAHEARVCIGESRTLDDP 229

Query: 244  DR-PRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             R  R +   YL++  EM+ +FSD+PEA+ENTVEIARRCS  +++    LP +   +   
Sbjct: 230  RRDRRFSDQQYLRSAEEMIELFSDIPEAVENTVEIARRCSVKVRMGEYFLPNYPIPDGM- 288

Query: 303  IQKEEENELRNKAVAGLE----VRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFL 358
                 +   R+ +  GLE      L++         ++Y +RL FEL++I +M F GYFL
Sbjct: 289  ---TMDEYFRHVSEEGLEARLAKTLSKDDPEYDQKREEYYKRLKFELDIIIQMGFPGYFL 345

Query: 359  IVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDF 418
            IV DFI+WAK N +PVGPGRGSGAGS+ AYAL ITD+DPL + LLFERFLNP+R+SMPDF
Sbjct: 346  IVMDFIKWAKNNGVPVGPGRGSGAGSLVAYALLITDLDPLEYDLLFERFLNPERVSMPDF 405

Query: 419  DIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKL 478
            D+DFC + RD VI Y   KYG E V+QIITFG++ AKA +RDV R     Y   D+L KL
Sbjct: 406  DVDFCMEGRDRVIDYTAQKYGREAVSQIITFGTMAAKAVVRDVARVQGKSYGLADKLSKL 465

Query: 479  IPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRP 538
            IP +    +  +AI  + + +E    D     + E++ KLEG+ R+A  HA G+VI    
Sbjct: 466  IPFEVGMTL-NKAIEQEPQLKEFLEQDEEAQEIWEMALKLEGVCRNAGKHAGGVVIAPTK 524

Query: 539  LSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKV-- 596
            ++   P+Y D      VTQF+   +E AGL+KFDFLGL+TLT+++ +L+ +  R  +   
Sbjct: 525  ITDFSPLYCDDEGGSLVTQFDKGDVEDAGLVKFDFLGLRTLTIIKWALNMINPRRQQRGE 584

Query: 597  ---DLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPG 653
               D+S IP DD  ++ +L    T  +FQLES GM+  +  +QPD +ED+IALV+L+RPG
Sbjct: 585  GELDISAIPLDDKPSFDMLKKAETTAVFQLESRGMKDLIRRLQPDSLEDMIALVALFRPG 644

Query: 654  PIDNIV--VYNNRKNGKEKIVSIHPL-----IDPMLKETQGVIIYQEQVMQIAQLLSGYS 706
            P+ + +   + +RK+G++ +   HP      + P+L+ T GVI+YQEQVMQIAQ+++GY+
Sbjct: 645  PLQSGMVDDFIDRKHGRQPLSYPHPDYQYQGLKPVLEPTYGVILYQEQVMQIAQVMAGYT 704

Query: 707  LSEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHA 766
            L  AD+LRRAMGKK  EEM KQK  F+ G   NGI KT+A NIF+L+ KFA YGFNKSH+
Sbjct: 705  LGGADMLRRAMGKKKPEEMAKQKAIFLDGCENNGIDKTLAENIFDLVEKFAGYGFNKSHS 764

Query: 767  AAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCV 826
            AAYA++SYQT W+K HYP EF+AA +T +M N +K+    ++ R   + ++ P V+    
Sbjct: 765  AAYALVSYQTLWLKAHYPAEFMAAVLTADMQNTDKVVTLVEECRNMKLDLLVPDVSRSAY 824

Query: 827  DFKVGD-NRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESL 885
             F V D  +I Y L AIKG+G      I+EA+   PF  + DFC RVD KK+N+R +E+L
Sbjct: 825  TFTVNDQGQIVYGLGAIKGLGEGPIESIVEAAKAGPFQDIFDFCRRVDLKKVNKRAMEAL 884

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHE-KGTFSDKITLEKFS 944
            + +GA+D  G  R +L+ S+D   + A    +N      ++F    +G   D+ T    +
Sbjct: 885  IRSGAMDKLGADRAKLMASIDKAIQQADQQSRNDAAGMVDMFGEMLEGGGDDEDTYADVA 944

Query: 945  ---VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMV 1001
                     R + E+  LG Y +GHP D Y+  +R+       +       +  R+A +V
Sbjct: 945  HVREWPEKERLKGEKDTLGLYLTGHPFDEYEREVRRFVRCSIADLK--PNKSPQRVAGLV 1002

Query: 1002 VSKQQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            V+++  KT+ GS + ++T  + +   EA  F
Sbjct: 1003 VAQRTMKTKTGSTMCFITLDDRSARIEATLF 1033


>gi|116251489|ref|YP_767327.1| DNA polymerase III subunit alpha [Rhizobium leguminosarum bv. viciae
            3841]
 gi|115256137|emb|CAK07218.1| putative DNA polymerase III alpha subunit [Rhizobium leguminosarum
            bv. viciae 3841]
          Length = 1165

 Score =  812 bits (2097), Expect = 0.0,   Method: Composition-based stats.
 Identities = 641/1031 (62%), Positives = 811/1031 (78%), Gaps = 6/1031 (0%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            +P F+HL+VHS+YSLLEGAL L  IL K   D QPAIAITDTNNLF ALEFSQKA   G+
Sbjct: 16   TPGFIHLRVHSAYSLLEGALPLKKILYKATGDSQPAIAITDTNNLFVALEFSQKAMEDGL 75

Query: 68   QPIIGCQLDIDMQDNLKMTNQGKT-PFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            QPIIGCQ+ IDM+D L+   +G       +PSIVLL +T  GY+RL++LVSR YL  +  
Sbjct: 76   QPIIGCQVSIDMEDGLETEKRGGQQALVKLPSIVLLAATDAGYERLVDLVSRAYLGGESN 135

Query: 127  QSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNL 186
            Q+V I  SWL+E GTEGLI L+G  +GP+D A        AE RLLT K+LFGDRLYV L
Sbjct: 136  QAVHISASWLEEAGTEGLIALSGALTGPVDVAIKEGHPTQAEARLLTLKRLFGDRLYVEL 195

Query: 187  QRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
            QRH  YD+  E +++ LAY H+LPLVATN + F + +DY+AHD LMAVAH+ +VS   R 
Sbjct: 196  QRHGTYDKRHEQKIIGLAYAHDLPLVATNEAFFPTRDDYDAHDALMAVAHNAIVSDDSRF 255

Query: 247  RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFI--EKECDDIQ 304
            R+TPDHYLK+R+EMV +F+DLPEALENT+EIA RCSF+L+   PILPRF     + ++ +
Sbjct: 256  RLTPDHYLKSRAEMVKLFADLPEALENTIEIATRCSFVLKTRKPILPRFTGATDDAEEAE 315

Query: 305  KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
            + E +ELR +AV GL++RL+   ++ GY  +DYR+RLDFEL+VI RM+F GYFLIVADFI
Sbjct: 316  RAEASELRRQAVEGLDMRLSTLGMSPGYEEKDYRERLDFELSVIERMRFPGYFLIVADFI 375

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
            +WAK+++IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNP+R+SMPDFDIDFCQ
Sbjct: 376  KWAKQHDIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPERVSMPDFDIDFCQ 435

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            DRR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL+PN+PA
Sbjct: 436  DRREEVIRYVQAKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKLVPNNPA 495

Query: 485  HPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
            +P    +AI ++ + +E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLS+LV
Sbjct: 496  NPTPLSKAIEEEPKLQEEAAKEPVVARLLDIAQKIEGLYRHASTHAAGIVIGDRPLSKLV 555

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPF 603
            PMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++DF+A+ G+K+DL+ IP 
Sbjct: 556  PMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKVAVDFVAKLGIKIDLAAIPL 615

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNN 663
            DD +TY +L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI  YN 
Sbjct: 616  DDKKTYEMLSRGETVGVFQVESAGMRKALIGMKPDCIEDIIALVALYRPGPMENIPTYNA 675

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G E++ SIHP+ID +LKETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKIK 
Sbjct: 676  RKHGDEELESIHPMIDHLLKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIKA 735

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
            EMD+Q+ERF+ GA KNG+SK  A NIFELLAKFA+YGFNKSHAAAYA++SYQTA+MK HY
Sbjct: 736  EMDQQRERFVVGAVKNGVSKPQADNIFELLAKFANYGFNKSHAAAYAIVSYQTAYMKAHY 795

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEFLAASMTL+M N EK+  F QDA++  I+++ PSV T    F+ GDNRIYY+LAA+K
Sbjct: 796  PVEFLAASMTLDMSNTEKVNDFRQDAKRLGIEVIAPSVQTSFRHFETGDNRIYYALAALK 855

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
            GVG +   HI+E   DKPF S+EDFC R+D +++NRRVLESL++AGA DCF   R QL  
Sbjct: 856  GVGESAVDHIVEVRGDKPFASIEDFCLRIDPRQVNRRVLESLIYAGAFDCFDMDRAQLAA 915

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
             LD +  YAQ  ++N+ +   +IF     +  +KI+L  FS    S R   E +VLGFY 
Sbjct: 916  GLDRVLGYAQRAQENKLSGQSDIFGSTLTSGPEKISLPPFSPWLPSERLLKEFQVLGFYL 975

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIRG--NNIRLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            + HPLD Y  IL+KM ++ + E  A I+    N RLA  V+SKQ++KTR G+++G + FS
Sbjct: 976  TAHPLDSYNNILQKMRVQTFAEFSAAIKQGAANARLAGTVISKQERKTRTGNKMGIIVFS 1035

Query: 1022 EPAKEYEANFF 1032
            + + ++EA  F
Sbjct: 1036 DSSGQFEAVLF 1046


>gi|303241705|ref|ZP_07328202.1| DNA polymerase III, alpha subunit [Acetivibrio cellulolyticus CD2]
 gi|302590706|gb|EFL60457.1| DNA polymerase III, alpha subunit [Acetivibrio cellulolyticus CD2]
          Length = 1169

 Score =  812 bits (2096), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/1067 (35%), Positives = 605/1067 (56%), Gaps = 63/1067 (5%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VH+ YSLL+GA  + +++ +       +IAITD   ++  ++F ++A   GI+PI
Sbjct: 4    FVHLHVHTEYSLLDGANRIKDLIKRTKELGMDSIAITDHGVMYGVVDFYKEAVNNGIKPI 63

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++    +          +       +VLL     GY+ L+++VS  +  +      R
Sbjct: 64   LGCEVYTAKRTRHDKQGVLDSDPG---HLVLLAKDNRGYKNLMKIVSIGFT-EGFYYKPR 119

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            I    L+   +EGLI L+   SG + +A   N  + A+K    +  +FG    Y+ LQ +
Sbjct: 120  IDFEVLERY-SEGLIALSACLSGDVPKALMNNDFERAKKVSQRYNDIFGKGNFYLELQSN 178

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++    SQ+V+L+    +PLVATN++ +L +ED  AH+VL+ +     ++ +DR R 
Sbjct: 179  GIEEQKLVNSQLVKLSKETGIPLVATNDAHYLRKEDARAHEVLLCIQTGKNMNDEDRMRF 238

Query: 249  T-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
            +  D Y+K+  EM  +F ++PEA++NTV+I   C+  L+     LP+F   +     K+ 
Sbjct: 239  STEDFYVKSPEEMADVFVNVPEAIQNTVKIGEMCNVELEFGKLHLPKFSIPD----NKDA 294

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L+     GL     +         +D  +RL++EL+VI +M +  YFLIV DFI++A
Sbjct: 295  FKYLKELCYEGLNRLFGECI-------EDKLERLEYELSVIKQMGYVDYFLIVGDFIKYA 347

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K N IPVGPGRGS AGS+ AY L IT+IDPL+++LLFERFLNP+R++MPD DIDFC +RR
Sbjct: 348  KDNGIPVGPGRGSAAGSLVAYCLGITNIDPLKYNLLFERFLNPERVTMPDIDIDFCFERR 407

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG ++V+QIITFG++ A+AA+RDVGRAL + YS+VD + K+IP      +
Sbjct: 408  QEVIDYVVRKYGEDKVSQIITFGTMAARAAIRDVGRALDIAYSEVDIVAKMIPMQIGMNI 467

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+  +   +     D  +  +++ ++ LEG+ RHASTHAAG+VI   P+++ VP+ +
Sbjct: 468  -GKALEMNPELKAKYEQDNLIKDMIDTARLLEGMPRHASTHAAGVVISKDPITEYVPLQK 526

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKV-DLSLIPFDDH 606
            +   +   TQF M  +E+ GL+K DFLGL+TLT+++ ++D + +      D+  +  +D 
Sbjct: 527  N--DESVTTQFPMGQLEELGLLKMDFLGLRTLTVIRDAVDLVYENYNTKLDIDRLEMNDP 584

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              + ++    T G+FQLES+GM Q ++ +QP  +EDIIA +SLYRPGP+D I  Y   KN
Sbjct: 585  NVFKIIGEGKTSGVFQLESAGMTQFMKELQPTSLEDIIAGISLYRPGPMDQIPRYIKNKN 644

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
                +   HPL++ +L  T G ++YQEQVMQI + L GYS+  +D++RRAM KK    M+
Sbjct: 645  VPAGVKYDHPLLENILNVTYGCMVYQEQVMQIVRDLGGYSMGRSDLVRRAMSKKKISVME 704

Query: 727  KQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI             G  +NG+ + IA  IF+ +  FA Y FNKSHAAAYAV++Y
Sbjct: 705  QERKNFIHGIDDENGNIVVMGCVRNGVDEKIANKIFDEMMDFASYAFNKSHAAAYAVVAY 764

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTAW+K +YPVEF+AA +   + + +KI ++  + +  NI+++PP +N   + F V + +
Sbjct: 765  QTAWLKCYYPVEFMAALLNSFLGSSDKISQYVHECKVLNIEVLPPDINESQMKFTVVNGK 824

Query: 835  IYYSLAAIKGVGTTTARHIM-EASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + LAA+K VG    + ++ E   D  + S  DFC R+D K +N+R +ESL+ +GA D 
Sbjct: 825  IRFGLAAVKNVGEGAVKSVIDERRTDGNYRSFRDFCDRIDGKDVNKRCIESLIKSGAFDS 884

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTF-----------SDKITLEK 942
             G  R +L+   + +      ++K       ++F    GT             D+     
Sbjct: 885  MGVYRSRLIAVFEKMLDGIAQIKKRNMEGQLSLFELSMGTDDKVNSSETSFYEDEDIYPD 944

Query: 943  FSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIK----------------GYEES 986
             +   + V    E+ +LG Y SGHPL  ++  L KM                     +++
Sbjct: 945  INEYPNKVLLSMEKEMLGLYISGHPLSEFEEELNKMVSLFSSELNVDANQSEEAYSLDDA 1004

Query: 987  VATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
                 G N+ +  ++ SK+ K TR  + + ++T  +     E   FP
Sbjct: 1005 KNISDGMNVIVGGIITSKKTKTTRNNNLMAFLTLEDLYGMMEVIVFP 1051


>gi|78044608|ref|YP_359983.1| DNA polymerase III DnaE [Carboxydothermus hydrogenoformans Z-2901]
 gi|77996723|gb|ABB15622.1| DNA polymerase III, alpha subunit [Carboxydothermus hydrogenoformans
            Z-2901]
          Length = 1116

 Score =  812 bits (2096), Expect = 0.0,   Method: Composition-based stats.
 Identities = 399/1030 (38%), Positives = 592/1030 (57%), Gaps = 36/1030 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL  HS YSLL+GA  + +++ +    + PA+A+TD  NLF  +EF ++A A GI+P
Sbjct: 2    SFVHLHTHSCYSLLDGAGKIKDLVGRAVELKMPALALTDHGNLFGVIEFYKEAKAQGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+G ++ +  +     T +       +  +VLL     GYQ L+ LVSR Y  +      
Sbjct: 62   ILGVEVYVAPRTRFDKTPK---IDDQLTHLVLLAKDRTGYQNLLRLVSRSYT-EGYYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L E  ++GLI L+   +G I         + A +    ++ +FG +  Y+ LQ 
Sbjct: 118  RVDKQLLAE-NSQGLIALSSCLAGEIPELILSGQREKAREVAGIYRDIFGKENFYLELQY 176

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++     +++ L+    +PLVATN+  ++ +E  + HDVL+A+     ++   R +
Sbjct: 177  HGISEQKVVNRELIALSKQLNIPLVATNDVHYILKEHAKTHDVLLAIQTGKSINDPGRMK 236

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T + YLK   EM  IF +LP+AL+NT+ IA +C+   +    +LP F   E     K 
Sbjct: 237  FPTEEFYLKTPYEMELIFGELPDALKNTLNIAEQCNLEFEFGRYLLPDFPVPEG----KT 292

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                L+     GL  R            ++ + RL  EL +I +M FSGYFLIV DFI++
Sbjct: 293  PAQYLKELCFQGLYKRYPNPG-------EEVKTRLLHELKIIEQMGFSGYFLIVWDFIRY 345

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A++  I VGPGRGS AGS+ AY L ITDIDPL++ LLFERFLNP+R+SMPD D+DFC +R
Sbjct: 346  AREKGIMVGPGRGSAAGSLVAYTLEITDIDPLKYGLLFERFLNPERVSMPDIDVDFCFER 405

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI Y+  KYG +RVAQIITFG++ AKAA+RDVGRAL  PYS+VD++ KLIPN     
Sbjct: 406  RQEVIDYLYQKYGEDRVAQIITFGTMAAKAAVRDVGRALDWPYSEVDKIAKLIPNVLGIT 465

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +    I      +     +P V  LL++++++EG+ RHAS HAAG+VI    + + +P++
Sbjct: 466  LEEA-IETTPELKTLYQNNPKVRELLDLARQIEGMPRHASVHAAGLVIAPEEIDKHIPLF 524

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSL-DFLAQRGVKVDLSLIPFDD 605
            +     +  TQF    +E+ GL+K D LGL+TLT+++K+L     Q G +++L  IP DD
Sbjct: 525  KTS-EGVVTTQFEKDTVEELGLLKIDLLGLRTLTVIEKALDFIKKQTGKEINLKDIPLDD 583

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNN 663
             +TY LL    T+G+FQLES GMRQ L+ ++P  IED+IALV+LYRPGP+ + +   + N
Sbjct: 584  EKTYKLLGEGDTVGVFQLESQGMRQILKELKPTSIEDLIALVALYRPGPLGSGMVEDFIN 643

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            R++G+  +   HP ++P+L+ET GVI+YQEQVM IA +L+G+SL EAD+LRRAMGKK  E
Sbjct: 644  RRHGRVPVEYPHPDLEPILRETYGVIVYQEQVMLIASVLAGFSLGEADLLRRAMGKKKPE 703

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             +   K  FI  +   G  +  A  IF L+  FA YGFNKSH+AAYA ++Y TAW+K ++
Sbjct: 704  IIAALKNDFIERSVARGYPREKAEEIFNLIEYFAGYGFNKSHSAAYAFVAYYTAWLKANF 763

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PV FLAA +    DN++K+  + +D ++  I+++PP +N   VDF +    I + LAA+K
Sbjct: 764  PVAFLAALLISVKDNLDKVTVYAEDCQRRGIKVLPPDINLSEVDFTISGQEIRFGLAAVK 823

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
             VG   A  I+E     PF    DF  R+D K +N+RV+ESL+ AGA   FG++R  LL 
Sbjct: 824  NVGEAAAAKIIEERQKGPFRDFNDFLHRIDKKTVNKRVIESLIKAGAFASFGFNRKTLLN 883

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
            +LD+  ++     K        +           + LE     +       E+  LG Y 
Sbjct: 884  NLDDALEF---YSKKSNGVQLTLGDFLPEADRYNLRLE--EEFSKLELLRMEKESLGLYL 938

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEP 1023
            +GHPL   +  ++K                 I   A++   ++  TR+G  + +      
Sbjct: 939  TGHPLAGLRSFIQKHCNLK-------ENKEKIYYPAILAEIKRTVTRRGEPMAFALLEGL 991

Query: 1024 AKEYEANFFP 1033
             +  EA  FP
Sbjct: 992  NQTVEAVIFP 1001


>gi|258405519|ref|YP_003198261.1| DNA polymerase III, alpha subunit [Desulfohalobium retbaense DSM
            5692]
 gi|257797746|gb|ACV68683.1| DNA polymerase III, alpha subunit [Desulfohalobium retbaense DSM
            5692]
          Length = 1159

 Score =  811 bits (2095), Expect = 0.0,   Method: Composition-based stats.
 Identities = 413/1038 (39%), Positives = 603/1038 (58%), Gaps = 26/1038 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
             F HL  H+ YSLL+GA+ + ++  +       ++AI+D  NLF AL+F   A   G++P
Sbjct: 3    DFTHLHCHTEYSLLDGAIRIGDLCQQAVDFGFSSVAISDHGNLFGALDFYLTAKKFGVKP 62

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +   D    T        +   +VLL     GY  L+ LVSR +L +      
Sbjct: 63   IIGCEVYVAPGDR--RTKHTDKDIRSGYHLVLLAQNLTGYYNLVRLVSRGWL-EGFHYKP 119

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            R+    L +   EGLI L+    G +            +     +  LF  R Y+ LQ +
Sbjct: 120  RVDKELLSQW-NEGLIALSACLKGEVPYGLRHEGMSRGKALAEEYSALFPGRFYLELQAN 178

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++     Q+++LA T +LPLVATN+  +LS  D EAHD+L+ +  +     KDR R 
Sbjct: 179  GIPEQVTLNEQLLELAETTKLPLVATNDCHYLSYNDVEAHDILLCIQTNAQYYAKDRMRF 238

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + Y +   EM   F+  P+ALEN   IAR C+  L +     P +   +     +  
Sbjct: 239  DTQELYYRPPEEMEQAFAHCPQALENVGAIARNCNVELDLGQNYFPVYDVPQG----RTL 294

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            E E       GL  RLA+  +      + Y QRLD EL+VI    F  YFLIV DFI WA
Sbjct: 295  EEEFIRLVREGLRTRLAK--LPYTVDEEVYWQRLDTELDVICAKGFPAYFLIVQDFINWA 352

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K+  IPVGPGRGS AGS+ AY L IT++DPLR++LLFERFLN +R SMPD D+DFC +RR
Sbjct: 353  KEQGIPVGPGRGSAAGSLVAYCLGITNLDPLRYNLLFERFLNVERASMPDIDVDFCYNRR 412

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
            +EVIRYV  KYG E VAQI TFG+++AKA +RDVGRAL + +++ D++ KL+P+D    +
Sbjct: 413  EEVIRYVTAKYGKESVAQITTFGTMKAKAVVRDVGRALGLSFAETDKIAKLVPDDLKMTI 472

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGD-RPLSQLVPMY 546
              +A+  +         D +V +L+++S++LEGL RHASTHAAGIVI D  PL   +P+Y
Sbjct: 473  D-KALEQEPDLAALAENDETVAKLIDVSRRLEGLARHASTHAAGIVISDSHPLEDHLPLY 531

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-GVKVDLSLIPFDD 605
               +    VTQF+MK +EK GLIKFDFLGLKTLT++  +L    Q      D+  +P +D
Sbjct: 532  LG-KKGEVVTQFDMKKVEKVGLIKFDFLGLKTLTVIADTLHLAQQAGKSVPDIDTLPLED 590

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNN 663
              T+ LL    T G+FQLESSGMR  ++ +QP   EDIIAL++LYRPGP+++ +   +  
Sbjct: 591  EATFALLCRTETDGVFQLESSGMRNVIKDLQPTSFEDIIALLALYRPGPLESGMVTDFIR 650

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G+  +   HPL++P+L+ T GVI+YQEQVM+IA  ++ YSL + D+LRRAMGKK   
Sbjct: 651  RKHGEIPVEYPHPLLEPILEATYGVILYQEQVMRIASDMANYSLGDGDILRRAMGKKDPS 710

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             M +Q+ +F++GA +N I +  A  IF+L+ KFA YGFNKSH+AAYA++SYQTA++K HY
Sbjct: 711  VMAEQRTKFVNGAKENEIDEATATYIFDLMEKFAGYGFNKSHSAAYALVSYQTAYLKAHY 770

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEF+AA +T E+ N +K+       R+  I+++PP VN     F V + ++ + L+ +K
Sbjct: 771  PVEFMAALITSEVSNTDKVIAHINACREMGIEVLPPDVNHSERHFTVENEKLRFGLSGVK 830

Query: 844  GVGTTTARHIM-EASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG      ++ E   + P+ SL DFC RV S+K+ +RVLESL+ +GA+D  G SR  LL
Sbjct: 831  NVGGGAIEALVAERRRNGPYASLLDFCKRVGSRKVTKRVLESLIKSGAMDSLGCSRASLL 890

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFS-------DKITLEKFSVENSSVRFENE 955
             +LD +   AQ   ++++    ++ A      S         I   +    +   R + E
Sbjct: 891  AALDKVVSTAQRQSRDKSRGQLSLMAMMGEEDSCVLSGIGMDIEEAQVEEWDDEKRLQYE 950

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRI 1015
            +  LGF+ SGHPL  ++  L++  +   ++         +R A +V   ++  T+KG R+
Sbjct: 951  KEALGFFLSGHPLLRFREELKRQRLLSLQDCGELGGDTEVRTAVLVTGVKEHVTKKGGRM 1010

Query: 1016 GWVTFSEPAKEYEANFFP 1033
             +    +     E   FP
Sbjct: 1011 AFCQIEDLTGTGEMTMFP 1028


>gi|241204110|ref|YP_002975206.1| DNA polymerase III subunit alpha [Rhizobium leguminosarum bv.
            trifolii WSM1325]
 gi|240858000|gb|ACS55667.1| DNA polymerase III, alpha subunit [Rhizobium leguminosarum bv.
            trifolii WSM1325]
          Length = 1165

 Score =  811 bits (2095), Expect = 0.0,   Method: Composition-based stats.
 Identities = 641/1031 (62%), Positives = 810/1031 (78%), Gaps = 6/1031 (0%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            +P F+HL+VHS+YSLLEGAL L  IL K   D QPAIAITDTNNLF ALEFSQKA   G+
Sbjct: 16   TPGFIHLRVHSAYSLLEGALPLKKILYKATGDSQPAIAITDTNNLFVALEFSQKAMEEGL 75

Query: 68   QPIIGCQLDIDMQDNLKMTNQGKT-PFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            QPIIGCQ+ IDM D L+   +G       +P+IVLL +T  GY+RL++LVSR YL  +  
Sbjct: 76   QPIIGCQVSIDMGDGLETEKRGGQQALVKLPAIVLLAATDAGYERLVDLVSRAYLGGESN 135

Query: 127  QSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNL 186
            Q+V I  SWL+E GTEGLI LTG  +GP+D A        AE RLLT K+LFGDRLYV L
Sbjct: 136  QAVHISASWLEEAGTEGLIALTGALTGPVDVAIKEGHPAQAEARLLTLKRLFGDRLYVEL 195

Query: 187  QRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
            QRH  YD+  E +++ LAY H+LPLVATN + F + +DY+AHD LMAVAH+ +VS   R 
Sbjct: 196  QRHGTYDKRHEQKIIGLAYAHDLPLVATNEAFFPTRDDYDAHDALMAVAHNAIVSDDSRF 255

Query: 247  RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFI--EKECDDIQ 304
            R+TPDHYLK+R+EMV +F+DLPEALENT+EIA RCSF+L+   PILPRF     + ++ +
Sbjct: 256  RLTPDHYLKSRAEMVKLFADLPEALENTIEIATRCSFVLKTRKPILPRFTGATDDAEEAE 315

Query: 305  KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
            + E +ELR +AV GL++RLA   ++ GY  +DYR+RLDFEL+VI RM+F GYFLIVADFI
Sbjct: 316  RAEASELRRQAVEGLDMRLATLGMSAGYEEKDYRERLDFELSVIERMRFPGYFLIVADFI 375

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
            +WAK+++IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNP+R+SMPDFDIDFCQ
Sbjct: 376  KWAKQHDIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPERVSMPDFDIDFCQ 435

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            DRR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL+PN+PA
Sbjct: 436  DRREEVIRYVQAKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKLVPNNPA 495

Query: 485  HPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
            +P    +AI ++ + +E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLS+LV
Sbjct: 496  NPTPLSKAIEEEPKLQEEAAKEPVVARLLDIAQKIEGLYRHASTHAAGIVIGDRPLSKLV 555

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPF 603
            PMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++DF+A+ GVKVDL+ IP 
Sbjct: 556  PMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKVAVDFVAKLGVKVDLAAIPL 615

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNN 663
            DD +TY +L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI  YN 
Sbjct: 616  DDKKTYEMLSRGETVGVFQVESAGMRKALIGMKPDCIEDIIALVALYRPGPMENIPTYNA 675

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G E++ SIHP+ID +LKETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKIK 
Sbjct: 676  RKHGDEELESIHPMIDHLLKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIKA 735

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
            EMD+Q+ERF+ GA +NG+SK  A NIFELLAKFA+YGFNKSHAAAYA++SYQTA+MK HY
Sbjct: 736  EMDQQRERFVVGAVRNGVSKPQADNIFELLAKFANYGFNKSHAAAYAIVSYQTAYMKAHY 795

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEFLAASMTL+M N EK+  F QDA++  I+++ PSV +    F+ GDNRIYY+LAA+K
Sbjct: 796  PVEFLAASMTLDMSNTEKVNDFRQDAKRLGIEVIAPSVQSSFRHFETGDNRIYYALAALK 855

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
            GVG +   HI+E   DKPF S+EDFC R+D +++NRRVLESL++AGA DCF   R +L  
Sbjct: 856  GVGESAVDHIVEVRGDKPFASIEDFCLRIDPRQVNRRVLESLIYAGAFDCFDMDRAELAA 915

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
             LD +  YAQ  ++N+ +   +IF     +  +KI+L  FS    S R   E +VLGFY 
Sbjct: 916  GLDRVLGYAQRAQENKLSGQSDIFGSTLTSGPEKISLPPFSPWLPSERLLKEFQVLGFYL 975

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIRG--NNIRLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            + HPLD Y  IL+KM ++ + E  A I+    N RLA  V+SKQ++KTR G+++G + FS
Sbjct: 976  TAHPLDSYNNILQKMRVQTFAEFSAAIKQGAANARLAGTVISKQERKTRTGNKMGIIVFS 1035

Query: 1022 EPAKEYEANFF 1032
            + + ++EA  F
Sbjct: 1036 DSSGQFEAVLF 1046


>gi|323693196|ref|ZP_08107414.1| DNA polymerase III [Clostridium symbiosum WAL-14673]
 gi|323502679|gb|EGB18523.1| DNA polymerase III [Clostridium symbiosum WAL-14673]
          Length = 1176

 Score =  811 bits (2094), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/1047 (36%), Positives = 571/1047 (54%), Gaps = 40/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            +F HL VH+ YSLL+ +  +  +  +       ++AITD   ++  ++F + A  AGI+P
Sbjct: 18   AFTHLHVHTEYSLLDASSKIKELTARAKELGMDSLAITDHGVMYGVIDFYRAAKEAGIKP 77

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +         N           ++LL     GYQ L+++VS+ + ++      
Sbjct: 78   IIGCEIYVAPGSRFDRENVNGE--DRYYHLILLAENNVGYQNLMKIVSKGF-VEGFYYKP 134

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYVNLQR 188
            R+    L+E  +EG+I L+    G + R       + A K  L ++++FG+   ++ LQ 
Sbjct: 135  RVDFEVLREY-SEGIISLSACLGGEVQRYLTRGMYEEACKSALRYQEIFGEGNFFLELQD 193

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H    +      +++++    +PL ATN+  ++ +ED E+HD+L+ +     V+ ++R R
Sbjct: 194  HGIPAQKTVNQGLLRMSQELGIPLTATNDCHYIYKEDVESHDILLCIQTGKKVADENRMR 253

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                  YLK+  EM  IF    +AL+NT +IA RC+  ++     LP+F   E       
Sbjct: 254  YEGGQFYLKSEEEMREIFPYAADALDNTHKIAERCNVDIEFGVTKLPQFDVPEG----YT 309

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                LR     G                   ++RL++EL VI  M +  YFLIV DFI +
Sbjct: 310  SWEYLRKLCFDGFNKHYPDDDGTL-------KERLEYELGVIQSMGYVDYFLIVWDFIHF 362

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK ++I VGPGRGS AGS+ AY+L ITDIDP+R+ LLFERFLNP+R+SMPD DIDFC +R
Sbjct: 363  AKSHDIMVGPGRGSAAGSIVAYSLGITDIDPIRYQLLFERFLNPERVSMPDIDIDFCFER 422

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV +KYG +RV QI+TFG+L AK  +RDVGR L MPY++ D + K+IP D    
Sbjct: 423  RQEVIDYVVSKYGKDRVVQIVTFGTLAAKGVVRDVGRVLDMPYAKCDSIAKMIPGDLGMT 482

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+      R A   D  V  L+++S++LEGL RH S HAAG+VI    + + VP+ 
Sbjct: 483  LD-KALKASPDLRNAYQEDDEVKYLIDMSRRLEGLPRHTSMHAAGVVISKASVDEYVPLS 541

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVK-VDLSLIPFDD 605
            R        TQF M  +E+ GL+K DFLGL+TLT++Q ++    +   K +DL  I ++D
Sbjct: 542  RAA-DGSITTQFTMTTLEELGLLKMDFLGLRTLTVIQNAVRLAEKTCKKTIDLYNIDYND 600

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
                  + T    G+FQLESSGM+  ++ ++P+ +EDIIA +SLYRPGP+D I  Y   K
Sbjct: 601  KNVLDAIGTGKNDGVFQLESSGMKSFMKELKPENLEDIIAGISLYRPGPMDFIPRYLKGK 660

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            N K+ I    P ++P+L  T G I+YQEQVMQI + L+GY+L  +D++RRAM KK    M
Sbjct: 661  NDKKSITYECPQLEPILSPTYGCIVYQEQVMQIVRDLAGYTLGRSDLVRRAMSKKKGSVM 720

Query: 726  DKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            +K+++ F+         G   NGI +  A +I++ +  FA Y FNKSHAAAYAV+SYQTA
Sbjct: 721  EKERQNFVYGNGEEGVKGCIANGIDEKTANHIYDEMIDFAKYAFNKSHAAAYAVVSYQTA 780

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            ++K +YPVEF+AA MT   DNV K+ ++    RQ  ++I+PP +N     F V    I Y
Sbjct: 781  YLKYYYPVEFMAALMTSVKDNVTKVSEYIMACRQMGMKIVPPDINEGEGGFSVSGGSIRY 840

Query: 838  SLAAIKGVGTTTARHIM-EASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
             L+AIK +G +    I+ E      F +LEDF  R+ SK++N+R LES + +GA+D    
Sbjct: 841  GLSAIKSIGQSVVEEIVKERRERGEFKTLEDFVDRMSSKEVNKRTLESFIKSGAMDSLPG 900

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFEN 954
            +R Q       +       +KN       +F    E+   + ++T               
Sbjct: 901  TRKQKFLVSAQLLDQKNKEKKNSMEGQMTMFDFVAEEEKENFQVTFPNVGEYTKDELLYF 960

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEES--------VATIRGNNIRLAAMVVSKQQ 1006
            E+ +LG Y SGHP++ Y  +  K       +              G  + +  M+ +K  
Sbjct: 961  EKEMLGVYISGHPMEAYIGLWEKNVTARTSDFIVDEETGEAQVRDGAIVTIGGMLTAKTV 1020

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K TR    + +VT  +     E   FP
Sbjct: 1021 KTTRTNKMMAFVTIEDLYGSVEVLVFP 1047


>gi|292670795|ref|ZP_06604221.1| DNA-directed DNA polymerase III alpha subunit [Selenomonas noxia ATCC
            43541]
 gi|292647416|gb|EFF65388.1| DNA-directed DNA polymerase III alpha subunit [Selenomonas noxia ATCC
            43541]
          Length = 1130

 Score =  811 bits (2094), Expect = 0.0,   Method: Composition-based stats.
 Identities = 382/1034 (36%), Positives = 600/1034 (58%), Gaps = 30/1034 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            +F HL VH+ YSLL+GA  +  ++ +       ++A+TD   ++ A+ F ++A A GI P
Sbjct: 2    AFAHLHVHTEYSLLDGASRIKELVRRTKELGMDSVAMTDHGVMYGAVRFYKEAKAQGIHP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            +IGC++ +  +   +   + +        ++LL     GY+ L++LVS   + +      
Sbjct: 62   VIGCEVYLAPRMRQE---RAEVDGQRYYHLILLAENELGYRNLVQLVSLANI-EGYYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYVNLQR 188
            RI    L+    EG+I L+   +G I +A    + + A++ +  +  +FG    ++ +Q 
Sbjct: 118  RIDKELLRRYH-EGIIALSACVAGEIPQAILRGNIEQADEIVREYIDIFGHANFFLEIQD 176

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   +       +  LA  H + LVATN+  ++  +D E HD+L+ V     ++  DR R
Sbjct: 177  HGLPEEKTVNHALRDLAEKHGVRLVATNDVHYVHADDSEFHDILLCVQTGRTINDPDRMR 236

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
             + PD+YLK+  EM  +F+D P ALENTV+IA RC          LP +   +     + 
Sbjct: 237  FSGPDYYLKSEQEMAELFADYPGALENTVKIAERCQVDFTFGELQLPYYPMPKGY---ES 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
            ++  LR      L +R             + RQRLD+EL VI  M ++ YFLIV DFI +
Sbjct: 294  DDVYLRALCEERLPLRYPD-------ADDEIRQRLDYELGVIHNMGYASYFLIVWDFINY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+++ + VGPGRGS AGS+ AY L IT+IDPL+++LLFERFLNP+R+SMPD DIDF    
Sbjct: 347  AREHGVAVGPGRGSAAGSIVAYLLGITNIDPLQYALLFERFLNPERVSMPDIDIDFDDIN 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R  VI YV+ +YG + VAQI TFG++ AK A+RDV R L+MP+S+V  + KLIP +    
Sbjct: 407  RGRVISYVKERYGEDHVAQIATFGTMGAKGAIRDVARVLEMPFSEVSTITKLIPAELNIT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+ + + FR+    D +  R++++++K+EGL R+ S HAAG+VI   PL+  VP++
Sbjct: 467  LD-RALQESTDFRKRYEEDEAARRVIDLARKIEGLPRNTSIHAAGVVIAKSPLADQVPVW 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDD 605
              V     VT+F+   +E  GL+K DFLGL+TLT++  +++ + +  GV++D+  IP +D
Sbjct: 526  --VSEGTLVTEFDKDDVEALGLLKMDFLGLRTLTIIADTVNHVRRSHGVELDIDQIPLED 583

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNN 663
             +T  +L    T  +FQ+ES+GM   ++ +QP    D+I  V+LYRPGP+ + +   + +
Sbjct: 584  AQTAKMLCNGDTGAVFQMESAGMTNLVKDLQPKGFVDLIPTVALYRPGPLGSGMVTDFID 643

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
              +GK+++V +HPL++P+LKET GV++YQEQVMQI Q+L+G++L +AD+LRRAMGKK  E
Sbjct: 644  GLHGKKEVVYMHPLLEPILKETFGVVLYQEQVMQIVQVLAGFTLGQADILRRAMGKKKHE 703

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             +  QKE F+ G  KNGI  ++A  IF+LL  FADYGFNKSH+AAY ++++QTA++K HY
Sbjct: 704  LLMAQKEIFLQGCEKNGIEASLANRIFDLLTHFADYGFNKSHSAAYGLLAWQTAYLKAHY 763

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEF+A  +T  MD  +KI  + Q  RQ  I+I+PP +N+    F +    I + LAA++
Sbjct: 764  PVEFMAGVLTSIMDKTDKIPVYIQLCRQMKIKILPPDINSSVATFGIEGGAIRFGLAAVR 823

Query: 844  GVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG      +    A+   F SL DFC+RVD + LN+R +ESL+  GA D  G  R QLL
Sbjct: 824  NVGENAIASMERVRAEGGKFRSLVDFCARVDMRTLNKRAIESLIKCGAFDSIGMERNQLL 883

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITL-EKFSVENSSVRFENEQRVLGF 961
             +LD   + A   +++  +    +F  +      +I +        +  R   E+   GF
Sbjct: 884  AALDAAMQDAARRQRDLISGQIGLFGQDTMEEVQQIQISSDVPPSTTRERLTWEKEATGF 943

Query: 962  YFSGHPLDVYKPILRKMGIKGYEESVAT--IRGNNIRLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y +GHPLD Y   L    +    +   T       +R+  ++ + ++  T+KG  + +  
Sbjct: 944  YITGHPLDDYSDTLA--CLLPIGDIPGTIRKDRQLVRIGGILTNTKRFTTKKGDTMLFAE 1001

Query: 1020 FSEPAKEYEANFFP 1033
              +     E   FP
Sbjct: 1002 LEDFTGRIEVTIFP 1015


>gi|291519904|emb|CBK75125.1| DNA polymerase III catalytic subunit, DnaE type [Butyrivibrio
            fibrisolvens 16/4]
          Length = 1161

 Score =  810 bits (2093), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/1055 (36%), Positives = 576/1055 (54%), Gaps = 47/1055 (4%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL  H+ YSLL+G+  +   + K       A AITD  N++  ++F ++  AAGI P
Sbjct: 2    SFVHLHTHTEYSLLDGSNKIKAYVKKCVDMGMTAAAITDHGNMYGVIDFYKECKAAGINP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            ++GC++ +                     ++LL    +GYQ LI++VS+ Y +D      
Sbjct: 62   VLGCEVYVAPGSRFDRER--VQGEDHYYHLILLAENNQGYQNLIKIVSKGY-VDGYYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYVNLQR 188
            R+    LQ+   +G+I L+   +G + RA        A+   L ++  FG+   ++ LQ 
Sbjct: 119  RVDFEILQQYH-QGIICLSACLAGEVARALNRGLYDEAKAVALKYRDCFGEGNYFLELQD 177

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++      +++L+    +PLVATN+  + ++ED ++HDVL+ +     +  +DR R
Sbjct: 178  HGIEEQKNVNQGLMRLSRETGIPLVATNDCHYTNKEDADSHDVLLCIQTGKKLQDEDRMR 237

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T + Y+K+  EM+ +F    +A+  T EIA RC   ++     LP F   E  D    
Sbjct: 238  FETSEFYVKSEEEMLQLFPYATDAIGRTQEIADRCHVEIEFGVTKLPHFEVPEGYD---- 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                L      GL+          G  A + + RL +EL VI  M +  YFLIV DFI +
Sbjct: 294  SWTYLNKLCYEGLDR-------RYGDKASELKPRLKYELEVIKNMGYVDYFLIVWDFINY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+ + IPVGPGRGS AGS+ +Y   IT+IDP+++SL+FERFLNP+R+SMPD DIDFC +R
Sbjct: 347  ARTHGIPVGPGRGSAAGSLVSYTTGITNIDPMKYSLVFERFLNPERVSMPDIDIDFCYER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG + V QI+TFG+L+A+  +RDVGR + +PY  VD + K+IP D    
Sbjct: 407  RGEVIDYVIEKYGKDCVTQIVTFGTLKARGVIRDVGRVMDLPYGYVDSIAKMIPMDLGMT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +S  R    +D  V  L+++++ LEGL R+   HAAG+VI  +P+ + VP+ 
Sbjct: 467  LD-KAMEANSELRAVYESDDQVKNLIDVARTLEGLPRNTGMHAAGVVIAGKPMDEYVPVA 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSLIPFDD 605
            R       VTQF M  IE+ GL+K DFLGL+TLT++  ++       G+K+D+  I ++D
Sbjct: 526  RGADGSSIVTQFVMTTIEELGLLKMDFLGLRTLTVINDAVKLVEKNHGIKLDMDAIDYND 585

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
                 +++     G+FQLES+GM+  ++ ++P  IEDIIA +SLYRPGP+D I  Y   K
Sbjct: 586  QGVMDMISAGKCEGVFQLESTGMKNFMKELKPHSIEDIIAGISLYRPGPMDFIPSYIKGK 645

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            N K+ IV   P ++P+L  T G I+YQEQVMQI Q L+GYSL  AD +RRAM KK +  +
Sbjct: 646  NAKDAIVYDTPELEPILAPTYGCIVYQEQVMQIVQQLAGYSLGGADEIRRAMSKKKQYVI 705

Query: 726  DKQKERF----------------ISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAY 769
            ++ +E F                I G    GIS  +A  I++ +  FA Y FNKSHAAAY
Sbjct: 706  EENREIFVNGGQIENHITGKITQIPGCVSKGISSEVANGIYDHMVDFAKYAFNKSHAAAY 765

Query: 770  AVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFK 829
            AV++ QTA++K +YP+EF+AA MT  +D   K+ ++    R   IQ++PP VN     F 
Sbjct: 766  AVVAIQTAYLKKYYPIEFMAALMTSVIDASGKVAEYIAVCRGNGIQVLPPDVNNGEGRFS 825

Query: 830  VGDNRIYYSLAAIKGVGTTTARHIM-EASADKPFDSLEDFCSRVDSKKLNRRVLESLVFA 888
            V  ++I Y L AIK VG  T   I+ +   +  +  LEDF  R+     N+R +E+L+ A
Sbjct: 826  VDGDKIRYGLYAIKSVGRNTIDAIIYDREKNGTYRDLEDFIKRISKYDANKRTIENLIKA 885

Query: 889  GALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENI--FAHEKGTFSDKITLEKFSVE 946
            GALD    +R Q       I       +KN      ++  FA E+     KIT+ K    
Sbjct: 886  GALDTMDGNRRQKCMVFPEILDSVNNKKKNEIEGQMSLFDFASEEQKEDLKITMPKVDEF 945

Query: 947  NSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV--------ATIRGNNIRLA 998
            +  +    E+ ++G Y SGHPLD Y  +L+K       + +        +    + + + 
Sbjct: 946  DKEMLLAFEKELMGVYVSGHPLDDYISLLQKNVTAQANKFLIDEETGEVSVKDDSEVIVG 1005

Query: 999  AMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
             M+     K T++G  + ++T  +     E   FP
Sbjct: 1006 GMITGITNKYTKQGKAMAFITIEDLTGTIEVIVFP 1040


>gi|323485857|ref|ZP_08091192.1| hypothetical protein HMPREF9474_02943 [Clostridium symbiosum
            WAL-14163]
 gi|323400845|gb|EGA93208.1| hypothetical protein HMPREF9474_02943 [Clostridium symbiosum
            WAL-14163]
          Length = 1176

 Score =  810 bits (2093), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/1047 (36%), Positives = 571/1047 (54%), Gaps = 40/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            +F HL VH+ YSLL+ +  +  +  +       ++AITD   ++  ++F + A  AGI+P
Sbjct: 18   AFTHLHVHTEYSLLDASSKIKELTARAKELGMDSLAITDHGVMYGVIDFYRAAKEAGIKP 77

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +         N           ++LL     GYQ L+++VS+ + ++      
Sbjct: 78   IIGCEIYVAPGSRFDRENVNGE--DRYYHLILLAENNVGYQNLMKIVSKGF-VEGFYYKP 134

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYVNLQR 188
            R+    L+E  +EG+I L+    G + R       + A K  L ++++FG+   ++ LQ 
Sbjct: 135  RVDFEVLREY-SEGIISLSACLGGEVQRYLTRGMYEEACKSALRYQEIFGEGNFFLELQD 193

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H    +      +++++    +PL ATN+  ++ +ED E+HD+L+ +     V+ ++R R
Sbjct: 194  HGIPAQKTVNQGLLRMSQELGIPLTATNDCHYIYKEDVESHDILLCIQTGKKVADENRMR 253

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                  YLK+  EM  IF    +AL+NT +IA RC+  ++     LP+F   E       
Sbjct: 254  YEGGQFYLKSEEEMREIFPYAADALDNTHKIAERCNVDIEFGVTKLPQFDVPEG----YT 309

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                LR     G                   ++RL++EL VI  M +  YFLIV DFI +
Sbjct: 310  SWEYLRKLCFDGFNKHYPDDDGTL-------KERLEYELGVIQSMGYVDYFLIVWDFIHF 362

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK ++I VGPGRGS AGS+ AY+L ITDIDP+R+ LLFERFLNP+R+SMPD DIDFC +R
Sbjct: 363  AKSHDIMVGPGRGSAAGSIVAYSLGITDIDPIRYQLLFERFLNPERVSMPDIDIDFCFER 422

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV +KYG +RV QI+TFG+L AK  +RDVGR L MPY++ D + K+IP D    
Sbjct: 423  RQEVIDYVVSKYGKDRVVQIVTFGTLAAKGVVRDVGRVLDMPYAKCDSIAKMIPGDLGMT 482

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+      R A   D  V  L+++S++LEGL RH S HAAG+VI    + + VP+ 
Sbjct: 483  LD-KALKASPDLRSAYQEDDEVKYLIDMSRRLEGLPRHTSMHAAGVVISKASVDEYVPLS 541

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVK-VDLSLIPFDD 605
            R        TQF M  +E+ GL+K DFLGL+TLT++Q ++    +   K +DL  I ++D
Sbjct: 542  RAA-DGSITTQFTMTTLEELGLLKMDFLGLRTLTVIQNAVRLAEKTCKKTIDLYNIDYND 600

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
                  + T    G+FQLESSGM+  ++ ++P+ +EDIIA +SLYRPGP+D I  Y   K
Sbjct: 601  KNVLDAIGTGKNDGVFQLESSGMKSFMKELKPENLEDIIAGISLYRPGPMDFIPRYLKGK 660

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            N K+ I    P ++P+L  T G I+YQEQVMQI + L+GY+L  +D++RRAM KK    M
Sbjct: 661  NDKKSITYECPQLEPILSPTYGCIVYQEQVMQIVRDLAGYTLGRSDLVRRAMSKKKGSVM 720

Query: 726  DKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            +K+++ F+         G   NGI +  A +I++ +  FA Y FNKSHAAAYAV+SYQTA
Sbjct: 721  EKERQNFVYGNGEEGVKGCIANGIDEKTANHIYDEMIDFAKYAFNKSHAAAYAVVSYQTA 780

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            ++K +YPVEF+AA MT   DNV K+ ++    RQ  ++I+PP +N     F V    I Y
Sbjct: 781  YLKYYYPVEFMAALMTSVKDNVTKVSEYIMACRQMGMKIVPPDINEGEGGFSVSGGSIRY 840

Query: 838  SLAAIKGVGTTTARHIM-EASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
             L+AIK +G +    I+ E      F +LEDF  R+ SK++N+R LES + +GA+D    
Sbjct: 841  GLSAIKSIGQSVVEEIVKERRERGEFKTLEDFVDRMSSKEVNKRTLESFIKSGAMDSLPG 900

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFEN 954
            +R Q       +       +KN       +F    E+   + ++T               
Sbjct: 901  TRKQKFLVSAQLLDQKNKEKKNSMEGQMTMFDFVAEEEKENFQVTFPNVGEYTKDELLYF 960

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEES--------VATIRGNNIRLAAMVVSKQQ 1006
            E+ +LG Y SGHP++ Y  +  K       +              G  + +  M+ +K  
Sbjct: 961  EKEMLGVYISGHPMEAYIGLWEKNVTARTSDFIVDEETGEAQVRDGAIVTIGGMLTAKTV 1020

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K TR    + +VT  +     E   FP
Sbjct: 1021 KTTRTNKMMAFVTIEDLYGSVEVLVFP 1047


>gi|302871937|ref|YP_003840573.1| DNA polymerase III, alpha subunit [Caldicellulosiruptor obsidiansis
            OB47]
 gi|302574796|gb|ADL42587.1| DNA polymerase III, alpha subunit [Caldicellulosiruptor obsidiansis
            OB47]
          Length = 1140

 Score =  810 bits (2092), Expect = 0.0,   Method: Composition-based stats.
 Identities = 381/1033 (36%), Positives = 602/1033 (58%), Gaps = 30/1033 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL +H+ YSLL+GA  ++ + +++      A+AITD   ++  ++F + A   GI+P
Sbjct: 2    SFVHLHLHTEYSLLDGACRIDRLFERVKELNMNAVAITDHGAMYGVIDFYKAAKENGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +               +  +VLL    +GY+ L ++VS  + ++      
Sbjct: 62   IIGCEVYLAPRTRFDKEP---NIDNDIHHLVLLAIDNDGYRNLSKIVSIGF-VEGFYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            R+    L +  ++GL+ LT   +G I +       +     +  +K++FG+  Y  LQ H
Sbjct: 118  RVDREVLSKY-SKGLVALTSCLAGEIPKLILREQKEKLYDAISFYKEVFGENFYFELQYH 176

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++    +++++L+  +++PLVATN+  +L +ED   HD+L+ +     ++  DR   
Sbjct: 177  YIDEQRFVNNELMRLSKKYQIPLVATNDVHYLKKEDRNLHDILLCIQTGKTINDSDRMEF 236

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM  +F  +PEAL+NT+EIA +C+   +     LP+F   E  +   + 
Sbjct: 237  PTDEFYLKSSEEMHQLFGYIPEALKNTLEIAEKCNVEFEFGKINLPKFQLPEGKN---DS 293

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L+  A+ G + R ++         +    RL  EL VI  M F  YFLIV DFI +A
Sbjct: 294  FEYLKELALEGFKKRYSKNN-------KTAYDRLMMELQVIKDMGFVEYFLIVQDFINYA 346

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K+NNI VGPGRGS AGSV AY L IT++DP+++ LLFERFLNP+R+SMPD DIDFC  RR
Sbjct: 347  KQNNIMVGPGRGSAAGSVVAYCLGITNVDPIKYDLLFERFLNPERVSMPDIDIDFCYQRR 406

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RV+QIITFG++ A+A++RDVGR L +PYSQVD + K+IP  P   +
Sbjct: 407  QEVIDYVTRKYGEDRVSQIITFGTMAARASIRDVGRVLGIPYSQVDEIAKMIPFSPGMTI 466

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                +  +   +     + +V ++++ ++ LEG+ RHAS HAAG+VI + P++ LVP+  
Sbjct: 467  DKA-LEINHELKRIYERNDTVRKIIDTARNLEGMPRHASVHAAGVVISNSPITDLVPL-- 523

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
                D  VTQF M  +E+ GL+K DFLGL+TLT++Q +L+ + + RG+++DL  I ++D 
Sbjct: 524  ARTDDAIVTQFPMTTLEELGLLKMDFLGLRTLTVIQNTLELVKKNRGIEIDLDRIDYNDK 583

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              Y  ++   T G+FQLESSGM+Q ++ ++P+ +EDIIA +SL+RPGP+D I VY   KN
Sbjct: 584  NVYEFISEGNTNGVFQLESSGMKQFMKELKPENLEDIIAGISLFRPGPMDQIPVYIQNKN 643

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
             +EKI  +HP ++P+L  T G I+YQEQVMQI + L+GYSL  AD++RRAM KK  + + 
Sbjct: 644  NREKIEYLHPSLEPILNVTYGCIVYQEQVMQIFRTLAGYSLGRADLVRRAMAKKKADILM 703

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
            ++K+RFI GA  NG+ K  A  IF ++  FA Y FNKSHAAAYA+++YQTA++K +Y +E
Sbjct: 704  EEKDRFIEGAVANGVKKETAERIFAIIEDFASYAFNKSHAAAYAILAYQTAYLKKYYTIE 763

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            F+ + +T  M++ EK+  + ++ R+F I I+PP +N    DF +  N I + L AIK +G
Sbjct: 764  FMTSLITSVMNSNEKVGMYIEECRKFGITILPPDINKSSYDFTIEGNSIRFGLRAIKSLG 823

Query: 847  TTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSL 905
                 HI++   +   F  L DF  RVD+  +N+R++E+L+ +GA D    +R  LL S+
Sbjct: 824  ENVIAHILKEREEKGEFKDLYDFIMRVDTNTVNKRIIENLIRSGAFDFTRINRNSLLASV 883

Query: 906  DNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSG 965
            ++I        K +     + F    G  ++    +      +    + E+  +G Y S 
Sbjct: 884  EDIL--VLKQAKKKNANQFSFF-EISGNENESFEYKSLPQPTAQELMKMEKDTIGIYISS 940

Query: 966  HPLDVYKPILRKMGIKGYEESVATIRGNN-----IRLAAMVVSKQQKKTRKGSRIGWVTF 1020
            HPL+ Y   + +  +    E       +      I +  ++   + K T+    + +   
Sbjct: 941  HPLERYTEEISRYNVTPLSEISTMSEEDEYKFEQILVCGILKEVKVKLTKSNQTMAFAKL 1000

Query: 1021 SEPAKEYEANFFP 1033
             +     E  FFP
Sbjct: 1001 EDLTDSVEILFFP 1013


>gi|301063202|ref|ZP_07203753.1| putative DNA polymerase III subunit alpha [delta proteobacterium
            NaphS2]
 gi|300442697|gb|EFK06911.1| putative DNA polymerase III subunit alpha [delta proteobacterium
            NaphS2]
          Length = 1155

 Score =  810 bits (2092), Expect = 0.0,   Method: Composition-based stats.
 Identities = 406/1039 (39%), Positives = 607/1039 (58%), Gaps = 19/1039 (1%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P FVHL VH+ YSLL+GA+ ++ +L+K  A    ++AITD  N+F  ++F  +A  
Sbjct: 1    MSDLP-FVHLHVHTEYSLLDGAIRIDRMLEKAKAQGMDSVAITDHGNMFGVVDFFDRAAK 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            AGI+PIIGC++ +   D    T   +   P    +VLLV   +GY+ L  LV+   L   
Sbjct: 60   AGIKPIIGCEVYVAPGDRRDRTP-SQNGGPNAYHLVLLVMNEQGYKNLSTLVTLGNLQG- 117

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLF-GDRLY 183
                 R+ +S L+E   +GL+ L+   +G +           A+++      +F GDR +
Sbjct: 118  FYYHPRVDMSALREY-NQGLVALSACLAGHVPYLIRNGQMDAAKEKAREMASVFDGDRFF 176

Query: 184  VNLQRHRGYDRYRESQ-VVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + LQ ++  ++   ++ + +L+    +P+VATN+  +L+ EDYEAHDVL+ +     V +
Sbjct: 177  LELQANKMAEQKVVNRGLRELSKDLSIPMVATNDCHYLNREDYEAHDVLLCIQTGKSVDE 236

Query: 243  KDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
            + R R  + + Y K R EM     D  EAL NT  +AR C + ++      P F   E  
Sbjct: 237  EKRLRFTSNEFYFKTRREMEEALPDDAEALNNTAHVARLCQYEMRFGEYKFPVFHVPEKQ 296

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
             +        R      L  +  +         ++Y +RL +EL +I +M F+GYFLIVA
Sbjct: 297  SLNDMLMALSRKGLARRLAQKEDEEGPIGPELRREYEERLQYELEIILKMGFAGYFLIVA 356

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DFI++A  ++I VGPGRGS AGS+ AY L IT+I+P+++ LLFERFLNP R+SMPD DID
Sbjct: 357  DFIEYALNHDIAVGPGRGSAAGSLVAYCLNITNIEPIKYGLLFERFLNPARISMPDIDID 416

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FC + RD+VI+YV +KYG   V+QIITFG+++A+  +RDVGR L +P S+VDR+ KL+P 
Sbjct: 417  FCINGRDQVIQYVADKYGRNNVSQIITFGTMKARGVIRDVGRTLNVPLSEVDRIAKLVPE 476

Query: 482  DPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
             P   +    I ++   +    A     +LL IS+ LEGL RHASTHA G+VI DRPL++
Sbjct: 477  GPGVKLDRA-IREEPELKSLENAPGRSQKLLSISRSLEGLARHASTHACGVVISDRPLTE 535

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGV-KVDLSL 600
             +P+Y+       + QF M  +EK GLIKFDFLGLKTLT+L+++L  +      K+DL+ 
Sbjct: 536  YLPLYKGS-KGEIMAQFTMDKVEKLGLIKFDFLGLKTLTVLKEALKLIEASAGLKIDLNR 594

Query: 601  IPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV- 659
            I  +D  TY L     T G+FQLESSGM++ L  + P+  EDIIALV+LYRPGP+ + + 
Sbjct: 595  ISLEDKGTYQLCADGKTTGVFQLESSGMKELLRKLNPEIFEDIIALVALYRPGPLGSNMV 654

Query: 660  -VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMG 718
              + N K+GK ++    P + P+LKET GVI+YQEQVM+IAQ+L+ Y+++EAD LR+A+G
Sbjct: 655  DDFINGKHGKIRVSYFLPQLKPILKETYGVILYQEQVMKIAQVLANYTMAEADELRKAVG 714

Query: 719  KKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            KK  E M + + RFI GA +NG+S  +A  +F L+ KF  YGFNKSH+AAYA+I+YQTA+
Sbjct: 715  KKKPEVMARHRARFIDGAKENGVSADMAEKLFGLIEKFGGYGFNKSHSAAYAMIAYQTAY 774

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K HYPV+F+ A +TL+M N +K  K   + R   IQI+PP VN    DF V +++I + 
Sbjct: 775  LKAHYPVQFMCALLTLDMGNQDKTIKNIAECRTMGIQILPPDVNESQADFSVVEDQIRFG 834

Query: 839  LAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            LAA+K VG      ++E       F  L DFC R++  K+NRRVLE L+  GA D     
Sbjct: 835  LAAVKNVGQKAVEMLIEERDKHGHFKGLLDFCRRMEGSKVNRRVLEGLIQCGAFDFTNAF 894

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDK---ITLEKFSVENSSVRFEN 954
            R +L + LD+  K              N+F   +    +    + L          +   
Sbjct: 895  RSRLFEGLDDALKLCGARH---DPNQLNMFGSLELGEGEAGGLLELPDLPEWEEKEKLRR 951

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSR 1014
            E+  LGFY +GHPL+ ++  +++       +       + ++LA +V S + K+T++G +
Sbjct: 952  EKEALGFYITGHPLEGFQKAIKRFATCLVNDLPTQNDKDQVKLAGVVESLKLKRTKRGDK 1011

Query: 1015 IGWVTFSEPAKEYEANFFP 1033
            +  +   +     E   FP
Sbjct: 1012 MAIMHLEDLTGSTEVVVFP 1030


>gi|291520859|emb|CBK79152.1| DNA polymerase III catalytic subunit, DnaE type [Coprococcus catus
            GD/7]
          Length = 1156

 Score =  810 bits (2091), Expect = 0.0,   Method: Composition-based stats.
 Identities = 374/1047 (35%), Positives = 566/1047 (54%), Gaps = 40/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
             F HL VH+ YSLL+G+  +  ++ ++      ++AITD   ++  ++F ++A   GI P
Sbjct: 2    DFTHLHVHTEYSLLDGSNKIKELIARVKELGMDSVAITDHGVMYGVIDFYKEAQKQGIHP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            +IGC++ +        +  G         +VLL     GY  L+++VS+ +  +      
Sbjct: 62   VIGCEVYVAPGSRFDKS--GNMSSNRYHHLVLLAENDTGYHNLMKIVSKGFT-EGFYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L+E   EG+I L+   +G I  A      Q A        ++FG D  Y+ LQ 
Sbjct: 119  RVDKELLKEYH-EGIIALSACLAGEIPDALRKGLYQTALNAAQEMSEIFGEDHFYLELQD 177

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   D+      +++LA    L LVATN+  +   ED +AHDVL+ +     V+  DR R
Sbjct: 178  HGIPDQKTVNQGLLRLAKDTGLELVATNDIHYTLAEDAQAHDVLLCIQTGKKVADTDRMR 237

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +Y+K+  EM S+F    EA+ENT +IA RC   ++     LP F   E  D    
Sbjct: 238  YEGGQYYVKSPEEMASLFPYAREAIENTHKIAMRCHVDIEFGHYKLPEFPVPEGYD---- 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                L+     G   R  Q         +  ++R+ +ELN I  M F  YFLIV DFI +
Sbjct: 294  SWEYLQKLVWDGFYERYPQ-------ADEKLKERVSYELNTIKTMGFVDYFLIVWDFIHY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK+++I VGPGRGS AGS+ +Y L IT +DP+R++LLFERFLNP+R++MPD D+DFC +R
Sbjct: 347  AKEHDIMVGPGRGSAAGSIVSYCLDITTLDPIRYNLLFERFLNPNRVTMPDIDVDFCFER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG ERV QI+TFG++ A+  +RDVGR L +PY+  D + K+IPN+    
Sbjct: 407  RQEVIDYVVRKYGKERVVQIVTFGTMAARGVIRDVGRVLDLPYAICDSVAKMIPNELGIT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +   ++    D S+  L++++++LEGL RH S HAAG+VI  + + + VP+ 
Sbjct: 467  ID-KALKMNPELKKLYDGDDSIHNLIDMARRLEGLPRHTSMHAAGVVISPKAVDEFVPLS 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-GVKVDLSLIPFDD 605
            R    D+  TQ+ M  +E+ GL+K DFLGL+TLT+++ ++  +       VD+  I ++D
Sbjct: 526  RGA-DDVITTQYTMTTLEELGLLKMDFLGLRTLTVIRNAVKLINADGRHHVDMHEIDYND 584

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
               + ++ T  T GIFQLESSGM+  ++ ++P  +EDIIA +SLYRPGP+D I  Y   K
Sbjct: 585  KAVFDMIGTGKTDGIFQLESSGMKSFMKELKPHNLEDIIAGISLYRPGPMDFIPRYIKGK 644

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            N    I    P ++ +L+ T G I+YQEQVMQI   L+GY L  +D++RRAM KK  + M
Sbjct: 645  NEPASITYECPQLEEILEPTYGCIVYQEQVMQIVMKLAGYDLGRSDLVRRAMSKKKADVM 704

Query: 726  DKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
             K+++ F+         G   NGI +  A  IF+ +  FA Y FNKSHAAAY ++SYQTA
Sbjct: 705  AKERQYFVYGNDELGVPGCIANGIDEATANRIFDEMTDFAKYAFNKSHAAAYTIVSYQTA 764

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            W+K +YPVEF+AA MT  +DN  K+ ++    RQ  I+I+PP +N     F V + RI Y
Sbjct: 765  WLKYYYPVEFMAALMTSVIDNSVKVAEYIMTCRQMGIKILPPDINHGVSSFSVDNGRILY 824

Query: 838  SLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
             L+A+K +G      I +      PF SL++F  R+  K++N+R +E+ + AGA D FG 
Sbjct: 825  GLSAVKSIGRPVVAAIEQERTLAGPFTSLKNFIERMSGKEVNKRSIENFIKAGAFDSFGA 884

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFEN 954
            +R Q +     I        K   +    +F    E+   + +I        +       
Sbjct: 885  TRRQQMMVYAQIMDQVAQDRKKNISGQMTLFDFMDEEEKQAFEIRYPNVGEYDKGTLLSF 944

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEES--------VATIRGNNIRLAAMVVSKQQ 1006
            E+ VLG Y SGHPLD      R+       +            +  + + +  MV  K  
Sbjct: 945  EKEVLGVYISGHPLDDVAESWRRNVTAVTSDFYVNEESGMPNVVDQSLVVIGGMVTGKTV 1004

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K T+    + ++   +     E   FP
Sbjct: 1005 KSTKNNKMMAFIQLEDLLGTVEVIIFP 1031


>gi|255657348|ref|ZP_05402757.1| DNA polymerase III DnaE [Clostridium difficile QCD-23m63]
 gi|296451837|ref|ZP_06893556.1| DNA-directed DNA polymerase III alpha subunit [Clostridium difficile
            NAP08]
 gi|296879767|ref|ZP_06903741.1| DNA-directed DNA polymerase III alpha subunit [Clostridium difficile
            NAP07]
 gi|296259316|gb|EFH06192.1| DNA-directed DNA polymerase III alpha subunit [Clostridium difficile
            NAP08]
 gi|296429238|gb|EFH15111.1| DNA-directed DNA polymerase III alpha subunit [Clostridium difficile
            NAP07]
          Length = 1189

 Score =  809 bits (2089), Expect = 0.0,   Method: Composition-based stats.
 Identities = 376/1065 (35%), Positives = 599/1065 (56%), Gaps = 57/1065 (5%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            + K   F HL VH+ YSLL+G   +  ++ +       +IAITD   +F  ++F + A  
Sbjct: 1    MNK--DFAHLHVHTEYSLLDGFSRVKKLIKRAKELNMSSIAITDHGCMFGVIDFYKTAIK 58

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GI+PIIGC++    +                  +VLL    EGY+ LI++VS  Y ++ 
Sbjct: 59   EGIKPIIGCEVYTAARGLRDKDPNYDKYQG---HLVLLAKNMEGYKNLIKIVSTSY-VEG 114

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLY 183
                 R+ +  L++   +G+I L+   +G + RA    + + A++    ++ +FG +  +
Sbjct: 115  FYYKPRVDMEELKK-HNKGIIALSACLAGDVARALMNRNYEKAKQFAFDYRDIFGEENFF 173

Query: 184  VNLQRHRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + +Q H   ++    S +V+L+    +PLVATN+  ++++ED + HDVLM +     ++ 
Sbjct: 174  LEIQDHNLPEQKEVNSGLVKLSKETGIPLVATNDVHYVNKEDSKIHDVLMCIQMGKTLND 233

Query: 243  KDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
             +R R  + + YLK+R EM  +F    EA++NTV+IA  C+     +   LP++   E  
Sbjct: 234  PNRMRFGSDEFYLKSREEMEELFPYALEAIDNTVKIADMCNVEFDFNTIHLPKYDVPEG- 292

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
                  E  LR     GL+             + +  +RL++EL+VI +M +  YFLIV 
Sbjct: 293  ---YTPETYLRELCFNGLKE-------RYDNPSDEILERLNYELDVIEKMGYVEYFLIVW 342

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DFI ++K+NNI VGPGRGS AGS+ AY L ITDIDP+++SLLFERFLNP+R+SMPD DID
Sbjct: 343  DFINFSKENNIIVGPGRGSAAGSIVAYTLKITDIDPIKYSLLFERFLNPERISMPDIDID 402

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FC +RR+EVI YV+ KYG + VAQIITFG++ AKAA+RDVGR L + Y++VD++ K IP 
Sbjct: 403  FCYERREEVIDYVKRKYGDDHVAQIITFGTMGAKAAIRDVGRVLDIGYNKVDKIAKEIPF 462

Query: 482  DPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
                 +  +A+  +   +E    DP    ++ IS+++EG+ RHASTHAAG+VI   P+ +
Sbjct: 463  ALGMTID-KALDTNPNLKELYDQDPETKEIINISKQIEGMLRHASTHAAGVVISKNPVDE 521

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVD---- 597
             VP+Y+    D   TQF M  +E+ GL+K DFLGL+TLT+++ +LD + +  V  +    
Sbjct: 522  YVPLYK--HQDAITTQFTMTTLEELGLLKMDFLGLRTLTVIRDTLDLIEKNRVIKNYTEK 579

Query: 598  --LSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPI 655
               S + +DD + Y +L++  TLG+FQLES+GMR  ++ ++PD  EDI+A +SL+RPGP+
Sbjct: 580  IDFSKMDYDDPKVYEMLSSGNTLGVFQLESAGMRSFMKQLKPDNFEDIVAGISLFRPGPM 639

Query: 656  DNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRR 715
            D+I  Y   K+  + +  +H  + P+++ T G ++YQEQVMQ+ + L GYS   +D++RR
Sbjct: 640  DSIPAYIKNKSNPKDVTYLHEKLKPIMEVTYGCLVYQEQVMQVVRDLGGYSYGRSDLVRR 699

Query: 716  AMGKKIKEEMDKQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNK 763
            AM KK  + M+++++ FI             G  +NG+ + IA  IF+ +  FA Y FNK
Sbjct: 700  AMSKKKMDVMEEERQYFIHGKFDEDGNIEIAGCIRNGVEEEIANKIFDDMIDFARYAFNK 759

Query: 764  SHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNT 823
            SHAAAY V++Y+TA++KT+YPVEF+AA +T  M N +K+ ++ ++ +   I ++PP +N 
Sbjct: 760  SHAAAYGVLAYETAYLKTYYPVEFMAALITSVMGNTDKVVEYIRECKALEIDVLPPDINK 819

Query: 824  PCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVL 882
                F V  + I + LAA+K VG     +I+     +  F  L D   R+D K  N+RV+
Sbjct: 820  SFSKFSVEGDNIRFGLAAVKNVGVNIINNIIAERESNGLFVDLVDLVKRLDQKDTNKRVI 879

Query: 883  ESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA-----HEKGTFSDK 937
            ESL+  GA D    +R  L+   +++ +      K       ++F       E   F   
Sbjct: 880  ESLIKCGAFDNISENRASLMAGYESLLESVSMDRKKNVQGQISLFDAFGDSEEDSDFQQI 939

Query: 938  ITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNN--- 994
             +L K        R   E+ VLG Y SGHPL  ++  L++       +  +         
Sbjct: 940  YSLPKRQEYEERERLNLEKEVLGMYVSGHPLSQFEKELQEKTSMDNGKLNSLKEEEESYL 999

Query: 995  ------IRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
                  + +  M+V+K  K T++   + ++   +     E   FP
Sbjct: 1000 QMNETDVIMGGMIVTKTIKTTKRNEIMAFLELEDLYGAIEIVVFP 1044


>gi|158319634|ref|YP_001512141.1| DNA polymerase III DnaE [Alkaliphilus oremlandii OhILAs]
 gi|158139833|gb|ABW18145.1| DNA polymerase III, alpha subunit [Alkaliphilus oremlandii OhILAs]
          Length = 1164

 Score =  809 bits (2089), Expect = 0.0,   Method: Composition-based stats.
 Identities = 397/1057 (37%), Positives = 614/1057 (58%), Gaps = 49/1057 (4%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +     FVHL VH+ YSLL+G   +N  ++++      AIAITD  ++F  ++F + A  
Sbjct: 1    MSNQ--FVHLHVHTEYSLLDGFTVINKAMERVKEMGMNAIAITDHGSMFGVVDFYKAAKK 58

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GI+PIIGC++    +       Q          +VLL    EGYQ +I++VS  +L + 
Sbjct: 59   NGIKPIIGCEVYTAPRSMADKDPQKDKNQG---HLVLLAKNEEGYQNIIKMVSNGFL-EG 114

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDR-LY 183
                 RI    L E  ++G+I L+   +G I +    +  + A+   L    +F +   Y
Sbjct: 115  FYYKPRIDYDEL-ERHSKGIICLSACLAGDIQQLLLQDQYESAKALALRLNAMFEENSFY 173

Query: 184  VNLQRHRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + LQ H   ++      +++L+    +PLVATN++ ++++ED +AHD+L+ +    +V  
Sbjct: 174  LELQDHNMAEQKKVNLGLIKLSRETGIPLVATNDAHYINKEDAKAHDILLCIQTGKIVED 233

Query: 243  KDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
            ++R R    + YLK+  EM+ IF   PEA+ NTV+IA +C+F    +   LP +   +  
Sbjct: 234  QERMRFPNDEFYLKSPEEMMKIFDFAPEAISNTVKIAEQCNFDFDFNTIHLPEYHVPQDV 293

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
            +     E+ LR     GL               ++   RL+ EL+VI +M +  YFLIV 
Sbjct: 294  NK----EDYLRKLCFEGLNK-------RYTSVTEELESRLEGELSVIEKMGYVEYFLIVW 342

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DFI++AK N IPVGPGRGS AGS+ AY L ITD+DP++++L+FERFLNP+R+SMPD DID
Sbjct: 343  DFIKYAKDNGIPVGPGRGSAAGSIVAYTLGITDVDPIKYNLIFERFLNPERISMPDIDID 402

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FC +RR+EVI YV+ KYG ++VAQIITFG++ A+AA+RDVGR + MPY++VD++ K IP 
Sbjct: 403  FCYERREEVIDYVKQKYGEDKVAQIITFGTMAARAAIRDVGRVINMPYNEVDKIAKQIPF 462

Query: 482  DPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
                 +  +A+  +   +     +     L++++++LEG+ RHASTHAAG+VI  +PL +
Sbjct: 463  AIGMTIE-KALKMNPELKSIYEENEQGRYLIDMARRLEGMPRHASTHAAGVVIAKKPLKE 521

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSL 600
             VP+Y  V  D   TQF M  +E+ GL+K DFLGL+TLT+++ ++D      G+K+DLS 
Sbjct: 522  HVPLY--VHDDNSTTQFTMGTLEELGLLKMDFLGLRTLTVIKDAIDLIEKNHGIKLDLSD 579

Query: 601  IPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVV 660
              +DD + Y L++   TLG+FQLES+GM Q L+ ++P+C EDIIA +SLYRPGP+D+I  
Sbjct: 580  SKYDDEKVYDLISKGDTLGLFQLESAGMIQFLKELKPNCFEDIIAGISLYRPGPMDSIPR 639

Query: 661  YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKK 720
            Y   KN  EKI  IH  ++P+L  T G ++YQEQ+MQI + L+GYS   +D++RRAMGKK
Sbjct: 640  YIENKNNPEKIKYIHESLEPILNVTYGCMVYQEQIMQIVRDLAGYSYGRSDLVRRAMGKK 699

Query: 721  IKEEMDKQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAA 768
              + M+++++ FI             G  +NG+ + +A  I++ +  FA+YGFNKSHAAA
Sbjct: 700  KMDVMEQERKNFIYGIVNEKGEVEVAGCIRNGVPEDVANKIYDEMIDFANYGFNKSHAAA 759

Query: 769  YAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDF 828
            YAV++Y+TA++KT+Y VEF+AA MT  M N  K+ ++ QD ++ NI+I+PPS+N     F
Sbjct: 760  YAVLAYETAYLKTYYKVEFMAALMTSVMGNTSKVVQYIQDCKKQNIKILPPSINRSFSKF 819

Query: 829  KVGDNRIYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVF 887
             V    I ++L A+K VG     ++++       F +  DFC RV+SK +N+R +ESL+ 
Sbjct: 820  TVEGESIRFALGAVKNVGIGMINNLVQIRETTGDFSTFLDFCQRVESKDINKRAVESLIK 879

Query: 888  AGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIF--AHEKGTFSDKITLEKFSV 945
             GA D  G +R QL+ S + I    Q  ++ +     ++F    E     + +       
Sbjct: 880  CGAFDNMGGNRAQLMASFEGIMDNIQQEKRRKLEGQIDLFQMNEEMDASMNTVNFPDIKD 939

Query: 946  ENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVA---------TIRGNNIR 996
             +  +R   E+ V+GFY SGHPL  Y+  L ++      + +             G  I 
Sbjct: 940  FSEKIRLSMEKEVVGFYISGHPLSEYEKELEQIVSANSAQLIEAMENLAESQLKDGQPII 999

Query: 997  LAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            +  M+     K TR    + ++   +     E   FP
Sbjct: 1000 VGGMIAEINSKITRNNQMMAFIVLEDLFGSLECIVFP 1036


>gi|291458628|ref|ZP_06598018.1| DNA polymerase III, alpha subunit [Oribacterium sp. oral taxon 078
            str. F0262]
 gi|291419161|gb|EFE92880.1| DNA polymerase III, alpha subunit [Oribacterium sp. oral taxon 078
            str. F0262]
          Length = 1188

 Score =  809 bits (2089), Expect = 0.0,   Method: Composition-based stats.
 Identities = 374/1050 (35%), Positives = 583/1050 (55%), Gaps = 43/1050 (4%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL VH+SYSLL+GA  +  ++ ++      A+AITD   ++  ++F ++A A GI P
Sbjct: 29   SFTHLHVHTSYSLLDGAGKIPEMIARVKELGMDAVAITDHGVMYGVIDFYKEAKAQGIHP 88

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +        +            +VLL    EGY  L++LV+R +  +      
Sbjct: 89   ILGCEIYLSPASRFDKSF--GKAEARYYHLVLLAENEEGYHNLMKLVTRGFT-EGFYYKP 145

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L+     GLI L+   +G + R    +  + A    L ++++FG    ++ LQ 
Sbjct: 146  RVDFELLRRYH-GGLIALSACLAGELARDLSRDQYEEARDAALRYQEIFGKGNFFLELQD 204

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++      +++L     +P+VATN+  +   ED +AHD+L+ +     ++ +DR R
Sbjct: 205  HGYPEQRKVNQGLLRLHEDTGIPMVATNDIHYTFREDAKAHDILLCLQTGKKLNDQDRMR 264

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                  Y+K+  EM  +F    EA+ NT +IA RC   ++     LP++   +       
Sbjct: 265  YPGGQFYIKSEEEMRELFPYAEEAILNTEKIAERCQVEIEFGHYHLPKYEVPDGF----T 320

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
              + LR     GL           G  A+ YR+RL +EL+VI+ M F+ YFLIV D+I +
Sbjct: 321  PLSYLRKLCEEGLVR-------RYGEEAEHYRERLSYELSVISSMGFTEYFLIVWDYIHF 373

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK + I VGPGRGS AGS+ AY++ ITDIDP+R+ LLFERFLNP+R++MPD D+DF  +R
Sbjct: 374  AKTHGIAVGPGRGSAAGSIVAYSIGITDIDPMRYQLLFERFLNPERVTMPDIDVDFEYER 433

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG E+V+QIITFG+L AK  +RDVGR + +PY++ D + KLIPN+    
Sbjct: 434  RQEVIDYVTKKYGKEQVSQIITFGTLAAKGVVRDVGRVMDIPYAKCDMIAKLIPNELNMT 493

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+      ++    D    R++++S++LEGL RH+STHAAG+VI    + + VP+ 
Sbjct: 494  LE-RALFGSPDLKKLYEEDEETRRIIDMSRRLEGLPRHSSTHAAGVVIAGSAVEEFVPLS 552

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDD 605
            ++       TQF M  +E+ GL+K DFLGL+TLT++Q ++ F  +    ++DL  + ++D
Sbjct: 553  KN-TDGAVTTQFTMTTVEELGLLKMDFLGLRTLTVIQDAIRFAEKDYGKRIDLERMDYED 611

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
             + Y +++     G+FQLES GM   ++ ++P  +ED+IA VSLYRPGP+D I  Y   K
Sbjct: 612  PKVYEMISRGDCAGVFQLESGGMVSFMKRLRPTSLEDVIAGVSLYRPGPMDFIPKYIEGK 671

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
               E++   HP I+P+LK T G I+YQEQVMQI + L+GYS+  +D+LRRAM KK    M
Sbjct: 672  KHPERVSYEHPRIEPILKSTYGCIVYQEQVMQIVRELAGYSMGRSDLLRRAMSKKKASVM 731

Query: 726  DKQKERF--------ISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            +K++  F        I G    GIS+ +A +I++ +  FA Y FNKSHAA YA+I+YQTA
Sbjct: 732  EKERRNFVYGNPEEGIPGCLSAGISEQVANHIYDEMIDFAKYAFNKSHAACYALIAYQTA 791

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            ++K +YP EF AA M+  MDN  K  ++ + AR   I I+PP +N     F V D  I Y
Sbjct: 792  YLKCYYPAEFYAALMSSFMDNAGKTAEYLEFARDREIPILPPDINLAESGFSVSDASIRY 851

Query: 838  SLAAIKGVGTTTARHIM-EASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
             L+A+KG+G + A  I+ E      F  LEDF  R+  + +NRR +ESL+++GALD    
Sbjct: 852  GLSAVKGIGRSAAEQIIEERRRGGKFRDLEDFLLRISDRGVNRRAVESLIYSGALDSLPG 911

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHE---NIFAHE-KGTFSDKITLEKFSVENSSVRF 952
            +R + + +L  + +     ++N         ++   + +   + + T+        +   
Sbjct: 912  NRREKVTALPFLLESKSKEKRNAMAGQMTLADLLGEDNEEAEAFRFTMPVLPEFPKAELL 971

Query: 953  ENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATI---------RGNNIRLAAMVVS 1003
             NE+  LG Y SGHPLD  + +L                         G  + +  ++  
Sbjct: 972  RNEKDALGVYLSGHPLDSDRELLDFYVDAKAGAFRTDPESGEEGGLSEGQLVTVGGLLTE 1031

Query: 1004 KQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
             +QK T+K   + ++T  +     E   FP
Sbjct: 1032 IRQKVTKKNELMAFLTLEDRQGSIEVTVFP 1061


>gi|126701019|ref|YP_001089916.1| DNA polymerase III DnaE [Clostridium difficile 630]
 gi|254977018|ref|ZP_05273490.1| DNA polymerase III DnaE [Clostridium difficile QCD-66c26]
 gi|255094345|ref|ZP_05323823.1| DNA polymerase III DnaE [Clostridium difficile CIP 107932]
 gi|255102599|ref|ZP_05331576.1| DNA polymerase III DnaE [Clostridium difficile QCD-63q42]
 gi|255308424|ref|ZP_05352595.1| DNA polymerase III DnaE [Clostridium difficile ATCC 43255]
 gi|255316098|ref|ZP_05357681.1| DNA polymerase III DnaE [Clostridium difficile QCD-76w55]
 gi|255518759|ref|ZP_05386435.1| DNA polymerase III DnaE [Clostridium difficile QCD-97b34]
 gi|255651937|ref|ZP_05398839.1| DNA polymerase III DnaE [Clostridium difficile QCD-37x79]
 gi|260684901|ref|YP_003216186.1| DNA polymerase III DnaE [Clostridium difficile CD196]
 gi|260688559|ref|YP_003219693.1| DNA polymerase III DnaE [Clostridium difficile R20291]
 gi|306521687|ref|ZP_07408034.1| DNA polymerase III DnaE [Clostridium difficile QCD-32g58]
 gi|115252456|emb|CAJ70299.1| DNA polymerase III DnaE subunit alpha [Clostridium difficile]
 gi|260211064|emb|CBA66425.1| DNA polymerase III alpha subunit [Clostridium difficile CD196]
 gi|260214576|emb|CBE07133.1| DNA polymerase III alpha subunit [Clostridium difficile R20291]
          Length = 1189

 Score =  809 bits (2088), Expect = 0.0,   Method: Composition-based stats.
 Identities = 377/1065 (35%), Positives = 600/1065 (56%), Gaps = 57/1065 (5%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            + K   F HL VH+ YSLL+G   +  ++ +       +IAITD   +F  ++F + A  
Sbjct: 1    MNK--DFAHLHVHTEYSLLDGFSRVKKLIKRAKELNMSSIAITDHGCMFGVIDFYKTAIK 58

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GI+PIIGC++    +                  +VLL    EGY+ LI++VS  Y ++ 
Sbjct: 59   EGIKPIIGCEVYTAARGLRDKDPNYDKYQG---HLVLLAKNMEGYKNLIKIVSTSY-VEG 114

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLY 183
                 R+ +  L++   +G+I L+   +G + RA    + + A++  L ++ +FG +  +
Sbjct: 115  FYYKPRVDMEELKK-HNKGIIALSACLAGDVARALMNRNYEKAKQFALDYRDIFGEENFF 173

Query: 184  VNLQRHRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + +Q H   ++    S +V+L+    +PLVATN+  ++++ED + HDVLM +     ++ 
Sbjct: 174  LEIQDHNLPEQKEVNSGLVKLSKETGIPLVATNDVHYVNKEDSKIHDVLMCIQMGKTLND 233

Query: 243  KDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
             +R R  + + YLK+R EM  +F    EA++NTV+IA  C+     +   LP++   E  
Sbjct: 234  PNRMRFGSDEFYLKSREEMEELFPYALEAIDNTVKIADMCNVEFDFNTIHLPKYDVPEG- 292

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
                  E  LR     GL+             + +  +RL++EL+VI +M +  YFLIV 
Sbjct: 293  ---YTPETYLRELCFNGLKE-------RYDNPSNEILERLNYELDVIEKMGYVEYFLIVW 342

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DFI ++K+NNI VGPGRGS AGS+ AY L ITDIDP+++SLLFERFLNP+R+SMPD DID
Sbjct: 343  DFINFSKENNIIVGPGRGSAAGSIVAYTLKITDIDPIKYSLLFERFLNPERISMPDIDID 402

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FC +RR+EVI YV+ KYG + VAQIITFG++ AKAA+RDVGR L + Y++VD++ K IP 
Sbjct: 403  FCYERREEVIDYVKRKYGDDHVAQIITFGTMGAKAAIRDVGRVLDIGYNKVDKVAKEIPF 462

Query: 482  DPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
                 +  +A+  +   +E    DP    ++ IS+++EG+ RHASTHAAG+VI   P+ +
Sbjct: 463  ALGMTID-KALDTNPNLKELYDQDPETKEIINISKQIEGMLRHASTHAAGVVISKNPVDE 521

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVD---- 597
             VP+Y+    D   TQF M  +E+ GL+K DFLGL+TLT+++ +LD + +  V  +    
Sbjct: 522  YVPLYK--HQDAITTQFTMTTLEELGLLKMDFLGLRTLTVIRDTLDLIEKNRVIKNYTEK 579

Query: 598  --LSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPI 655
               S + +DD + Y +L++  TLG+FQLES+GMR  ++ ++PD  EDI+A +SL+RPGP+
Sbjct: 580  IDFSKMDYDDPKVYEMLSSGNTLGVFQLESAGMRSFMKQLKPDNFEDIVAGISLFRPGPM 639

Query: 656  DNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRR 715
            D+I  Y   K+  + +  +H  + P+++ T G ++YQEQVMQ+ + L GYS   +D++RR
Sbjct: 640  DSIPAYIKNKSNPKDVTYLHEKLKPIMEVTYGCLVYQEQVMQVVRDLGGYSYGRSDLVRR 699

Query: 716  AMGKKIKEEMDKQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNK 763
            AM KK  + M+++++ FI             G  +NG+ + IA  IF+ +  FA Y FNK
Sbjct: 700  AMSKKKMDVMEEERQYFIHGKFDEDGNIEIAGCIRNGVEEEIANKIFDDMIDFARYAFNK 759

Query: 764  SHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNT 823
            SHAAAY V++Y+TA++KT+YPVEF+AA +T  M N +K+ ++ ++ +   I ++PP +N 
Sbjct: 760  SHAAAYGVLAYETAYLKTYYPVEFMAALITSVMGNTDKVVEYIRECKALEIDVLPPDINK 819

Query: 824  PCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVL 882
                F V  + I + LAA+K VG     +I+     +  F  L D   R+D K  N+RV+
Sbjct: 820  SFSKFSVEGDNIRFGLAAVKNVGVNIINNIIAERESNGLFVDLVDLVKRLDQKDTNKRVI 879

Query: 883  ESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA-----HEKGTFSDK 937
            ESL+  GA D    +R  L+   +++ +      K       ++F       E   F   
Sbjct: 880  ESLIKCGAFDNISENRASLMAGYESLLESVSMDRKKNVQGQISLFDAFGDSEEDSDFQQI 939

Query: 938  ITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNN--- 994
             +L K        R   E+ VLG Y SGHPL  ++  L++       +  +         
Sbjct: 940  YSLPKRQEYEERERLNLEKEVLGMYVSGHPLSQFEKELQEKTSMDNGKLNSLKEEEESYL 999

Query: 995  ------IRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
                  + +  M+V+K  K T++   + ++   +     E   FP
Sbjct: 1000 QMNETDVIMGGMIVTKTIKTTKRNEIMAFIELEDLYGAIEIIVFP 1044


>gi|150391763|ref|YP_001321812.1| DNA polymerase III DnaE [Alkaliphilus metalliredigens QYMF]
 gi|149951625|gb|ABR50153.1| DNA polymerase III, alpha subunit [Alkaliphilus metalliredigens QYMF]
          Length = 1155

 Score =  809 bits (2088), Expect = 0.0,   Method: Composition-based stats.
 Identities = 400/1053 (37%), Positives = 600/1053 (56%), Gaps = 48/1053 (4%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL VH+ YSLL+G  ++N  LD++      A+AITD  ++F  ++F + A   GI+P
Sbjct: 2    SFVHLHVHTQYSLLDGFATINQTLDRVKELGMDALAITDHGSMFGVVDFYKAAKKKGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++    +    MT++      +   +VLL     GYQ LI+LVS  YL        
Sbjct: 62   IIGCEVYTAARG---MTDKDPVKDKSQGHLVLLAKNNVGYQNLIKLVSESYLH-GFYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+  + + +  TEGLI L+   +G + R    N  + A+++ L  +++FG    Y+ LQ 
Sbjct: 118  RVDYNEIAK-HTEGLIALSACLAGEVQRLILQNQYEKAKEKALMLEEMFGKGNFYLELQD 176

Query: 189  HRGYD-RYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H+  + +    +++++     +PLVATN+  +  +ED EAHD+L+ +    +++ + R +
Sbjct: 177  HKLPEQQQVNEELIKMNQETGIPLVATNDVHYTDQEDAEAHDILLCIQTGKILNDEKRLK 236

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                  YLK + EM  +F   PEAL NTV+IA  C          LP +         K 
Sbjct: 237  FPNDQFYLKTQKEMAKLFDYAPEALANTVKIAEMCQVDFDFDTIHLPNYDVAPG----KT 292

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
            ++  LR     GL+              Q+ ++RL++EL +I +M +  YFLIV DFI++
Sbjct: 293  KQGYLRELCYEGLQY-------RYKEITQELKERLEYELGIIEQMGYMEYFLIVWDFIKY 345

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK   I VGPGRGS AGS+ AY L ITDIDP+R++L+FERFLNP+R+SMPD DIDFC +R
Sbjct: 346  AKDQGIAVGPGRGSAAGSIVAYTLGITDIDPIRYNLIFERFLNPERVSMPDIDIDFCYER 405

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R+EVI YV+ KYG ++VAQIITFG++ A+ A+RDVGR + MPY++VD++ K IP      
Sbjct: 406  REEVINYVKAKYGQDKVAQIITFGTMAARGAIRDVGRVVNMPYNEVDQIAKEIPFTLGIT 465

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +   R+    +   + L+ +++KLEG+ RHASTHAAG+VI  +PL Q +P+Y
Sbjct: 466  IE-KALEVNPVLRKMYQENDDANYLIRMAKKLEGMPRHASTHAAGVVIAKKPLDQHIPLY 524

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-QRGVKVDLSLIPFDD 605
                 +   TQF M  +E+ GL+K DFLGL+TLT+++ +L+ +    G++V      + D
Sbjct: 525  M--HDNSMTTQFTMGTLEELGLLKMDFLGLRTLTVIRDALELIKANHGLEVSFEDSEYTD 582

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
             + Y L+    TLG+FQLES GM Q +  ++PD  EDI+A +SL+RPGP+++I  Y   K
Sbjct: 583  PKVYELIGRGETLGVFQLESQGMIQFMRELKPDNFEDIVAGISLFRPGPMESIPKYIEYK 642

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            N  EKI  +H  ++P+L  T G ++YQEQVMQ+ + L+GYS   +D++RRAMGKK ++ M
Sbjct: 643  NNHEKIEYLHESLEPILNMTYGCMVYQEQVMQVVRDLAGYSYGRSDLVRRAMGKKKRDVM 702

Query: 726  DKQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVIS 773
            +++++ FI             G  + GI + IA  I++ +  FA+Y FNKSHAA+YAV+S
Sbjct: 703  EEERKYFIYGKESEAGELEIEGCIRRGIPENIANEIYDQMIDFANYAFNKSHAASYAVLS 762

Query: 774  YQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDN 833
            YQTA++K HYPVEF+AA MT  M N  K+  + QD ++  ++I+ PS+N     F V DN
Sbjct: 763  YQTAYLKCHYPVEFMAALMTSVMGNTLKVVHYIQDVKRQGMEILSPSINKSYSKFAVEDN 822

Query: 834  RIYYSLAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALD 892
            +I + LAA+K VG      I+E       F S  DFC +V SK LN+R +ESL+  GA D
Sbjct: 823  QIRFGLAAVKNVGGNMIDAIVETRNHKGSFTSFTDFCQKVPSKDLNKRSIESLIKCGAFD 882

Query: 893  CFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFS--DKITLEKFSVENSSV 950
            C    R QLL   + +        K        +F    G  S  ++  L      N  +
Sbjct: 883  CLEVYRAQLLAIYEKVLDSVYHDRKRNIQGQLGLFEGPSGMPSNLNEGLLPNIKEFNDKL 942

Query: 951  RFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEES----------VATIRGNNIRLAAM 1000
            R   E+ VLG Y SGHPL  Y+  L K       +                G+ + +  +
Sbjct: 943  RLNMEKEVLGLYISGHPLAAYEKELSKKVSAYSNQLVLSLEEDDNEQEWKEGDRVIIGGI 1002

Query: 1001 VVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            V+ K  K T+    + +VT  +     E   FP
Sbjct: 1003 VIEKTIKTTKHQQIMAFVTVEDLFGVVECVVFP 1035


>gi|328543710|ref|YP_004303819.1| DNA polymerase III subunit alpha [Polymorphum gilvum SL003B-26A1]
 gi|326413454|gb|ADZ70517.1| DNA polymerase III subunit alpha [Polymorphum gilvum SL003B-26A1]
          Length = 1146

 Score =  809 bits (2088), Expect = 0.0,   Method: Composition-based stats.
 Identities = 565/1028 (54%), Positives = 727/1028 (70%), Gaps = 12/1028 (1%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL+VHS+ SLLEGAL +  +LD   AD QPA+AITDT NLF A EFS KA  AGIQPI
Sbjct: 6    FVHLRVHSALSLLEGALPIKKLLDLAKADAQPALAITDTGNLFGAQEFSGKAWGAGIQPI 65

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGCQL +   D      + +   P +  +VLL ++  GY  L+EL SR YL         
Sbjct: 66   IGCQLAVAFDDG---GGEDRRGEPPLLDVVLLAASEAGYGNLMELSSRAYLDTATGLKPH 122

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHR 190
            +  + L+E  + GLI+LTGG +GPI RA    +  +AE RL      F +R YV LQRH 
Sbjct: 123  VPAALLEEK-SGGLILLTGGVNGPIGRALLAGNRTLAEARLKRLAAAFPNRTYVELQRHG 181

Query: 191  GYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVT 249
              +  R E   ++LAY   LPLVATN + F   EDYEAHD L+ +A   V+ ++DR ++T
Sbjct: 182  MAEERRCEPGFLELAYELGLPLVATNEAFFPKREDYEAHDALICIAEGRVLIEEDRRKLT 241

Query: 250  PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFI--EKECDDIQKEE 307
            P+HY K+R+EM+ +F DLPEA  NTVEIARRC +      PILPRF   + + +  +K E
Sbjct: 242  PEHYFKSRAEMLELFCDLPEATANTVEIARRCHYRPLRRDPILPRFAGADADPEAAEKAE 301

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
              ELR +A  GL+ RL    +A G   QDY  RLD+EL VI RMKF GYFLIVADFI+WA
Sbjct: 302  AEELRRQARDGLKARLEAHGLAPGLGQQDYWDRLDYELGVIERMKFPGYFLIVADFIKWA 361

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K ++IPVGPGRGSGAGSV A+ALTITD+DP+RFSLLFERFLNP+R+SMPDFDIDFCQ RR
Sbjct: 362  KAHDIPVGPGRGSGAGSVVAWALTITDLDPMRFSLLFERFLNPERVSMPDFDIDFCQYRR 421

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
            +EVIRYVQ KYG  +VAQIITFGSLQA+A LRDVGR LQMPY QVDRLCKL+P +PA+PV
Sbjct: 422  EEVIRYVQEKYGRRQVAQIITFGSLQARAVLRDVGRVLQMPYGQVDRLCKLVPANPANPV 481

Query: 488  S-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  QAI D+ R REA   +  VDRLL ++QKLEGLYRHASTHAAG+VIGDRPL QLVP+Y
Sbjct: 482  TLAQAIGDEPRLREAAREEEIVDRLLTMAQKLEGLYRHASTHAAGVVIGDRPLEQLVPLY 541

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
            RD RSD+PV QFNMK +E AGL+KFDFLGLKTLT++  ++  +A++GV VD++ +P DD 
Sbjct: 542  RDPRSDMPVAQFNMKMVEDAGLVKFDFLGLKTLTVIDTAVKLIARKGVTVDMASVPLDDA 601

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
             TY LL    T+G+FQLES GMR+A+ GM+PD  EDIIALV+LYRPGP++NI VYN  K+
Sbjct: 602  RTYQLLARGETVGVFQLESQGMRRAIAGMKPDRFEDIIALVALYRPGPMENIPVYNAVKH 661

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
            G+++   +HPL++P+LKET G+I+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI  EM+
Sbjct: 662  GEQEADYLHPLLEPILKETNGIIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIAAEME 721

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
             Q+ RF+ GA + G+ +  A  IF+L+AKFA+YGFNKSHAAAYA++SY TAW+K ++PVE
Sbjct: 722  VQRARFVDGAVERGVDRDQAGTIFDLVAKFANYGFNKSHAAAYALVSYHTAWLKANHPVE 781

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            F+AASMTL++ N +K+  F Q+AR+  I I+PPS+N     F V D RI Y+L AIKGVG
Sbjct: 782  FMAASMTLDLGNTDKLGDFRQEARRMGIAIVPPSINRSMHPFDVDDGRIVYALGAIKGVG 841

Query: 847  TTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLD 906
                +HI+EA   +PF SL DF  RV  + LN+R LESL  AGA D    +R ++L+ LD
Sbjct: 842  EQAVQHIVEARGTQPFRSLGDFARRVSPRFLNKRTLESLAAAGAFDDLEPNRARVLEGLD 901

Query: 907  NIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSGH 966
             I   AQ  E+N       +F    G   + + L + +    + R + E   +GFY S H
Sbjct: 902  RIIGIAQRTEENSVLGQNELF--GGGGEEEDLHLPEVAAWMPAERLQREHAAIGFYLSSH 959

Query: 967  PLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVTFSEPA 1024
            PLD Y+P+L +M ++ + +   A  RG +  RLA  V+S+Q++KT+ G+R+G V  S+ +
Sbjct: 960  PLDEYQPLLERMRVQSWAQFSEAVKRGASAGRLAGTVISRQERKTKSGNRMGIVRLSDAS 1019

Query: 1025 KEYEANFF 1032
             ++EA  F
Sbjct: 1020 GQFEALLF 1027


>gi|153813022|ref|ZP_01965690.1| hypothetical protein RUMOBE_03430 [Ruminococcus obeum ATCC 29174]
 gi|149830824|gb|EDM85914.1| hypothetical protein RUMOBE_03430 [Ruminococcus obeum ATCC 29174]
          Length = 1155

 Score =  808 bits (2087), Expect = 0.0,   Method: Composition-based stats.
 Identities = 376/1046 (35%), Positives = 587/1046 (56%), Gaps = 41/1046 (3%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL VH+ YSLL+G+  +   +D++      + AITD   ++  ++F + A AAGI PI
Sbjct: 3    FTHLHVHTEYSLLDGSNKIKEYVDRVKELGMDSAAITDHGVMYGVIDFYRAARAAGINPI 62

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +          +  +       +VLL    +GY  L+++VS+ + ++      R
Sbjct: 63   LGCEVYVAPGSRFDR--EAGSGEDRYYHLVLLAENNQGYSNLMKIVSKGF-VEGFYYKPR 119

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            + L  L++   EG+I L+   +G + R       + A+   L ++ +FG    ++ LQ H
Sbjct: 120  VDLQLLEKYH-EGIIALSACLAGEVARFLTRGMYEDAKAAALRYQDIFGKGNFFLELQDH 178

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++     Q++++     + LVATN+  +   ED + HDVL+ +     ++ +DR R 
Sbjct: 179  GIPEQQNVNQQLLKMHRETGIDLVATNDVHYTLAEDAQPHDVLLCLQTGKKLADQDRMRY 238

Query: 249  T-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
                +Y+K+  EM  +F    EALENT +IA+RC   ++     LP+F   +        
Sbjct: 239  EGGQYYVKSPEEMERLFPYATEALENTHKIAQRCHVEIEFGVTKLPKFGVPDG----YTS 294

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L      GLE R            ++ ++RL++EL  I  M +  YFLIV DFI++A
Sbjct: 295  WEYLNELCFKGLEERYQP-------VTEELKERLNYELTTIKNMGYVDYFLIVWDFIKYA 347

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            + ++I VGPGRGS AGS+ AY L IT +DP+R+ LLFERFLNP+R+SMPD D+DFC +RR
Sbjct: 348  RDHDIMVGPGRGSAAGSLVAYTLGITQLDPIRYDLLFERFLNPERVSMPDIDVDFCFERR 407

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV+ KYG + V QI+TFG+L A+  +RDVGR + +PY+QVD + K+IP +    +
Sbjct: 408  QEVIDYVRRKYGDDCVVQIVTFGTLAARGVIRDVGRVMDLPYAQVDTIAKMIPQELNITI 467

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+  +  F++    D  +  L++ +++LEGL RH S HAAG+VI  + +S+ VP+ R
Sbjct: 468  D-KALQMNPEFKKVYEEDKEIHELIDTAKRLEGLPRHTSMHAAGVVISQKDVSEYVPLSR 526

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
                   VTQF M  +E+ GL+K DFLGL+TLT++Q ++  + Q  GVK+D+  I ++D 
Sbjct: 527  AS-DGSIVTQFTMTTLEELGLLKMDFLGLRTLTVIQNAVHLVEQDTGVKLDMQHIDYNDK 585

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            +    L T  + G+FQLES+GM+  ++ ++P  +ED+IA +SLYRPGP+D I  Y   KN
Sbjct: 586  KVLDSLGTGHSDGVFQLESAGMKNFMKELKPQSLEDVIAGISLYRPGPMDFIPQYIRGKN 645

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              + I    P ++P+LK T G I+YQEQVMQI + L+GY+L  +D++RRAM KK    M+
Sbjct: 646  RPDTIKYDCPQLEPILKPTYGCIVYQEQVMQIVRNLAGYTLGRSDLVRRAMSKKKAAVME 705

Query: 727  KQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            K+++ F+         G   NGI +  A  I++ +  FA Y FNKSHAAAYAV+SYQTA+
Sbjct: 706  KERQNFVYGNEAEGVPGCIANGIPEQTANKIYDDMIDFAKYAFNKSHAAAYAVVSYQTAF 765

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K +YPVEF+AA MT  ++   K+ ++ Q  R+ NI+I+PP VN     F V +  I Y 
Sbjct: 766  LKYYYPVEFMAALMTSVIEMPIKVAEYIQVCRKMNIKILPPDVNRGAYGFSVDNGAIRYG 825

Query: 839  LAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            L+AIK VG      ++E   A+  + SL+DF  R+ +  +N+R +E+ + AGALDC   +
Sbjct: 826  LSAIKSVGRPVINALVEEREANGEYRSLKDFIERL-TGTVNKRAIENFIKAGALDCLEGN 884

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFENE 955
            R Q +     I       +KN      ++F    E+     +I +      +  +    E
Sbjct: 885  RRQKMVVYSQIVDSIAQEKKNSFAGQMSLFDLVGEEDKKDYEIRMPDVEEYDKDMILGFE 944

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATI--------RGNNIRLAAMVVSKQQK 1007
            + VLG Y SGHPL+ Y+ I+ KM      +              G  + +  M+  K  K
Sbjct: 945  KDVLGIYLSGHPLEKYRNIMEKMISARTIDFQPDEESGIPKVYDGQKVIIGGMITEKTIK 1004

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             TR    + ++T  +     E   FP
Sbjct: 1005 YTRNNKVMAFLTLEDLMGTVEIVVFP 1030


>gi|253682356|ref|ZP_04863153.1| DNA polymerase III subunit alpha [Clostridium botulinum D str. 1873]
 gi|253562068|gb|EES91520.1| DNA polymerase III subunit alpha [Clostridium botulinum D str. 1873]
          Length = 1166

 Score =  808 bits (2086), Expect = 0.0,   Method: Composition-based stats.
 Identities = 364/1061 (34%), Positives = 590/1061 (55%), Gaps = 57/1061 (5%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL  H+ YSLL+G+  +  ++ +       ++AITD   +F  ++F +KA  AGI+PI
Sbjct: 6    FVHLHTHTEYSLLDGSGKIGGLISRAKELGMKSLAITDHGTMFGCVDFYKKAKDAGIKPI 65

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +            +        +VLLV   +GY+ L+++VS+  + +      R
Sbjct: 66   IGCEIYVSSNSMHIKRLDAENR---NHHLVLLVKNEQGYKNLMKIVSKASI-EGFYYKPR 121

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHR 190
            +   +L+E  +EGLI L+   +G +       + + A +  L +K +F +  Y+ LQ H 
Sbjct: 122  VDHEYLKE-HSEGLIALSACLAGEVSYNLLNGTKEKAREIALFYKDIFKEGFYIELQYHG 180

Query: 191  GYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVT 249
               + R    +V+LA   ++PLVATN+  ++ +ED ++H+VL+ +     +  +DR +  
Sbjct: 181  IDKQLRVNEMLVELARELDIPLVATNDVHYIKKEDAKSHEVLLCIQTGKTLDDEDRMKYE 240

Query: 250  PDHYL-KNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEE 308
            P ++  K+  EM   FS + +ALENT +IA  C+F    H   LP F   E  D      
Sbjct: 241  PQNFYLKSPEEMYETFSYVSDALENTNKIADECNFDYIFHESKLPNFPLPEGID----HF 296

Query: 309  NELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAK 368
              ++     GLE       I       + ++RL++EL+VI  M +  YFLIV DF +++ 
Sbjct: 297  EYMKELCYKGLE-------IRYEKVTDELKERLEYELDVIKEMGYVDYFLIVWDFFRFSH 349

Query: 369  KNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRD 428
            +  I  GPGRGS AGS+ AY L IT IDP++++L+FERFLNP+R+SMPD D DFC +RR 
Sbjct: 350  EKGIMTGPGRGSAAGSLVAYTLGITKIDPIKYNLIFERFLNPERVSMPDIDSDFCYERRG 409

Query: 429  EVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVS 488
            EVI YV  KYG + V+QI+TFG++  +A +RDVGRA+   Y++VDR+ K+IP      + 
Sbjct: 410  EVIDYVVEKYGKDNVSQIVTFGTMAPRACIRDVGRAMNYSYAEVDRIAKMIPTVLGITID 469

Query: 489  LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRD 548
             +A+  +   RE    D  +  L+++++ LEGL RH STHAAG+VI  +PL   VP+ ++
Sbjct: 470  -KALEMNPELREVYDKDTRIKELIDVARDLEGLPRHTSTHAAGVVIASQPLVNYVPLSKN 528

Query: 549  VRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDDHE 607
               +  VTQF M  +E+ GL+K DFLGL+TLT+++ +++ + +   +++DL  I F+D  
Sbjct: 529  --EEAIVTQFTMTTLEELGLLKMDFLGLRTLTVIRDAIELIKKNTGIEIDLDKINFEDEN 586

Query: 608  TYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKNG 667
             Y++L    T+G+FQLES+GM   ++ ++P+ +EDIIA +SLYRPGP+  I  Y   KN 
Sbjct: 587  VYNMLGKGKTVGVFQLESAGMTNFMKELKPESLEDIIAGISLYRPGPMAEIPKYIKNKNN 646

Query: 668  KEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDK 727
             + I  I P ++ +L  T GV++YQEQVMQI + L+GYS+  +D++RRAM KK  + M++
Sbjct: 647  PKNIEYITPELEGILNVTYGVMVYQEQVMQIVRDLAGYSMGRSDLVRRAMSKKKHKVMEE 706

Query: 728  QKERFIS-----------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQT 776
            +++ FI            G  +NGIS+  A  I++ +  FA Y FNKSHAAAY V++Y T
Sbjct: 707  ERKNFIYGIEENGKVVVPGCLRNGISEESANKIYDQMMDFASYAFNKSHAAAYGVVAYYT 766

Query: 777  AWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIY 836
            A++  +YP EF+AA +     N +K+  + + A+Q +I+ +PP +N     F V + +I 
Sbjct: 767  AYLVHYYPTEFMAAMLNSVRGNSDKVAIYIRAAKQMDIETLPPDINKSFGKFTVQNGKIR 826

Query: 837  YSLAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFG 895
            + L+AIK VG      I+++  +   F+S  DFC+++    +N+R++ESL+ AG  D FG
Sbjct: 827  FGLSAIKNVGENIIDVIVKSREEKGEFNSFVDFCNKISMGSINKRMVESLIKAGVFDSFG 886

Query: 896  YSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFSVENSSVRFEN 954
              R QLL   + I        K       ++F +    F   +I        N   +   
Sbjct: 887  IYRSQLLAVYEKIIDSVVSQRKKNIEGQVSLFGNFDNEFKGVEIKYPAIDEFNKKSKLAM 946

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV----------------------ATIRG 992
            E+ + G Y +GHPL+ Y+ IL+        + +                          G
Sbjct: 947  EKEMTGLYLTGHPLEDYEEILKNATSAKTTDIIMDESLEEDLVDEVTLHVEEQNSKIKDG 1006

Query: 993  NNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + + +  ++ +  +K T+  S + ++   +     E   FP
Sbjct: 1007 DKVIIGGLITNVTRKITKTNSMMAFINLEDLYSSIEVIIFP 1047


>gi|158423315|ref|YP_001524607.1| DNA polymerase III subunit alpha [Azorhizobium caulinodans ORS 571]
 gi|158330204|dbj|BAF87689.1| DNA polymerase III alpha subunit [Azorhizobium caulinodans ORS 571]
          Length = 1144

 Score =  808 bits (2086), Expect = 0.0,   Method: Composition-based stats.
 Identities = 546/1030 (53%), Positives = 727/1030 (70%), Gaps = 11/1030 (1%)

Query: 7    KSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAG 66
            + P FVHL VHSSYSLLEGAL+L  + D   AD QPA+A+TDT NLF ALEFS+K   AG
Sbjct: 2    RDPGFVHLHVHSSYSLLEGALTLGKLADFAKADAQPALALTDTGNLFGALEFSEKMYGAG 61

Query: 67   IQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            IQPI GC L +D+ + +      +   P  P IVLL +  +G++ L+ LVSR YL     
Sbjct: 62   IQPIAGCSLALDLPEPVAP----RGIVPKKPRIVLLAAREQGWRNLMTLVSRAYLETPDG 117

Query: 127  QSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNL 186
            +  R+ L WL E+  +GLI LTGG +GP+D+A       VA  RL     ++GDRLYV L
Sbjct: 118  EEPRVTLDWLSEL-NDGLIALTGGPAGPLDKALVAGHGDVAASRLDQLTAIYGDRLYVEL 176

Query: 187  QRHR-GYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDR 245
            QRH    +R  E  ++ LAY   LPLVA N   F ++ DY AHD L+A+A S ++S+ DR
Sbjct: 177  QRHNWDPERIAEPGLLDLAYAKGLPLVAANEPFFGAQSDYNAHDALIAIAESKLLSEGDR 236

Query: 246  PRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
             R+TP+H  K R+EM+ +F+DLPEA  NTVEIA+RC++ ++   PILPRF      D   
Sbjct: 237  RRLTPEHRFKTRAEMLELFADLPEATANTVEIAQRCAYRVRTAKPILPRFTSGGGGDALA 296

Query: 306  EEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
            EE  EL  +A  GL  RLA+   A+G   + Y +RL +E++VI +MKF GYFLIV+DFI+
Sbjct: 297  EEAAELERQAQEGLAARLAKHGPAEGLDTKIYEERLAYEISVITKMKFPGYFLIVSDFIK 356

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            WAK ++IPVGPGRGSGAGS+ AY+L ITD+DPLRF LLFERFLNPDR+SMPDFD+DFCQD
Sbjct: 357  WAKAHDIPVGPGRGSGAGSLVAYSLQITDLDPLRFGLLFERFLNPDRVSMPDFDVDFCQD 416

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RR+EVI YVQ +YG  +VAQIITFG+LQA+  LRDVGR L+MPY QVD+LCKL+P +PA+
Sbjct: 417  RREEVIDYVQKRYGRSQVAQIITFGTLQARGVLRDVGRVLEMPYGQVDKLCKLVPQNPAN 476

Query: 486  PVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
            PV+  QAI ++ R +EAR  +  V +  +I+ +LEGL RHASTHAAGIVIGDRPL +LVP
Sbjct: 477  PVTLKQAIEEEPRLQEARDEEEVVKQAFDIAVRLEGLNRHASTHAAGIVIGDRPLHELVP 536

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFD 604
            +YRD +SD+PVTQ+NMKW+E+AGL+KFDFLGLKTLT +  ++  + QRG+ +D+S IP D
Sbjct: 537  LYRDPKSDMPVTQYNMKWVEQAGLVKFDFLGLKTLTTITTAVKLIRQRGIDLDISKIPLD 596

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNR 664
            D +TY +L    T+G+FQ+ES+GMR+AL  M+ D IED+IALV+LYRPGP+ NI VY + 
Sbjct: 597  DPKTYAMLARGETVGVFQVESAGMRRALVDMKADRIEDLIALVALYRPGPMANIPVYCDC 656

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G+ +   IHP ++P LKET GVIIYQEQVMQIAQ LSGYSL EAD+LRRAMGKKI+ E
Sbjct: 657  KHGRAEPDYIHPKLEPYLKETFGVIIYQEQVMQIAQALSGYSLGEADLLRRAMGKKIRAE 716

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            M+KQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA+++YQTAW+K +Y 
Sbjct: 717  MEKQRARFVDGAQERGVPKAQADTIFDLLAKFADYGFNKSHAAAYALVAYQTAWLKANYA 776

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKG 844
             EFLAASMTL+M N +K+ +F Q+A++  IQ++PP++N    DF V D +I Y++AAIKG
Sbjct: 777  TEFLAASMTLDMGNTDKLAEFRQEAQRLGIQVVPPNINLSHRDFAVVDGKIIYAMAAIKG 836

Query: 845  VGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQS 904
            VG      ++ +   +PF  L DF +R   K LN+R LE+L  AG  D    +R ++  +
Sbjct: 837  VGGHAVDALVASRGKEPFTDLADFANRFPVKHLNKRTLENLAAAGCFDVLEKNRARVFAA 896

Query: 905  LDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFS 964
            LD +  +AQ VE +R++   ++F    G    K+ L        + R + E   +GF+ +
Sbjct: 897  LDAVVAHAQRVEADRSSGQNDMFG--SGPVKAKLPLPDAQPWEPAERLKREYDTIGFFLT 954

Query: 965  GHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVTFSE 1022
            GHPLD Y P L+KM ++ + +   A  +G    RLAA VVS+Q++KT+ G+R+G V  S+
Sbjct: 955  GHPLDDYAPALKKMRVQQFSDFSRAVRQGAAAGRLAATVVSRQERKTKTGNRMGIVGLSD 1014

Query: 1023 PAKEYEANFF 1032
            P+  +EA  F
Sbjct: 1015 PSGHFEAVLF 1024


>gi|225018880|ref|ZP_03708072.1| hypothetical protein CLOSTMETH_02830 [Clostridium methylpentosum DSM
            5476]
 gi|224948350|gb|EEG29559.1| hypothetical protein CLOSTMETH_02830 [Clostridium methylpentosum DSM
            5476]
          Length = 1155

 Score =  807 bits (2085), Expect = 0.0,   Method: Composition-based stats.
 Identities = 372/1032 (36%), Positives = 580/1032 (56%), Gaps = 28/1032 (2%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL +H+ +SLL+GA  +  +        Q A+AITD  N+F  ++F     A GI+PI
Sbjct: 26   FVHLHLHTEFSLLDGACRIKELAAYAKKLGQDALAITDHGNMFGTIDFYSACKAEGIKPI 85

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +  +      ++  T       +VLL     GY+ LI+LVS  Y+ +      R
Sbjct: 86   IGCEVYVAPRTRFDKVHRIDTSPN---HLVLLCKNETGYRNLIKLVSAGYI-EGFYSRPR 141

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            I  + LQE  +EGLI L+   +G I RA        A++    ++   G D  ++ LQ H
Sbjct: 142  IDHNLLQE-HSEGLIALSACLAGEIPRALTAGDYGRAKQIAEFYRDTMGPDNYFIELQDH 200

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++     Q+V+LA    + LVATN+  ++  ED +   VL+ +     + ++     
Sbjct: 201  GIKEQRAILPQLVKLAQQVGVGLVATNDVHYIRREDSKTQKVLLCIQTGKTLDEELAIEF 260

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
             T + YLK+  EM S+F     A+ENT  IA RC+   +     LP F     +D +   
Sbjct: 261  PTQEFYLKSEEEMQSLFGSFEGAIENTARIAERCNLEFEFGVTKLPHFEPPNGEDNK--- 317

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
                      GL+    +              R  +E++VI  M F  Y+LIV DF+++A
Sbjct: 318  -EFFLRLCHDGLKKYYGEQPD------PKILDRFHYEIDVIDSMGFVDYYLIVYDFVRYA 370

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K++ IPVGPGRGSGAGS+ AY + IT IDP++++LLFERFLNP+R+SMPDFDIDFC +RR
Sbjct: 371  KEHGIPVGPGRGSGAGSIIAYCIGITGIDPIKYNLLFERFLNPERVSMPDFDIDFCYERR 430

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EV+ YV  KYG + VAQI+TFG+L A+ A+RDVGR + MPY  VD++ K +P  P   +
Sbjct: 431  PEVLDYVIRKYGADHVAQIVTFGTLAARGAIRDVGRVMGMPYDVVDKIAKQVPIHPGITI 490

Query: 488  SLQA-IADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            ++ + +      +    +DP V  L++ ++KLEG+ R+ STHAAG+VI D+P++  VP+ 
Sbjct: 491  TIDSALKKSPELKAMADSDPQVRELIDTARKLEGMPRNTSTHAAGVVITDKPVTDYVPLS 550

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
            ++   +  VTQ+ M  I   GL+K DFLGL+ LT++  +   + +   +  ++ IP DD 
Sbjct: 551  KN--DESIVTQYTMNTIADLGLLKMDFLGLRNLTVISDAERGVRRFEPEFAINKIPLDDK 608

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            ET+ +L+   + G+FQ ES+GMR+ L  M+PDC+ED+IA++SLYRPGP   I  +   + 
Sbjct: 609  ETFDMLSQGQSDGVFQFESAGMRKMLSRMKPDCLEDLIAVLSLYRPGPAQFIDAFIENRI 668

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E+I      +  +L  T GVI+YQEQVMQI + L+GYS   ADV+RRA+ KK    M+
Sbjct: 669  HPERITYRDERLRHILDVTYGVIVYQEQVMQIFRELAGYSYGRADVVRRAISKKKAGVME 728

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
            +++ +FI GA  NG+S+  A  IF  ++ FA Y FNKSHAAAY+++SYQTA++K HYP E
Sbjct: 729  QERIKFIEGAVANGLSERDAEAIFNDMSSFASYAFNKSHAAAYSLVSYQTAYLKCHYPRE 788

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            ++AA +   + + +K+  +  + R+ +IQ++PP +N   + F V D  I + L A+K VG
Sbjct: 789  YMAALLNSVIYSTDKVISYIGECRKQHIQVLPPDINRSQIGFTVSDGSIRFGLLAVKKVG 848

Query: 847  TTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSL 905
                  I+E   A+  F+SL +F  R+ +++LN+  + + +  GA D F  +R Q+ +S 
Sbjct: 849  KGVIERIVEEREANGAFESLYNFVERMHNRELNKAAILAFIQCGAFDSFEENRRQMAESY 908

Query: 906  DNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSG 965
            + I +     +++  N   N+F    GT  +K +  +     +      E++  G Y S 
Sbjct: 909  ERIVESVNSSKRSNINGQINLFETVTGT--EKFSYPELEEYTTDELMAMERQTTGLYISS 966

Query: 966  HPLDVYKPILRKMGIKGYEESVATI----RGNNIRLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            HPLD +   L+   I    E          G +  L A+V S ++ +T+ G+ + +    
Sbjct: 967  HPLDRFDKQLKGRRIDQISEIQQEESSYCDGAHAELGAIVASVKRIQTKGGALMAFAELE 1026

Query: 1022 EPAKEYEANFFP 1033
            +     EA  FP
Sbjct: 1027 DRTGSIEAVVFP 1038


>gi|313895480|ref|ZP_07829036.1| DNA polymerase III subunit alpha [Selenomonas sp. oral taxon 137 str.
            F0430]
 gi|312975606|gb|EFR41065.1| DNA polymerase III subunit alpha [Selenomonas sp. oral taxon 137 str.
            F0430]
          Length = 1130

 Score =  807 bits (2085), Expect = 0.0,   Method: Composition-based stats.
 Identities = 378/1032 (36%), Positives = 591/1032 (57%), Gaps = 26/1032 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL VH+ YSLL+GA  +  ++ +       +IAITD   ++ A+ F ++A A GI P
Sbjct: 2    SFVHLHVHTEYSLLDGASRIKELVQRTKELGMDSIAITDHGVMYGAIAFYKEAMAQGIHP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  Q   +              ++LL     GY+ L+ LVS   + +      
Sbjct: 62   IIGCEVYVAPQSRHERAEVDGVR---YYHLILLAENEIGYRNLVRLVSLANI-EGYYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L++   EG+I L+   +G I R+      +  ++ L  +  +FG D  ++ LQ 
Sbjct: 118  RVDKDLLRQYH-EGIIALSACVAGEIPRSILRGDPERTDEILAEYVDIFGRDNFFLELQD 176

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   +       +  L+  H++ LVATN+  ++  ED E HD+L+ V     ++  +R R
Sbjct: 177  HGLPEEKTVNHALRDLSKKHDIGLVATNDIHYVRAEDSEFHDILLCVQTGRTINDPNRMR 236

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
             + PD+YLK+ +EM ++F D P A+ENT +IA RC          LP +   E      +
Sbjct: 237  FSGPDYYLKSEAEMTALFHDYPGAVENTAKIAARCRVDFTFGELQLPFYPIPEKF---AD 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
            ++  LR            +          + R RLD+EL VI  M ++ YFLIV DFI +
Sbjct: 294  DDAYLRTLCEE-------RLPERYSEITNEIRSRLDYELGVIHGMGYASYFLIVWDFINY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+ + + VGPGRGS AGS+ AY L IT+IDPLR++LLFERFLNP+R+SMPD DIDF    
Sbjct: 347  ARGHGVAVGPGRGSAAGSIVAYLLGITNIDPLRYALLFERFLNPERVSMPDIDIDFDDIN 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R  VI YV+ +YG + VAQI TFG++ AK A+RDVGR L+M +S+V  + KL+P++    
Sbjct: 407  RGRVISYVKERYGEDHVAQIATFGTMGAKGAIRDVGRVLEMSFSEVSNITKLVPSELNIT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+ + + FR     D SV R++++++K+EGL R+ S HAAG+VI   PL+  VP++
Sbjct: 467  ID-RALKESADFRRLYDEDESVRRVIDLARKIEGLPRNTSIHAAGVVIAKEPLTNHVPVW 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-QRGVKVDLSLIPFDD 605
              +     VT+F+   +E  GL+K DFLGL+TL++++ +L  +    G+ +D+  IP +D
Sbjct: 526  --ISEGTLVTEFDKDDVEALGLLKMDFLGLRTLSIIEDALKNIRTSHGIDIDIDNIPLED 583

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNN 663
              T  +L    T  +FQ+ES+GM   ++ +QP    D+I  V+LYRPGP+ + +   + +
Sbjct: 584  DLTAQMLCDGDTGAVFQMESAGMTNLVKDLQPKGFVDLIPTVALYRPGPLGSGMVTDFID 643

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
              +GK+++V +HPL++P+LKET GV++YQEQVMQI Q+L+G++L +AD+LRRAMGKK   
Sbjct: 644  GLHGKKEVVYMHPLLEPILKETFGVVLYQEQVMQIVQVLAGFTLGQADLLRRAMGKKKHA 703

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             +  QKE F++G + NGI   +A +IF+LL  FADYGFNKSH+A+Y ++++QTA++K HY
Sbjct: 704  LLMAQKESFLAGCANNGIDAPLANHIFDLLTHFADYGFNKSHSASYGLLAWQTAYLKAHY 763

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEF+A  +T  MD  +KI  + +   Q  I+I+PP +N+    F +    I + LAA++
Sbjct: 764  PVEFMAGVLTSIMDKTDKIPVYIRLCHQMKIRILPPDINSSAATFSIESGAIRFGLAAVR 823

Query: 844  GVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG      +     +  PF SL DFC+RVD + LN+R +ESL+  GA D  G  R  LL
Sbjct: 824  NVGENAIAVLEHVREEGGPFRSLVDFCTRVDLRTLNKRAIESLIKCGAFDSLGIDRNHLL 883

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKI-TLEKFSVENSSVRFENEQRVLGF 961
             SL+     A   +++  +    +F  +      +I   +   +     R   E+   GF
Sbjct: 884  ASLNAAVTDAARRQRDLLSGQIGLFGDDAMAEVQQIGDFDDVPLCTPRERLTWEKEATGF 943

Query: 962  YFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            Y +GHPL+ Y+  L  +   G   +        +R+  ++ S ++  T+KG  + +    
Sbjct: 944  YITGHPLEDYQETLSHLQPIGQIAAAVQRDRQLMRVGGILTSTKRFTTKKGDTMLFADLE 1003

Query: 1022 EPAKEYEANFFP 1033
            +     E   FP
Sbjct: 1004 DFTGTLEVTVFP 1015


>gi|124514840|gb|EAY56352.1| DNA polymerase III, alpha subunit [Leptospirillum rubarum]
          Length = 1201

 Score =  807 bits (2085), Expect = 0.0,   Method: Composition-based stats.
 Identities = 414/1045 (39%), Positives = 610/1045 (58%), Gaps = 21/1045 (2%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +  +  FVHL VH+ YSLL+GA  ++ ++ K  A+  PAIA+TD  NLF A+EF Q A  
Sbjct: 1    MSSTDQFVHLHVHTQYSLLDGANKIDPLIRKARAENMPAIAMTDHGNLFGAIEFFQTAKK 60

Query: 65   AGIQPIIGCQLDIDMQDNLKM---------TNQGKTPFPTVPSIVLLVSTAEGYQRLIEL 115
             G++PIIGC++ I  +               +Q K        ++LL     GY+ L+++
Sbjct: 61   HGVKPIIGCEVYITPRSRFDRQDLYFGGDGPHQAKKINNASFHLILLAENDTGYRNLLKI 120

Query: 116  VSRMYLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFK 175
            VS  +L +      RI L  L     EGLI L+G   G I        +  A      F+
Sbjct: 121  VSLSHL-EGFYYRPRIDLELLSR-HHEGLIALSGCLKGQISYMLTRGDTDRAYATAGLFR 178

Query: 176  KLFG-DRLYVNLQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMA 233
            ++FG +  +  +Q +   D+     +++ L+    +PLVATN+  +L  ED   HD+L+ 
Sbjct: 179  EIFGPENYFFEVQANGLEDQRIANREIIGLSKKLSIPLVATNDCHYLEREDSVPHDILLC 238

Query: 234  VAHSTVVSQKDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPIL 292
            +     +    R R  + + YLK   EMV  F +LPEA+ENT+ IA R    + +    +
Sbjct: 239  LQTGKTLEDPARLRFGSDEFYLKTPREMVRSFEELPEAIENTLRIADRIDVSIDLQTTHM 298

Query: 293  PRFIEKECDDIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMK 352
            P +   E               +  GL+ R  +   +    A  Y +RL+ E+ VI +M 
Sbjct: 299  PSYRLDENQGQTTTVPELFVRTSREGLDARFQENTFSDTEKA-LYLERLEREIQVIQKMG 357

Query: 353  FSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDR 412
            + GYFLIV DFI+ A++  IPVGPGRGS AGSV A++L IT+IDP+RF LLFERFLNP+R
Sbjct: 358  YEGYFLIVWDFIRKAREMGIPVGPGRGSAAGSVVAWSLRITNIDPIRFGLLFERFLNPER 417

Query: 413  MSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQV 472
            +S+PD D+DFC +RR EVI+YV ++YG +RVA I TFG++ AK ++RDVGR L M Y++V
Sbjct: 418  VSLPDIDVDFCMNRRGEVIQYVVDRYGMDRVAMIATFGTMGAKGSIRDVGRVLGMTYAEV 477

Query: 473  DRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGI 532
            DR+ K+IPN     +    + ++   R     DP ++ L  +S+KLEG+ RH+S HAAG+
Sbjct: 478  DRVAKMIPNSLDMTLEKA-LEENPDLRALLEKDPRMEELFSLSRKLEGITRHSSIHAAGV 536

Query: 533  VIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR 592
            VI   PL + VP+ R   +   VTQF    +EK GL+KFDFLGL TLTL+Q + + +   
Sbjct: 537  VISREPLLEHVPLMRGA-NGEIVTQFTKDDVEKVGLVKFDFLGLTTLTLIQGAENRIQAH 595

Query: 593  GVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRP 652
                    IP DD  TY LL+   TLGIFQLES GM   +  MQP+  ED+IAL++LYRP
Sbjct: 596  TPDFSADRIPLDDARTYRLLSEGKTLGIFQLESRGMTDLIMKMQPETFEDLIALLALYRP 655

Query: 653  GPIDNIV--VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEA 710
            GPI++ +   +  RK    +I    P ++P+L+ET GVI+YQEQVMQIA +L+G+SL EA
Sbjct: 656  GPINSGMVDDFIKRKKNPREIRYELPELEPVLRETYGVIVYQEQVMQIANVLAGFSLGEA 715

Query: 711  DVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYA 770
            D+LRRAMGKK  EEM K +++F+ GA + G  K  A ++FEL+A FA YGFNKSH+AAYA
Sbjct: 716  DLLRRAMGKKKPEEMAKMQDKFVDGAIRKGFPKEKATHVFELMAYFAGYGFNKSHSAAYA 775

Query: 771  VISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKV 830
            +ISYQTA++K HYP+E  AA +T  +D+ EKI  F   A+   I+++ P +N    DF +
Sbjct: 776  LISYQTAYLKAHYPLELWAALLTNALDDTEKIGVFLAGAKDMGIEVLAPDINQSEFDFAI 835

Query: 831  -GDNRIYYSLAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFA 888
               +RI + L A+K VG      I+EA A+  PF    DF  R+  KK+NRRV+E+L+ A
Sbjct: 836  LPGSRILFGLGAVKNVGKQAVDCILEARANDGPFVDFPDFLKRIVGKKVNRRVIEALIRA 895

Query: 889  GALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENS 948
            GA    G  R   ++SLD++  +A+  +  + +  +++F+ ++G  S    L +    + 
Sbjct: 896  GAFRSLGIRRSVAMESLDDLLAWAEKQKSGKGSLQKSLFSEDQGGRSSGPPLREVPEWDE 955

Query: 949  SVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKK 1008
             +    E+  LGFY + HP+  Y  +L K+  +      +   G  +R+ A+V + ++ K
Sbjct: 956  RMLLREEKNALGFYLTSHPMARYADLLLKLDTRSTRSLESVSEGETVRVFAVVSALREVK 1015

Query: 1009 TRKGSRIGWVTFSEPAKEYEANFFP 1033
            T+KG ++  +T  +     EA  FP
Sbjct: 1016 TKKGDKMAQLTLLDMEGTIEAVLFP 1040


>gi|300853524|ref|YP_003778508.1| DNA polymerase III subunit alpha [Clostridium ljungdahlii DSM 13528]
 gi|300433639|gb|ADK13406.1| DNA polymerase III, alpha subunit [Clostridium ljungdahlii DSM 13528]
          Length = 1158

 Score =  807 bits (2084), Expect = 0.0,   Method: Composition-based stats.
 Identities = 383/1059 (36%), Positives = 594/1059 (56%), Gaps = 50/1059 (4%)

Query: 5    LEK-SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKAC 63
            ++K    +V L  H+ YSLL+ +  +  ++ +       ++AITD   ++  +EF ++A 
Sbjct: 1    MDKGKHRWVSLHQHTEYSLLDSSAKIPELIARAKELGMDSMAITDHGVMYGCVEFYKEAR 60

Query: 64   AAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLD 123
            A GI+PIIGC++ +   D     N GK        +VLLV   EGYQ L+++VS   +  
Sbjct: 61   AQGIKPIIGCEIYVSQGDMTIKQNNGKN---ENYHLVLLVKNEEGYQNLMKIVSTASIKG 117

Query: 124  QGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLY 183
                  R+  ++L +  +EGLI L+   SG +       +   AE+  L +K  F D  Y
Sbjct: 118  -FYYKPRVDHNYL-KNHSEGLIALSACMSGEVQSNILKGNIDKAEETALFYKSAFKDGFY 175

Query: 184  VNLQRHRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + +Q H    +     Q++ ++    +PLVATN+  ++ +EDY AHD+L+ +     V +
Sbjct: 176  LEIQYHGIEAQLKINEQLISMSKKLNIPLVATNDVHYIKKEDYRAHDILLCIQTGKTVDE 235

Query: 243  KDRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
            ++R R  + + YLK+  EM  +FS++PE+LENT++IA +C+F  + H   LP+F   E  
Sbjct: 236  ENRMRYPSDEFYLKSPDEMYDMFSNVPESLENTIKIADQCNFDYEFHKSKLPKFPLPEDT 295

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
            D        +++    GL                + + RL++EL +I +M +  YFLIV 
Sbjct: 296  DPY----EYMKDLCYKGLYK-------RYNDVTDELKSRLEYELGIIKKMGYVDYFLIVW 344

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DFI++A+KN I  GPGRGSGAGS+ AY L IT IDP+++ L+FERFLNP+R+SMPD D D
Sbjct: 345  DFIRFARKNGIMTGPGRGSGAGSIVAYTLEITKIDPIKYKLIFERFLNPERVSMPDIDSD 404

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FC +RR EVI YV  KYG + V+QIITFG++ AK  +RDVGRA+   Y +VDR+ K+IP+
Sbjct: 405  FCYERRGEVIDYVVEKYGKDSVSQIITFGTMAAKMCIRDVGRAMNYSYGEVDRIAKMIPS 464

Query: 482  DPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
             P   +  +A+  +  F+EA  ++     L++I++ LEGL RH STHAAG+VI   PL  
Sbjct: 465  IPNITID-KALDMNPEFKEAYDSESRTKELIDIARALEGLPRHTSTHAAGVVIASEPLVN 523

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSL 600
             VP+ ++   D  VTQF M  +E+ GL+K DFLGL+TLT+L+ +++ + + +G+++DL  
Sbjct: 524  YVPLQKN--EDNIVTQFTMNTLEELGLLKMDFLGLRTLTVLRDAVEMIKEDKGIEIDLDT 581

Query: 601  IPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVV 660
            I +DD   Y+++    T+G+FQLES G    ++ ++PD +EDIIA +SLYRPGP+  I  
Sbjct: 582  IDYDDKAVYNMIGEGKTVGVFQLESPGFSSFMKELKPDSLEDIIAGISLYRPGPMSEIPK 641

Query: 661  YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKK 720
            Y   KN  E I  + P ++ +L  T G ++YQEQVMQI + L+GYS+  +D++RRAM KK
Sbjct: 642  YIKNKNNPEGIEYVTPQLEHILSVTYGCMVYQEQVMQIVRDLAGYSMGRSDLVRRAMSKK 701

Query: 721  IKEEMDKQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAA 768
                M++++  F+             G  +NGIS+ IA +IF+ +  FA Y FNKSHAAA
Sbjct: 702  KHHVMEEERHNFVYGIVDEKGEIQVPGCVRNGISEKIANDIFDSMMDFASYAFNKSHAAA 761

Query: 769  YAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDF 828
            YAV++++TA++  +YP EF AA +     + EK+  + + A+   I+IMPPS+N  C  F
Sbjct: 762  YAVVAFRTAYLMYYYPTEFTAAMLNSVKGDSEKVAYYIRFAKSIGIEIMPPSINESCTKF 821

Query: 829  KVGDNRIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVF 887
             V D  I + L+AIK VG      I+ +      F  + DFC+ +D   +N+RV+ESL+ 
Sbjct: 822  TVEDGNIRFGLSAIKNVGENVIDSIVRSRSKHGKFKDIVDFCNSIDLDSINKRVVESLIK 881

Query: 888  AGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVEN 947
            AGA DCFG  R QL+   + +        K       ++F+  + + S +I         
Sbjct: 882  AGAFDCFGVLRSQLIAVHEKVIDSVINSRKKNIEGQVSLFSQIEDS-SVRIKYPSIEEFK 940

Query: 948  SSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATI-------------RGNN 994
                   E+ + G Y SGHPLD Y   L         + V                 G+ 
Sbjct: 941  KLDMLAMEKEMTGLYLSGHPLDEYARTLELQADTKISDIVGRKTLEDNFVEEAKVNDGDR 1000

Query: 995  IRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + +  ++    +K T+    + +    +     E   FP
Sbjct: 1001 VIVGGILSEVSKKITKNNDMMAFAKLEDLYGIMEIIVFP 1039


>gi|160878493|ref|YP_001557461.1| DNA polymerase III DnaE [Clostridium phytofermentans ISDg]
 gi|160427159|gb|ABX40722.1| DNA polymerase III, alpha subunit [Clostridium phytofermentans ISDg]
          Length = 1186

 Score =  807 bits (2084), Expect = 0.0,   Method: Composition-based stats.
 Identities = 373/1077 (34%), Positives = 586/1077 (54%), Gaps = 66/1077 (6%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL VH+ +SLL+G+  +  +  +       A+AITD   ++  ++F +   A GI+P
Sbjct: 2    SFTHLHVHTEFSLLDGSGKIKEMAAQAKKLGMDALAITDHGVMYGVIDFYRACLAEGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +          +G         +VLL     GY  LI++VSR +  +      
Sbjct: 62   IIGCEVYVAPNSRFDK--EGSASEERYHHLVLLAENDIGYHNLIKIVSRGFT-EGFYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L+E  +EG+I L+   +G +      N  + A+   L  +++FG    ++ LQ 
Sbjct: 119  RVDHELLKEY-SEGIIALSACLAGEVAVMLRRNFFEEAKASALKLQEIFGAGNFFLELQD 177

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++      +++++    +PLVATN+  +  + D  AHD+L+ +     V+ +DR R
Sbjct: 178  HGYPEQKSVNQGLLRISEETNIPLVATNDIHYTYDTDETAHDILLCIQTQKKVTDEDRMR 237

Query: 248  VTPDHYLKN-RSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +      EM  +F    +AL+NT EIA+RC+  ++     LP++       +   
Sbjct: 238  YAGGQFYMKSPEEMRELFPYALQALQNTEEIAKRCNVTIEFGHYKLPKYDVPAPYTVSPG 297

Query: 307  -----------------------EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDF 343
                                       LR     GL  R           + +   RL++
Sbjct: 298  SGSTDDEGDISASQNISTNTDILAREYLRKLCEEGLVRRYKD-------PSTELWDRLNY 350

Query: 344  ELNVIARMKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLL 403
            EL  I  M F  YFLIV DFI++AK N+I VGPGRGS AGSV +Y L IT+IDP+++SLL
Sbjct: 351  ELETIENMGFVDYFLIVWDFIKYAKDNDIIVGPGRGSAAGSVVSYCLEITNIDPIKYSLL 410

Query: 404  FERFLNPDRMSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGR 463
            FERFLNP+R++MPD DIDFC +RR EVI YV +KYG +RV QI+TFG++ A+A +RDVGR
Sbjct: 411  FERFLNPERLTMPDIDIDFCFERRQEVIDYVVSKYGKDRVVQIVTFGTMAARAVIRDVGR 470

Query: 464  ALQMPYSQVDRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYR 523
            AL MPY+ VD + K+IP +    +  +A+  +   ++   +DP V  L+++S++LEGL R
Sbjct: 471  ALDMPYASVDVVAKMIPTELGITIE-KALNINPDLKKLYESDPEVMHLIDMSKRLEGLPR 529

Query: 524  HASTHAAGIVIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQ 583
            H S HAAG+VI + P  + VP+ R    D   TQF M  +E+ GL+K DFLGL+TLT++Q
Sbjct: 530  HTSMHAAGVVISNAPADEYVPLSRSS-DDSITTQFTMTTLEELGLLKMDFLGLRTLTVIQ 588

Query: 584  KSLDFLAQ--------RGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGM 635
             ++  + Q            +++  I ++D +   L+++  T GIFQLESSGM+  ++ +
Sbjct: 589  NAVLLVNQAKARLGETEENFLNIDEIDYNDSKVLDLISSAKTEGIFQLESSGMKSFMKEL 648

Query: 636  QPDCIEDIIALVSLYRPGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQV 695
            +P  +EDIIA +SLYRPGP+D I  Y   KN ++ I      ++P+L  T G I+YQEQV
Sbjct: 649  KPQNLEDIIAGISLYRPGPMDFIPKYIQGKNNQKSIQYECKELEPILSPTYGCIVYQEQV 708

Query: 696  MQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKERFIS--------GASKNGISKTIAV 747
            MQI + L+GYS   +D++RRAM KK    M+K+++ F+         G    GI + +A 
Sbjct: 709  MQIVRELAGYSFGRSDLVRRAMSKKKASVMEKERQSFVYGNVEEGVPGCISKGIPEAVAN 768

Query: 748  NIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQ 807
            +I++ +  FA Y FNKSHAAAYAV+SYQTA++K +YPVEF+AA MT  +DN  K+ ++  
Sbjct: 769  HIYDEMTDFAKYAFNKSHAAAYAVVSYQTAYLKCYYPVEFMAALMTSVIDNPSKVAEYIY 828

Query: 808  DARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIM-EASADKPFDSLE 866
              RQ  I+++PP +N     F V    I Y L+AIKG+G      ++ E   + P+ +L+
Sbjct: 829  TCRQMGIKLLPPDINDGYATFTVSGENIRYGLSAIKGLGRPVIDALVIEREENGPYLNLK 888

Query: 867  DFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENI 926
            DF SR+  K++N+R +ES + +GA D    +R QL+     +       +K       ++
Sbjct: 889  DFASRLSGKEVNKRTIESFIKSGAFDSMPGTRKQLMHVYVGVLDGVSQEKKRAMTGQMSL 948

Query: 927  FAHEKGT--FSDKITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYE 984
            F  +      +++I   +    +       E+ VLG Y SGHPL+ Y+ +L++       
Sbjct: 949  FDLDGDAKVMNEEIIFPEVGEYSKEELLAFEKEVLGIYVSGHPLEAYELLLKRNATANTA 1008

Query: 985  ESV--------ATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + +            G+ + +  M+ S+  K TR  + + ++T  +     E   FP
Sbjct: 1009 DFIVEEETNTVKVADGDTVTVGGMITSRTLKTTRTNAVMAFITLEDMFGTMEVIIFP 1065


>gi|116748665|ref|YP_845352.1| DNA polymerase III subunit alpha [Syntrophobacter fumaroxidans MPOB]
 gi|116697729|gb|ABK16917.1| DNA polymerase III, alpha subunit [Syntrophobacter fumaroxidans MPOB]
          Length = 1164

 Score =  807 bits (2083), Expect = 0.0,   Method: Composition-based stats.
 Identities = 416/1039 (40%), Positives = 610/1039 (58%), Gaps = 24/1039 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            +FVHL VH+ YSLL+GA+ L ++++   + + PA+ +TD  N+F ALEF +KA AAGI+P
Sbjct: 3    AFVHLHVHTQYSLLDGAIRLTDLIETARSMEMPAVTMTDHGNMFGALEFYEKAKAAGIRP 62

Query: 70   IIGCQLDIDMQDNLKMTNQ----GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQG 125
            IIGC++ +  +       +    G         +VLL   A GYQ L++LVS  YL +  
Sbjct: 63   IIGCEVYLAPRSRHDRHGRAEGSGTGEEDRNYHLVLLAKDATGYQNLMKLVSAGYL-EGF 121

Query: 126  KQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYV 184
                RI    L +   EGLI L+    G +      N    A      +  + G D  Y+
Sbjct: 122  YYKPRIDKEILLQ-HHEGLIGLSSCLKGEVATLLSRNQESAARDAAREYAGILGPDHFYL 180

Query: 185  NLQRHRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             LQ +   ++     +++ +     LPLVATN+  +L + D  AH++L+ +     V  +
Sbjct: 181  ELQANGMPEQAKVNERLIVMGKELGLPLVATNDCHYLRKSDARAHEILLCIQTGKTVLDE 240

Query: 244  DRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             R +  T   Y K+  EM   F+ +PEALEN+V IA RC   L++              D
Sbjct: 241  KRMKFQTDQLYFKSPEEMAREFAHVPEALENSVAIAERCRLELKLGDY----HFPVFPLD 296

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQ----DYRQRLDFELNVIARMKFSGYFL 358
              +  E++    A+ G   RL +    +   ++    +Y +RL  EL VI  M F+ YFL
Sbjct: 297  EGESVEDKFEKTALEGFRRRLRELEKRRSGFSEQDRGEYEERLRSELAVIREMGFAAYFL 356

Query: 359  IVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDF 418
            IV DFI +AK + IPVGPGRGS AGS+ AYA+ ITD+DP+   L+FERFLNP+R+SMPD 
Sbjct: 357  IVGDFINYAKSHGIPVGPGRGSAAGSLVAYAMNITDLDPIEHGLIFERFLNPERISMPDI 416

Query: 419  DIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKL 478
            D+DFC   R+EV  YV  KYG  RVAQI TFG++QA+A +RDVGRAL MPY++VDR+ KL
Sbjct: 417  DVDFCIRGREEVFNYVSEKYGKNRVAQITTFGTMQARAVIRDVGRALAMPYNEVDRIAKL 476

Query: 479  IPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRP 538
            IP+     +  +A   + R  E +  DP +  L EI+  LEGL RHASTHAAG+V+ DRP
Sbjct: 477  IPSSLGMTLE-KAFQAEPRLAEQQREDPQIRELFEIAFALEGLTRHASTHAAGVVMADRP 535

Query: 539  LSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGV-KVD 597
            + + +P+Y   +    VTQ+ MK++E+AGLIKFDFLGL+ LT++  ++  + +    ++D
Sbjct: 536  IVEYMPLYLG-QDGEVVTQYPMKYVERAGLIKFDFLGLRNLTVIDDAVRLIRETHGLELD 594

Query: 598  LSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDN 657
            +  +P DD +TY LL+   T G+FQLESSGMR  L  ++P+   DI+ALV+LYRPGP+++
Sbjct: 595  MLALPLDDRDTYALLSRADTTGVFQLESSGMRNILARLKPENFADIVALVALYRPGPLES 654

Query: 658  IVV--YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRR 715
             +V  Y   K+G+ +I     ++ P+L+ T GVI+YQEQVM+IA +++ Y+L EADVLRR
Sbjct: 655  GMVELYIQGKHGQIEITYDPEILRPILEPTYGVILYQEQVMKIASVMASYTLGEADVLRR 714

Query: 716  AMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQ 775
            AMGKK  E M  Q+ RF+ G+ KNGI    A +IF+L+ KFA YGFNKSH+AAYA+++YQ
Sbjct: 715  AMGKKNAEAMRDQRARFVEGSRKNGIPLAKANHIFDLMEKFAGYGFNKSHSAAYALVAYQ 774

Query: 776  TAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRI 835
            TA++KTHY VEF+AA +   + + +++ +   + R+  I I+PP VN    DF V   +I
Sbjct: 775  TAYLKTHYLVEFMAALLNSFLSSSDQVVRLISECREKGIDILPPDVNASSRDFTVVGGKI 834

Query: 836  YYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCF 894
             + L A+K VG      I+       PF S+ DFC RVD++++NRRVLE LV  GA D  
Sbjct: 835  RFGLGAVKNVGEAAIEVILNTRVERGPFKSIHDFCLRVDTQRVNRRVLEQLVKCGAFDSI 894

Query: 895  GYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKG-TFSDKITLEKFSVENSSVRFE 953
               R  ++ +LD+    AQ V+++R +   N+F   K  T +    L +    +     +
Sbjct: 895  HSCRAGVMAALDDALDKAQAVQRDRQSGQINMFDLLKPRTKAGASALPEVPEWDGRQTLQ 954

Query: 954  NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGS 1013
             E+  LGFY SGHPLD Y   + ++     +       G  + L  M+   ++  T+KG 
Sbjct: 955  FEKEALGFYISGHPLDSYAAQISQLCTADTQAVKERKEGAEVILCGMISIVKELTTKKGD 1014

Query: 1014 RIGWVTFSEPAKEYEANFF 1032
            R+ ++   +     E   F
Sbjct: 1015 RMAFLAIEDKEGVLEVVAF 1033


>gi|212704482|ref|ZP_03312610.1| hypothetical protein DESPIG_02538 [Desulfovibrio piger ATCC 29098]
 gi|212672049|gb|EEB32532.1| hypothetical protein DESPIG_02538 [Desulfovibrio piger ATCC 29098]
          Length = 1157

 Score =  807 bits (2083), Expect = 0.0,   Method: Composition-based stats.
 Identities = 418/1038 (40%), Positives = 614/1038 (59%), Gaps = 25/1038 (2%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL  H+ YSLL+GA+ + ++  +      PA AITD  NLF A +F       GI+
Sbjct: 2    SDFVHLHCHTEYSLLDGAIRVKDLCSRAKDFGMPACAITDHGNLFGAAKFFLTCKDFGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC++ +      K +   +        ++LL    EGY  L++LVSR YL +     
Sbjct: 62   PIIGCEVYVCHDHLDKTSELARKRN----HLILLSENIEGYHNLVKLVSRSYL-EGFHYK 116

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             R+  + L++  +EGLI L+   +G I RA        A      +  ++ DR Y+ LQ 
Sbjct: 117  PRVDKAMLRQY-SEGLICLSACIAGEIPRALNAGDMDGAIALAREYADIYPDRFYLELQS 175

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            +   ++      ++++A   +LP+VATN+  +L+ +D +AH+VL+ +   T +    R R
Sbjct: 176  NSLPEQEIANKGLLEIADHLKLPIVATNDCHYLNADDADAHEVLLCIQTQTTMDDPKRMR 235

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T D Y K+  EM ++F  LP++L NT EIA RC+  L +     P +   E   +   
Sbjct: 236  FGTHDLYYKSGEEMEAVFGHLPQSLSNTAEIAERCNVELDMGHHYFPVYKLPEGASL--- 292

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
             ++E R  A  GLE RL +       + Q YR RL +EL VI  M F GYFLIV +FI W
Sbjct: 293  -DSEFRRLAEEGLERRLEKHPNRANINPQAYRDRLQYELKVILEMGFPGYFLIVQEFINW 351

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK + IPVGPGRGS AGS+ A++L IT++DPL ++LLFERFLN +R+S+PD D+DFC+ R
Sbjct: 352  AKDHGIPVGPGRGSAAGSLVAWSLRITNLDPLPYNLLFERFLNAERVSLPDIDVDFCERR 411

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI+++ + YG + VAQI TFG+++AK  +RDVGRAL M +++ DR+ KL+P+D    
Sbjct: 412  RTEVIQHMVDTYGKDSVAQITTFGTMKAKGVVRDVGRALGMSFAETDRIAKLVPDDLKMT 471

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +   +     DP V +LL+ +++LEGL RHASTHAAG+V+  RP+ + +P+Y
Sbjct: 472  I-NKALEAEPDLQNLYDTDPQVKKLLDTARRLEGLSRHASTHAAGLVVSPRPMDEFLPLY 530

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSLIPFDD 605
               R +  VTQF+    EK+GL+KFDFLGLKT+TL+Q +LD    Q     DL  +P  D
Sbjct: 531  TGKRGE-LVTQFDGPMTEKSGLVKFDFLGLKTMTLIQDTLDNITLQGKTPPDLDNLPLTD 589

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVV--YNN 663
              TY L     T GIFQ+ESSGMRQ L  ++P C ED+IA+++LYRPGP+ + +V  +  
Sbjct: 590  AATYDLYARGDTDGIFQVESSGMRQYLRMLKPSCFEDVIAMLALYRPGPLGSGMVDEFIK 649

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G+  +V  H  +   L++T GVI+YQEQVMQIAQ+++ Y+L  AD+LRRAMGKK  E
Sbjct: 650  RKHGQVPVVYPHESLSDCLRDTYGVIVYQEQVMQIAQIIASYTLGGADLLRRAMGKKKPE 709

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             M K++ +F+ GA KNG+ K  A  IF+L+ KFA+YGFNKSH+AAYA ISY TA++K H+
Sbjct: 710  AMAKERVKFVEGAQKNGVDKAKADEIFDLMEKFAEYGFNKSHSAAYAQISYFTAYLKVHH 769

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
             VEF+AA +T EM N EK+ K+    +   I ++ PSVN     F   + ++ + L  IK
Sbjct: 770  TVEFMAALLTSEMSNQEKLLKYISCCKDMGIDVVQPSVNASQRSFSAREGKVVFGLGGIK 829

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
             VG +    IM+A  D  + SL D C RVD +K+ +RVLE+L+  GA DCFG SR  LL 
Sbjct: 830  NVGDSAITEIMDARKDGEYVSLFDMCCRVDLRKVTKRVLEALIKGGACDCFGVSRAALLA 889

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-------KITLEKFSVENSSVRFENEQ 956
            +LD +   AQ   K + +   ++ A      +                  +   R +NE+
Sbjct: 890  ALDTVVTRAQKKAKEKNSNQISLLAMAPQVEAKPQPGIGFDCPESGIPEMDEDQRLKNEK 949

Query: 957  RVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTR-KGSRI 1015
              LGF+ + HPL  +   +R++ +   E++        +  A +VVS ++  T+ KG R+
Sbjct: 950  EALGFFLTSHPLQPFSREMRRLRLTTLEDARDLYPKAELSTAVLVVSLKEVITKSKGERM 1009

Query: 1016 GWVTFSEPAKEYEANFFP 1033
             +V   +     E  FFP
Sbjct: 1010 AFVGVEDLTGHAEVTFFP 1027


>gi|320354498|ref|YP_004195837.1| DNA polymerase III subunit alpha [Desulfobulbus propionicus DSM 2032]
 gi|320123000|gb|ADW18546.1| DNA polymerase III, alpha subunit [Desulfobulbus propionicus DSM
            2032]
          Length = 1173

 Score =  806 bits (2082), Expect = 0.0,   Method: Composition-based stats.
 Identities = 424/1044 (40%), Positives = 618/1044 (59%), Gaps = 30/1044 (2%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +     F+HL VHS YS+L+GA+ +++++D        A+A+TD   ++ ALEF +KA  
Sbjct: 1    MPTP--FIHLHVHSQYSMLDGAIRVSDLIDTAKEFGMEAVALTDHGAMYGALEFYEKAKK 58

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            AGI+P++GC+  +                     +V L     GY  L++L S       
Sbjct: 59   AGIKPLVGCEFYLAENG----MEIHDRSAGHNFHLVALAMNEAGYGNLMKLASLAQTK-G 113

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                 RI    L     EGLI+LT    G I      N    A  R L  +K+FGDRLY+
Sbjct: 114  FYYRPRIDRQTLYA-HQEGLIVLTACLKGEIPWRLTHNDENRARARALELQKVFGDRLYL 172

Query: 185  NLQRHRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             +Q +   ++      ++ LA    + LVATN+  +L++E+  AH+VL+ +     ++  
Sbjct: 173  EIQENGLPEQTIANQGLMALAKDLNIKLVATNDCHYLTKEESYAHEVLLCIQTGKTINDP 232

Query: 244  DRPRVTPDH-YLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
            +R R   +  Y K+  EM + F+  PEA+ NT+E+A RC+  L       P F  KE   
Sbjct: 233  NRFRFNTNELYFKSGDEMAAQFAYCPEAISNTLEVAERCNLELSFKEHFFPIFPIKE--- 289

Query: 303  IQKEEENELRNKAVAGLEV---RLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
              +  E         G +     + +         + YR RL++E++VI  M F+GYFLI
Sbjct: 290  -NETLETVFSQACWDGFQQRLDHMREMGPVSAETEKTYRDRLEYEIDVIQEMGFAGYFLI 348

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            VADFI WAKK  IPVGPGRGSGAGS+ AY + ITDIDP+ + LLFERFLN +R+SMPDFD
Sbjct: 349  VADFINWAKKQKIPVGPGRGSGAGSLAAYCMAITDIDPIPYGLLFERFLNVERVSMPDFD 408

Query: 420  IDFCQDRRDEVIRYVQNKY-GHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKL 478
            +DFC++RRDEVI YV+ +Y G + VAQI+ +GS++A+A LRDVGR L +P   VDR+ KL
Sbjct: 409  VDFCKERRDEVIDYVRQRYGGDDYVAQIVAYGSMKARAVLRDVGRVLDIPLPVVDRIAKL 468

Query: 479  IPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRP 538
            +P +    +  +AI  + R REA   D  V  LL I+Q LEGL RH STHAAG+VI  +P
Sbjct: 469  VPEELKITLK-KAIEKEPRLREAMKDDE-VRELLTIAQTLEGLARHKSTHAAGVVISPKP 526

Query: 539  LSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVD 597
            + + +P+     +   +TQ++MK+ EK GLIKFDFLGLKTLT++ ++L  +A     +VD
Sbjct: 527  MVEYLPV-CIGPNKEILTQYDMKYTEKTGLIKFDFLGLKTLTVIDRALKLIAYDVGKEVD 585

Query: 598  LSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDN 657
            L  IP DD +TY+LL    +LG+FQLES GMR+ L  MQP+   D+IALV+LYRPGP+D+
Sbjct: 586  LRKIPMDDPKTYNLLCRGDSLGVFQLESDGMRELLIKMQPEQFTDLIALVALYRPGPLDS 645

Query: 658  IVV--YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRR 715
             +V  +   K+G+       P I  +L+ET GVI+YQEQVM+I+ +L+GYSL +AD+LRR
Sbjct: 646  GMVDTFVETKHGRRPADYPLPQIKSVLQETYGVIVYQEQVMKISNILAGYSLGDADILRR 705

Query: 716  AMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQ 775
            AMGKKI E M+K++ +F++GA  N I +  A  IF+L+AKFA YGFNKSH+AAYA+++YQ
Sbjct: 706  AMGKKIPEVMEKERGKFMAGAKVNNIPEDKATYIFDLMAKFAGYGFNKSHSAAYALVAYQ 765

Query: 776  TAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRI 835
            TA++K HYP +FLAA ++ + DN +K+ K+  + RQ  I+++PP +N    DF V ++R+
Sbjct: 766  TAYLKAHYPAQFLAALLSCDYDNTDKVVKYINECRQNKIEVLPPDINESFNDFTVINDRV 825

Query: 836  YYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCF 894
             + LAA+K VG      I+    A  P+ SL DFCSRVDS K+NR+V+ESL+ AGA D  
Sbjct: 826  RFGLAAVKNVGGAALDSILAEREAGGPYRSLSDFCSRVDSSKVNRKVIESLIKAGAFDSM 885

Query: 895  GYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA----HEKGTFSDKITLE-KFSVENSS 949
               R Q +  LD     A+  +++R +   N+FA      K   + ++ L          
Sbjct: 886  SGRRAQYMAMLDQCLDRAKAAQRDRMSGQMNLFAIGQPASKQAEATEVELPADVEEWPEL 945

Query: 950  VRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKT 1009
             R   E+  +GF+ +GHPL+     LR+              G  +R+  ++ S ++ K+
Sbjct: 946  ERLAAEKETVGFFLTGHPLEGVMEDLRRAVDTDIAGVEKLREGQAVRIGGLIASYKEHKS 1005

Query: 1010 RKGSRIGWVTFSEPAKEYEANFFP 1033
            +KG R+ + T  + +   E   FP
Sbjct: 1006 KKGDRMAFTTLEDMSASIEVIVFP 1029


>gi|226310964|ref|YP_002770858.1| DNA polymerase III alpha subunit [Brevibacillus brevis NBRC 100599]
 gi|226093912|dbj|BAH42354.1| DNA polymerase III alpha subunit [Brevibacillus brevis NBRC 100599]
          Length = 1142

 Score =  806 bits (2082), Expect = 0.0,   Method: Composition-based stats.
 Identities = 386/1029 (37%), Positives = 605/1029 (58%), Gaps = 24/1029 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL VH+ YSLL+GA  ++ ++ + +     A+A+TD  NL+ A+ F +    AGI+P
Sbjct: 3    SFVHLHVHTEYSLLDGAARIDTLVKRASELGMHALAMTDHANLYGAIPFYKACLEAGIRP 62

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIG +L +   +            P    +++L     GY+ L+ L +            
Sbjct: 63   IIGMELYVIEGNLQDRVRNA----PPPSHLIVLAENETGYRNLLRLATIANTDGN-YILP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYVNLQR 188
            R+    L +  T+GLI L+G   G + +      +  A++  L ++++FG+   Y+ L  
Sbjct: 118  RLNKEVLAK-HTDGLIALSGCQQGEVAKLLLAGEADTAKEAALRYQRMFGEQHFYLELAD 176

Query: 189  HRGY-DRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H    +R   +++V+L+    +PL+ATNN  ++  ED++ HD+L+A+     + +++R R
Sbjct: 177  HGLEVERRLNTRLVKLSQETGIPLIATNNVHYIHREDHQQHDILLAIKEGKTIGEENRFR 236

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T  +YLK+  EM ++F+  P+AL NTV +A RC   L   A ILP F   E  D    
Sbjct: 237  YETDQYYLKSAEEMAALFAFAPQALANTVAVADRCKLDLTFGAHILPEFPLAEGQD---- 292

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                LR     G            G    + + RLD EL +I    F+ YFLIV DF+++
Sbjct: 293  STQYLRELCEKGCLE-------RYGEITPEAQARLDHELAIITGTGFTDYFLIVWDFMRY 345

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A +N IP GPGRGS AGS+ AY L IT++DPLRF LLFERFLNP+R++MPD DIDF  +R
Sbjct: 346  AHENGIPTGPGRGSAAGSLVAYVLKITNVDPLRFQLLFERFLNPERVTMPDIDIDFSVER 405

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            RDEVI YV +KYGH+RVAQIITFG++ A+AA+RDVGRAL +    VDR+ K+IP  P   
Sbjct: 406  RDEVIHYVASKYGHDRVAQIITFGTMAARAAVRDVGRALGLSLGIVDRVAKMIPQSPGMT 465

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +    +  +    +    +    +L+E ++ +EGL RHASTHAAG+VI   PL+  VP+ 
Sbjct: 466  IERA-MQINPDIGKLCAENKQAAQLIETARGVEGLPRHASTHAAGVVISREPLTNYVPLQ 524

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
                  L +TQ+ M+ +E+ GL+K DFLGL+ LT++Q++L  L ++G+ +DL  +P DD 
Sbjct: 525  TG-NEGLALTQYPMEILEEVGLLKMDFLGLRNLTIIQETLRHLQEQGISLDLDKLPTDDE 583

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            +T+ +L+   T GIFQLESSGMR  L  ++P  ++DIIA+++LYRPGP++ I  Y   K+
Sbjct: 584  KTFRMLSRGETTGIFQLESSGMRNVLRDLKPSSLDDIIAVLALYRPGPMEIIPQYIAAKH 643

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
            G  K+   HP+++P+L+ET G +IYQEQ+MQI+  L+G+SL EAD+LRRA+GKK +E + 
Sbjct: 644  GTSKVQYAHPVLEPILRETHGFMIYQEQIMQISSTLAGFSLGEADILRRAVGKKKRELLA 703

Query: 727  KQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVE 786
            +Q+E+F++G  + G    +   +++L+ +FADYGFNK+H+ AYA+I+YQ A++K  YP+ 
Sbjct: 704  EQREKFVAGCVRQGYGDELGNQVYDLIVRFADYGFNKAHSVAYAIIAYQMAYLKATYPLA 763

Query: 787  FLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGVG 846
            F+AA ++L + +  +I ++ ++AR+  + ++ P VN     F V  + I + LAA+K VG
Sbjct: 764  FMAALLSLSIGSQTRIAEYTEEARRLQLTVLGPDVNKSLAFFTVEQDAIRFGLAAVKNVG 823

Query: 847  TTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSLD 906
                  I++    +P+  + DFC+RVD++ +NRRV+ESL   GALD     R QLL  LD
Sbjct: 824  YGAIESIVKERKGRPYRDVFDFCARVDARLVNRRVVESLTLCGALDSLPGHRNQLLLLLD 883

Query: 907  NIQKYAQWVEKNRTNKHENIFAHEKGTFS--DKITLEKFSVENSSVRFENEQRVLGFYFS 964
                 A      R     N+FA E+      +     +    + + + + E+ ++G Y S
Sbjct: 884  EAVGKANNKRIERDANQLNLFAGEEDAAPLREPAEYPEVPPLSHTQQLKEERDLIGVYIS 943

Query: 965  GHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPA 1024
            GHPLD +  +  +  +          R   +++  M+   ++ +T+KG  + ++T  +  
Sbjct: 944  GHPLDQFAHVASRPEVTVISSLGDVPRDKTVKVFGMITEARRIQTKKGDPMAFITLEDKT 1003

Query: 1025 KEYEANFFP 1033
               E   FP
Sbjct: 1004 APVELVVFP 1012


>gi|242280805|ref|YP_002992934.1| DNA polymerase III, alpha subunit [Desulfovibrio salexigens DSM 2638]
 gi|242123699|gb|ACS81395.1| DNA polymerase III, alpha subunit [Desulfovibrio salexigens DSM 2638]
          Length = 1175

 Score =  806 bits (2082), Expect = 0.0,   Method: Composition-based stats.
 Identities = 396/1049 (37%), Positives = 598/1049 (57%), Gaps = 33/1049 (3%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL VH+ YSLL+GA+ + ++  +      PA+AITD  ++F A+ F   A   GI+
Sbjct: 2    SEFVHLHVHTEYSLLDGAIRIKDLCQQAKDFGMPAVAITDHGSMFGAVTFYMTAMDMGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC++ +   D        +        +VLL    +GY+ +I+L S  +L +     
Sbjct: 62   PIIGCEVYVAPGDIDDELAHTRKDKKGRYHLVLLAKNQQGYKNIIKLCSLGFL-EGFHYK 120

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             R+    L +  +EG+I L+   +G + RA          +   T++ +F    Y+ +Q 
Sbjct: 121  PRVSKYLLNKY-SEGVIALSACLAGEVPRALMNEGLDAGIEMAKTYESIFPGNFYLEVQA 179

Query: 189  HRGYDRYRESQVV-QLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            +   ++   ++++ + A    LPLVATN+  +L++EDYEAHD+L+ +   T V  + R R
Sbjct: 180  NGLKEQEDLNELIYKCAEQTGLPLVATNDCHYLTKEDYEAHDLLLCIQTQTTVDAEKRFR 239

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
            + T   Y K + E    F+ +PEA+ NT +IA  C+  +++     P +   E   I   
Sbjct: 240  MGTDQLYFKPQEEFEEYFAHVPEAIANTQKIAEMCNLEIELGNYYFPEYELPEGMTI--- 296

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
             E E       GL+ R+             Y +RLD+EL VI  M F  YFLIV DFI W
Sbjct: 297  -ETEFVKLCKEGLQKRIEN--APYEIDEAKYWERLDYELGVINEMGFPAYFLIVQDFINW 353

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK N IPVGPGRGS AGS+ A+AL IT++DP+ + LLFERFLN +R+SMPD D+DFC+ R
Sbjct: 354  AKDNRIPVGPGRGSAAGSIVAWALRITNLDPIPYDLLFERFLNVERVSMPDIDVDFCERR 413

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDP--- 483
            R EV++Y   KYG + VAQI T+G+++ KA ++DVGRA+ M +S+ D + KL+P+DP   
Sbjct: 414  RLEVVKYCSEKYGWDHVAQITTYGTMKTKAVIKDVGRAMGMHFSETDPIAKLVPDDPAVI 473

Query: 484  --------AHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIG 535
                    A      A+            DP + +L++I+ +LEG+ RHASTHAAG+VI 
Sbjct: 474  AQGLGVKKAKITVPNAVEAIPELSNMVATDPKIAKLMDIATRLEGMSRHASTHAAGVVIS 533

Query: 536  DRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-QRGV 594
            D+P++  +P+Y+  +    VTQ++MK +EK GLIKFDFLGL+T+T+++  LD +  Q   
Sbjct: 534  DKPMTDYLPLYKG-KKGEIVTQYDMKKVEKVGLIKFDFLGLRTMTVIEDCLDIIRLQGKE 592

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
              DL  +  DD +T+ +     T G+FQ+ESSGMR+ L  ++P C EDIIA+++LYRPGP
Sbjct: 593  APDLDTLTLDDQDTFDIFCKGDTDGVFQVESSGMRKYLRMLRPSCFEDIIAMLALYRPGP 652

Query: 655  IDNIVV--YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADV 712
            + + +V  +  RK+G+ ++  + P ++P LK T GVI+YQEQVM  A  ++ YSL E D+
Sbjct: 653  LGSGMVDEFIKRKHGEIEVTYLWPTLEPSLKPTYGVIVYQEQVMGAAMTIANYSLGEGDL 712

Query: 713  LRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVI 772
            LRRAMGKKI EEM K + RF+ GA +N I +  A +IF+L+ +FA YGFNKSH+AAYA+I
Sbjct: 713  LRRAMGKKIPEEMAKHRVRFVDGAKENNIPEQTANDIFDLMEQFAAYGFNKSHSAAYALI 772

Query: 773  SYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGD 832
            SY TA++K H+PVEF+AA M+ EM+N EKI  +    R  ++ +  P +N     F V +
Sbjct: 773  SYYTAYLKAHFPVEFMAALMSTEMNNTEKIIMYINACRDMDVTVRQPDINLGVARFSVYE 832

Query: 833  NRIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGAL 891
              I Y +A IK VG      I+E    + PF    DF +RV+ +++ +RV+E L+ AGA 
Sbjct: 833  GDIIYGMAGIKNVGEEAIDEIVEERQKNGPFKDFIDFITRVNLRRVTKRVIEYLIRAGAF 892

Query: 892  DCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLE------KFSV 945
            D  G +R  L+ SLD    Y Q   K + +   N+     G    +              
Sbjct: 893  DSMGLTRSGLIASLDKAVSYGQKKNKEKESGMINMLDMLGGGGEAEEPAVVSFEEFNMPE 952

Query: 946  ENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQ 1005
             +       E+  LGFY + HPL  Y+  + ++G++  E          I+L A++   +
Sbjct: 953  MDDKEMQRLEKEALGFYLTCHPLLSYRNEMSRLGLQTIENCPNLAHEATIKLGAIITGYK 1012

Query: 1006 QKKTRK-GSRIGWVTFSEPAKEYEANFFP 1033
            +  T+K G ++ + T  +     E   FP
Sbjct: 1013 EIITKKSGKKMAFATIEDMTGSGELIIFP 1041


>gi|313906491|ref|ZP_07839825.1| DNA polymerase III, alpha subunit [Eubacterium cellulosolvens 6]
 gi|313468681|gb|EFR64049.1| DNA polymerase III, alpha subunit [Eubacterium cellulosolvens 6]
          Length = 1157

 Score =  806 bits (2081), Expect = 0.0,   Method: Composition-based stats.
 Identities = 369/1047 (35%), Positives = 579/1047 (55%), Gaps = 40/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL  H+ YSLL+G+  + + + ++      A AITD   ++  + F ++  AAGI+P
Sbjct: 2    SFVHLHTHTEYSLLDGSNKIKDYVARVKELGMNAAAITDHGVMYGCIAFYKECLAAGIRP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +      +   +          ++LL    EGY  L+++VSR +  +      
Sbjct: 62   ILGCEVYVAPGSRFQK--EAGNSEERYYHLILLAENNEGYHNLLKIVSRGFT-EGFYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+ L  L+E   EG+I L+   +G +      N  +   +  L ++++FG    ++ LQ 
Sbjct: 119  RVDLEVLREYH-EGIICLSACLAGEVATYLAKNMYEEGLQAALRYQEIFGKGNFFLELQD 177

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H    +     Q+++++    + LV TN+  +   ED +AHD+L+ +     VS ++R R
Sbjct: 178  HGIPQQQVVNPQLLRMSEETGIELVCTNDCHYTRAEDADAHDILLCIQTGKKVSDENRLR 237

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +Y+K+  EM ++F    +ALENT +IA RC+  ++ H   LP++   E       
Sbjct: 238  YEGGQYYVKSEEEMAALFPYAKQALENTQKIADRCNVEIRFHELKLPKYEVPEG----YT 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                L+     G+                + R+RLD+EL+VI  M +  YFLIV D+I +
Sbjct: 294  SWTYLQKICEDGIRKL-------YDPVTDEIRERLDYELDVIRTMGYVDYFLIVWDYIHF 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK++ IPVGPGRGS AGS+ +YA+ IT++DPL++SLLFERFLNP+R+SMPD D+DF  +R
Sbjct: 347  AKEHGIPVGPGRGSAAGSIVSYAMGITELDPLKYSLLFERFLNPERVSMPDIDVDFGFER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG +RV QI+TFG++ A+ A+RDVGR L +PY+  D   K+IP +    
Sbjct: 407  RQEVIDYVVRKYGKDRVVQIVTFGTMAARNAIRDVGRVLDLPYALCDSTAKMIPQELNIT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +   ++   AD  +  L+++++KLEGL RH S HAAG+VI  + + + VP+ 
Sbjct: 467  ID-KALKMNPELKKEYEADDQIRYLIDMARKLEGLPRHTSMHAAGVVISSKEVDEFVPLQ 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSLIPFDD 605
                     TQ+NM  +E+ GL+K DFLGL+TLT++Q ++        V +D+  I ++D
Sbjct: 526  TAA-DGTVTTQYNMTELEELGLLKMDFLGLRTLTVIQDAVSMAQRNHNVSIDMMKIDYND 584

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
                 ++      G+FQLES+GM+  ++ ++P  +EDI+A V+LYRPGP+D I  Y   K
Sbjct: 585  PAVMKMIGEGKDEGVFQLESAGMKSFMKELKPSSLEDIVAGVALYRPGPMDFIPQYIRGK 644

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
               +++    P +  +L+ T G I+YQEQVMQI + L+GYS   +D+LRRAM KK    M
Sbjct: 645  KHPDEVQYDCPQLKAILEPTYGCIVYQEQVMQIVRELAGYSYGGSDLLRRAMSKKKMHVM 704

Query: 726  DKQKERF--------ISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            ++++  F        I G  +NGI + +A  I++ +  FA Y FNKSHAAAYA++S+QTA
Sbjct: 705  EEERRNFVYGNEERGIPGCIRNGIDEKVANKIYDDMIDFAKYAFNKSHAAAYALVSFQTA 764

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            W+K +YPVEF+AA MT  +DN  K  ++    R   I+I+PP++N     F V D +I Y
Sbjct: 765  WLKCYYPVEFMAALMTSVIDNTAKCAEYMMHTRALGIEILPPNINKSEGTFSVEDGKIRY 824

Query: 838  SLAAIKGVGTTTARHI-MEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
            +L+AIKGVG      I +E   +  F +L DFC R+  +++N+R LE+ + AGA DC G 
Sbjct: 825  ALSAIKGVGRPVIDAISLERDQNGSFKNLGDFCRRLTGREVNKRTLENFIKAGAFDCLGG 884

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFEN 954
            +R Q +Q    +   A   +KN      ++F    E+     +I L      +       
Sbjct: 885  TRRQFMQVYTLVADQAVKEKKNNATGQLSLFDLMGEEDRQQYEIRLPDVGEFDKEEILSF 944

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEE--------SVATIRGNNIRLAAMVVSKQQ 1006
            E+ V G Y SGHPL+  +   RK       +              GN   +  ++V K  
Sbjct: 945  EKEVTGIYISGHPLESDEKKWRKNITCVSADFALPEEGNLPKLKDGNRETIGGIIVDKTI 1004

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K T K   + ++T  +     E   FP
Sbjct: 1005 KYTSKNQTMAFLTIEDLVGSVEVIVFP 1031


>gi|310641197|ref|YP_003945955.1| DNA polymerase iii, alpha subunit [Paenibacillus polymyxa SC2]
 gi|309246147|gb|ADO55714.1| DNA polymerase III, alpha subunit [Paenibacillus polymyxa SC2]
          Length = 1221

 Score =  805 bits (2080), Expect = 0.0,   Method: Composition-based stats.
 Identities = 402/1030 (39%), Positives = 600/1030 (58%), Gaps = 16/1030 (1%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
             SFVHL VHS YSLL+GA     ++ + +A    A+A+TD   ++ A+ F +     GI+
Sbjct: 2    SSFVHLHVHSEYSLLDGAARTAELVKQASAYGMKALALTDHGVMYGAIPFYRACVENGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC+  +      +   +G      +  ++LL     GYQ L++L S  +L +     
Sbjct: 62   PIIGCEAYMTAGSRKE---RGSRKDQPIYHLILLAKNKTGYQNLMKLCSIGHL-EGFHYK 117

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             RI +  L     EG+I L+    G + +         A +    ++ +FGD  Y+ LQ 
Sbjct: 118  PRIDMDALAA-HHEGIICLSACLGGEVPQHLLHGREAEARRAAERYRSIFGDDFYLELQD 176

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++ R   Q++ LA   ++PLVATN+  +L+E D +  DVL+ +     V  ++R R
Sbjct: 177  HGLSEQKRVNPQLIALAKELDIPLVATNDVHYLTEPDADVQDVLICIGTGKTVDDEERLR 236

Query: 248  -VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T   YLK++ EM  +F  + EA+ NTV IA +C   L+    ILP +           
Sbjct: 237  IPTRQLYLKSQEEMARLFPHVAEAIANTVRIAEKCELELEFGQSILPEY---RPLPEDMT 293

Query: 307  EENELRNKAVAGLEVRLAQGAI-AKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
              + LR+  V GLE R     +  +    +   QRL++ELN I  M FS YFLIV DFI 
Sbjct: 294  SSSYLRSLCVQGLERRYGGDPVWEQPEERERLDQRLNYELNTIDSMGFSDYFLIVWDFIA 353

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            +A K+ I  GPGRGS AGS+ AY L IT++DP++++LLFERFLNP+R+SMPD DIDF  +
Sbjct: 354  FAHKHKITTGPGRGSSAGSLVAYVLNITNVDPMKYNLLFERFLNPERISMPDIDIDFSDE 413

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RRDEVI YV  KYG+E VAQIITFG+L A+AA+RDVGR L +PY +VD+  KLIP     
Sbjct: 414  RRDEVIDYVVQKYGNEHVAQIITFGTLAARAAVRDVGRVLNVPYGEVDKAAKLIPAQLGI 473

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
             +   A+      +      P    LL+++ K+EG+ RHASTHAAG+VI   PL+  VP+
Sbjct: 474  NI-RHALEITPELKALYETKPKTRELLDMAIKVEGMPRHASTHAAGVVISRTPLTDAVPL 532

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSL-DFLAQRGVKVDLSLIPFD 604
              +    +P+TQ++M+ +E+ GL+K DFLGL+TL+++++ +     Q G   D S +P D
Sbjct: 533  Q-EGSEGVPLTQYSMENLERIGLLKMDFLGLRTLSIIERCMRWIAEQHGETPDFSRVPDD 591

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNR 664
            D  TY LL    T G+FQLES+G+R+ L+ ++P   EDII++V+LYRPGP+  I  +   
Sbjct: 592  DPHTYDLLGKGDTGGVFQLESAGVRRVLKDLKPSVFEDIISVVALYRPGPMGFIPNFIQA 651

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G+ +I   HP ++P+LK+T G+I+YQEQ+MQIA  ++G+SL EAD+LRRA+ KK +E 
Sbjct: 652  KHGQIEISYPHPDLEPILKDTYGIIVYQEQIMQIASRMAGFSLGEADLLRRAVSKKKREV 711

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            +D ++  F+ G+ K G ++  A  +++++ +FADYGF ++HAAAY V+++QTA++K HYP
Sbjct: 712  LDLERGHFVEGSIKQGYTEEEAGRVYDMIVRFADYGFPRAHAAAYGVLAFQTAYLKAHYP 771

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKV-GDNRIYYSLAAIK 843
            V+F+A+ +T  M +  K+ ++  + R+ +I ++PP VN   V F       I + LAAIK
Sbjct: 772  VQFMASMLTAVMGSHRKVAEYVVECRRMDIAVLPPDVNESGVLFTPLQHGDIRFGLAAIK 831

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
             VGT     I+    ++PFDSL DFC RVD +  N+RV+ESL+ AGA D     R QLL 
Sbjct: 832  NVGTQAMESILAVRKERPFDSLLDFCRRVDLRVCNKRVIESLIQAGAFDSLTGHRAQLLA 891

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
             LD     A    K R +   ++F   +    D I        ++S + E E+ +LG Y 
Sbjct: 892  MLDETVDAAAKWRKERDDLQIDMFGFVEMPNWD-IEYPNVPPFSTSQQLELERELLGLYL 950

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEP 1023
            SGHPLD ++ +L         E         I  A MVVS +   T++G  + ++   + 
Sbjct: 951  SGHPLDDFESLLESSQADRLMELSDVPDETVIVTAGMVVSLKTITTKQGKAMAFIELEDQ 1010

Query: 1024 AKEYEANFFP 1033
             +  E   FP
Sbjct: 1011 IERCEVVLFP 1020


>gi|253580959|ref|ZP_04858221.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251847801|gb|EES75769.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 1155

 Score =  805 bits (2080), Expect = 0.0,   Method: Composition-based stats.
 Identities = 369/1046 (35%), Positives = 576/1046 (55%), Gaps = 41/1046 (3%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL VH+ YSLL+G+  +   + ++      + AITD   ++  ++F + A A GI PI
Sbjct: 3    FTHLHVHTEYSLLDGSNKIKEYVARVKELGMDSAAITDHGVMYGVIDFYRAARAEGINPI 62

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +          +  +       +VLL    +GY  L+++VS+ +  +      R
Sbjct: 63   LGCEVYVAPGSRFDR--EAGSGEDRYYHLVLLAENNQGYANLMKIVSKGFT-EGFYYKPR 119

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            + L+ L+E   EG+I L+   +G + R       + A+   L ++ +FG    ++ LQ H
Sbjct: 120  VDLAVLKEYH-EGIIALSACLAGEVARYLQRGMYEDAKAAALRYQDIFGKGNFFLELQDH 178

Query: 190  RGY-DRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
                 R    +++++     + LVATN+  +   ED + HD+L+ +  +  ++ +DR R 
Sbjct: 179  GIPAQRLVNQELLRMHEETGIDLVATNDVHYTRAEDADPHDILLCLQTNKKLADEDRMRY 238

Query: 249  T-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
                +Y+K+  EM  +F    EALENT +IA+RC   ++     LPRF   +        
Sbjct: 239  EGGQYYVKSPEEMAELFPYALEALENTHKIAQRCHVEIEFGVTKLPRFDVPDG----LTS 294

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L      GLE R            ++ + RL++EL+ I  M +  YFLIV DFI++A
Sbjct: 295  WEYLNKLCFEGLEERYQP-------VTEELKARLNYELSTIKNMGYVDYFLIVWDFIKYA 347

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            + ++I VGPGRGS AGS+ AY L IT +DP+R+ LLFERFLNP+R+SMPD D+DFC +RR
Sbjct: 348  RDHDIMVGPGRGSAAGSLVAYTLGITQLDPIRYDLLFERFLNPERVSMPDIDVDFCFERR 407

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV+ KYG + V QI+TFG+L A+  +RDVGR L MPY+QVD + K+IP +    +
Sbjct: 408  QEVIEYVRRKYGDDCVVQIVTFGTLAARGVIRDVGRVLDMPYAQVDSIAKMIPQELNITI 467

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+  +   ++A      +  L++++++LEGL RH S HAAG+VI  + +S+ VP+ R
Sbjct: 468  D-KALTMNPELKKAYEEQDEIHYLIDMARRLEGLPRHTSMHAAGVVISQKDVSEYVPLSR 526

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKV-DLSLIPFDDH 606
                   VTQF M  +E+ GL+K DFLGL+TLT++Q ++  + +      D+  I +DD 
Sbjct: 527  AS-DGSIVTQFTMTTLEELGLLKMDFLGLRTLTVIQNAVKLIQKDAGVTLDMQKINYDDK 585

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            +    L T  + G+FQLES+GM+  ++ ++P  +ED+IA +SLYRPGP+D I  Y   KN
Sbjct: 586  KVLDSLGTGRSDGVFQLESAGMKNFMKELKPQSLEDVIAGISLYRPGPMDFIPQYIRGKN 645

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              + I    P ++P+LK T G I+YQEQVMQI + L+GY+L  +D++RRAM KK    M+
Sbjct: 646  RPDTIRYDCPQLEPILKPTYGCIVYQEQVMQIVRNLAGYTLGRSDLVRRAMSKKKASVME 705

Query: 727  KQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            K+++ F+         G   NGI +  A  I++ +  FA Y FNKSHAAAYAV+SYQTA+
Sbjct: 706  KERQNFVYGNEAEGVPGCIANGIDEATANKIYDEMIDFAKYAFNKSHAAAYAVVSYQTAY 765

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K +YPVEF+AA MT  +D   K+ ++    RQ  I+I+PP VN     F V +  I Y 
Sbjct: 766  LKYYYPVEFMAALMTSVIDFPNKVAEYILVCRQMGIKILPPDVNCGMYGFSVDNGAIRYG 825

Query: 839  LAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            L+AIK VG      ++     +  + SL+DF  R +S ++N+R +E+ + AGALDC   +
Sbjct: 826  LSAIKSVGRPVIESLVREREENGQYRSLKDFMER-NSPQMNKRAVENFIKAGALDCLDGN 884

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFAH--EKGTFSDKITLEKFSVENSSVRFENE 955
            R Q +     I       +KN      ++F    E+     +I +              E
Sbjct: 885  RRQKMLVYQKISDSISQDKKNSLAGQMSLFDLVSEEDKKEFEIRMPDVEEFGKEELLGYE 944

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEE--------SVATIRGNNIRLAAMVVSKQQK 1007
            + VLG Y SGHPL+ Y+ ++ K       +            + G  + +  M+  K  K
Sbjct: 945  KEVLGIYLSGHPLENYRGMMEKTISAKTSDFQQDEETNLPKVMDGQKVIIGGMITDKTIK 1004

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             T+    + ++T  +     E   FP
Sbjct: 1005 YTKNNKVMAFLTVEDLVGTVEVVVFP 1030


>gi|295110725|emb|CBL24678.1| DNA polymerase III catalytic subunit, DnaE type [Ruminococcus obeum
            A2-162]
          Length = 1155

 Score =  805 bits (2079), Expect = 0.0,   Method: Composition-based stats.
 Identities = 377/1046 (36%), Positives = 587/1046 (56%), Gaps = 41/1046 (3%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL VH+ YSLL+G+  +   +D++      + AITD   ++  ++F + A AAGI PI
Sbjct: 3    FTHLHVHTEYSLLDGSNKIKEYVDRVRELGMDSAAITDHGVMYGVIDFYRAARAAGINPI 62

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +          +  +       +VLL    +GY  L+++VS+ + ++      R
Sbjct: 63   LGCEVYVAPGSRFDR--EAGSGDDRYYHLVLLAENNQGYSNLMKIVSKGF-VEGFYYKPR 119

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            + LS L++   EG+I L+   +G + R       + A+K  L ++ +FG    ++ LQ H
Sbjct: 120  VDLSLLEKYH-EGIIALSACLAGEVARFLTRGMYEDAKKAALRYQDIFGKGNFFLELQDH 178

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++     Q++++     + LVATN+  +   ED + HDVL+ +     ++ +DR R 
Sbjct: 179  GIPEQQNVNQQLLKMHRETGIELVATNDVHYTLAEDAQPHDVLLCLQTGKKLADEDRMRY 238

Query: 249  T-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
                +Y+K+  EM  +F   PEALENT +IA+RC   ++     LP+F   E        
Sbjct: 239  EGGQYYVKSPEEMERLFPYAPEALENTHKIAQRCHVEIEFGVTKLPKFGVPEG----YTS 294

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L      GLE R            ++ ++RL++EL+ I  M +  YFLIV DFI++A
Sbjct: 295  WEYLNELCFKGLEERYQP-------VTEELKERLNYELSTIRNMGYVDYFLIVWDFIKYA 347

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            + ++I VGPGRGS AGS+ AY L IT +DP+R+ LLFERFLNP+R+SMPD D+DFC +RR
Sbjct: 348  RDHDIMVGPGRGSAAGSLVAYTLGITQLDPIRYDLLFERFLNPERVSMPDIDVDFCFERR 407

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV+ KYG + V QI+TFG+L A+  +RDVGR + +PY+QVD + K+IP +    +
Sbjct: 408  QEVIDYVRRKYGDDCVVQIVTFGTLAARGVIRDVGRVMDLPYAQVDTIAKMIPQELNITI 467

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+  +  F++A      +  L++ +++LEGL RH S HAAG+VI  + +S+ VP+ R
Sbjct: 468  D-KALQMNPEFKKAYEEQKEIHDLIDTAKRLEGLPRHTSMHAAGVVISQKDVSEYVPLSR 526

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKV-DLSLIPFDDH 606
                   VTQF M  +E+ GL+K DFLGL+TLT++Q ++  + Q      D+  I ++D 
Sbjct: 527  AS-DGSIVTQFTMTTLEELGLLKMDFLGLRTLTVIQNAVHLIEQDAGVKLDMQHIDYNDK 585

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            +    L T  + G+FQLES+GM+  ++ ++P  +ED+IA +SLYRPGP+D I  Y   KN
Sbjct: 586  KVLDSLGTGRSDGVFQLESAGMKNFMKELKPQSLEDVIAGISLYRPGPMDFIPQYIRGKN 645

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              + I    P ++ +LK T G I+YQEQVMQI + L+GY+L  +D++RRAM KK    M+
Sbjct: 646  RPDTIKYDCPQLESILKPTYGCIVYQEQVMQIVRNLAGYTLGRSDLVRRAMSKKKAAVME 705

Query: 727  KQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            K+++ F+         G   NGIS+  A  I++ +  FA Y FNKSHAAAYAV+SYQTA+
Sbjct: 706  KERQNFVYGNEEEGVPGCIANGISEQTANKIYDDMIDFAKYAFNKSHAAAYAVVSYQTAF 765

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K +YPVEF+AA MT  ++   K+ ++ Q  RQ NI+I+PP VN     F V +  I Y 
Sbjct: 766  LKYYYPVEFMAALMTSVIEMPTKVAEYIQVCRQMNIKILPPDVNRGAYGFSVDNGAIRYG 825

Query: 839  LAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            L+AIK VG      ++E   A+  + SL+DF  R+ +  +N+R +E+ + AGALDC   +
Sbjct: 826  LSAIKSVGRPVINALVEEREANGEYRSLKDFIERL-TGTVNKRAIENFIKAGALDCLEGN 884

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFAH--EKGTFSDKITLEKFSVENSSVRFENE 955
            R Q +     I       +KN      ++F    ++     +I +      +  +    E
Sbjct: 885  RRQKMLVYGQIVDSIAQEKKNSFAGQMSLFDLVSDEEKKEYEIRMPDVEEYDKEMILAFE 944

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATI--------RGNNIRLAAMVVSKQQK 1007
            + VLG Y SGHPL+ Y+ I+ KM      +              G  + +  M+  K  K
Sbjct: 945  KDVLGIYLSGHPLERYRNIMEKMISAKTTDFQPDEESGIPKVYDGQKVIIGGMITEKTIK 1004

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             TR    + ++T  +     E   FP
Sbjct: 1005 YTRNNKVMAFLTVEDLLGTVEIVVFP 1030


>gi|260588911|ref|ZP_05854824.1| DNA polymerase III alpha subunit [Blautia hansenii DSM 20583]
 gi|331083399|ref|ZP_08332511.1| hypothetical protein HMPREF0992_01435 [Lachnospiraceae bacterium
            6_1_63FAA]
 gi|260540690|gb|EEX21259.1| DNA polymerase III alpha subunit [Blautia hansenii DSM 20583]
 gi|330404092|gb|EGG83640.1| hypothetical protein HMPREF0992_01435 [Lachnospiraceae bacterium
            6_1_63FAA]
          Length = 1156

 Score =  805 bits (2079), Expect = 0.0,   Method: Composition-based stats.
 Identities = 371/1046 (35%), Positives = 578/1046 (55%), Gaps = 40/1046 (3%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL VH+ YSLL+G+  +N  + ++      + AITD   +F  ++F + A AAGI+PI
Sbjct: 3    FAHLHVHTEYSLLDGSNKINEYVARVKELGMNSAAITDHGVMFGCIDFYRAAKAAGIKPI 62

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +          +          +VLL     GY+ L+++VS+ + +D      R
Sbjct: 63   LGCEVYVAPGSRFDR--EIGQAEDRYYHLVLLAENNHGYENLMKIVSKAF-VDGFYYKPR 119

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            + +  LQE   EG+I L+   +G + +       + A+   L ++K+FG    ++ LQ H
Sbjct: 120  VDMDLLQEYH-EGIIALSACLAGEVAKNITRGMYEEAKSAALRYEKIFGKGNFFLELQDH 178

Query: 190  RGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
                + R   Q+++++    + LVATN+  +  + D EAHD+L+ V    ++S ++R R 
Sbjct: 179  GIPQQQRVNQQLLRMSQETGIALVATNDVHYTYDTDAEAHDILLCVQTRKLLSDENRMRY 238

Query: 249  T-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
                +Y+K+  EM  +F  +PEALENT +IA RC   ++     LP+F            
Sbjct: 239  EGGQYYVKSPEEMAELFPYIPEALENTQKIADRCEVEIEFGVTKLPKFDVP----APYTS 294

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L      GL+ R +           +  +RL++EL VI  M +  YFLIV DFI++A
Sbjct: 295  WEYLNKLCYDGLKERYSGDLT-------ELEKRLEYELGVIKTMGYVDYFLIVWDFIRFA 347

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            + ++I VGPGRGS AGS+ +Y L IT +DP++++LLFERFLNP+R+SMPD D+DFC +RR
Sbjct: 348  RDHDIMVGPGRGSAAGSLVSYTLGITKLDPIKYNLLFERFLNPERVSMPDIDVDFCFERR 407

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RV QI+TFG++ A+  +RDVGR + +PY+Q D + K+IP +    +
Sbjct: 408  QEVIDYVVEKYGKDRVVQIVTFGTMAARGVIRDVGRVMDLPYAQCDAIAKMIPEELNITI 467

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+  +   +     D  V +L+++S++LEGL RH S HAAG+VI  + + + VP+ R
Sbjct: 468  D-KALKMNPELKNLYTTDEMVKKLIDMSRRLEGLPRHTSMHAAGVVISQKSVDEYVPLAR 526

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSLIPFDDH 606
                   VTQF M  +E+ GL+K DFLGL+TLT++QK++      +G+ +D+  + ++D 
Sbjct: 527  AS-DGSIVTQFTMTTLEELGLLKMDFLGLRTLTVIQKAVKLIEKNKGISLDMDHVDYNDK 585

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              Y +L    T G+FQLES+GM   ++ ++P+ +ED+IA +SLYRPGP+D I  Y   KN
Sbjct: 586  AVYDMLGAGKTEGVFQLESAGMTSFMKELKPESLEDVIAGISLYRPGPMDFIPQYIEGKN 645

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              + I  + P ++P+L  T G I+YQEQVMQI + L GY+L  +D++RRAM KK    M+
Sbjct: 646  NPDSIHFLCPQLEPILSATYGCIVYQEQVMQIVRSLGGYTLGRSDLVRRAMSKKKAAVME 705

Query: 727  KQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            K+++ F+         G    GIS+ IA  I+E +  FA Y FNKSHAAAYAV++YQTA+
Sbjct: 706  KERQNFVYGNEEEGVPGCVNRGISEEIANKIYEQMMDFAKYAFNKSHAAAYAVVAYQTAY 765

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K H+PVEF+AA MT  +DN  K+  +    R+  I I+PP +N     F V    I Y 
Sbjct: 766  LKCHFPVEFMAALMTSVIDNPPKVADYILSCRRMGIAILPPDINKGDSTFSVDGGGIRYG 825

Query: 839  LAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            L+AIK +G      I+        F SL DF  R+  K +N++ +E+ + AGA D    +
Sbjct: 826  LSAIKSIGKPVIESIVAERNQRGDFTSLRDFIERMTGKDVNKKAIENFIKAGAFDELPGN 885

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFAH--EKGTFSDKITLEKFSVENSSVRFENE 955
            R Q +     I       +KN      ++F    E+   + +I +          +   E
Sbjct: 886  RRQKMMVYAQILDAIVQEKKNMMAGQMSLFDFVSEEEKTAYEIHMPDVEEYPKEAKLAFE 945

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEESVA--------TIRGNNIRLAAMVVSKQQK 1007
            + VLG Y SGHPL+ Y+   RK       + +            G  + +  M+  K  K
Sbjct: 946  KEVLGIYISGHPLEEYETCWRKNISAVTTDFMPDEESGQPKVRDGQQVIVGGMITEKTIK 1005

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             T+    + ++T  +     E   FP
Sbjct: 1006 YTKTNKVMAFLTLEDLLGTVEIVVFP 1031


>gi|227824700|ref|ZP_03989532.1| DNA polymerase III [Acidaminococcus sp. D21]
 gi|226905199|gb|EEH91117.1| DNA polymerase III [Acidaminococcus sp. D21]
          Length = 1156

 Score =  805 bits (2079), Expect = 0.0,   Method: Composition-based stats.
 Identities = 371/1036 (35%), Positives = 588/1036 (56%), Gaps = 30/1036 (2%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL  H+ +SLL+GA  + +++        PA+AITD   ++ A+EF Q+    GI+PI
Sbjct: 22   FVHLHTHTQFSLLDGACRIPDLVSYAKELGMPALAITDHGVMYGAIEFYQECVKQGIKPI 81

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ I    +     + +     +  ++LL     GYQ L++LVS    ++      R
Sbjct: 82   IGCEVYITSGSHTVKNMEAR---GKLYHLILLAENRTGYQNLMKLVSIG-QVEGFYYKPR 137

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            I    L++   EGLI L+   +G + R       + AEK +L +  +FG D  Y+ +Q H
Sbjct: 138  IDKQDLRKYH-EGLICLSACVAGEVARHIVRGEKETAEKVMLEYLDIFGRDHYYLEIQNH 196

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               +      ++  LA  + + LVATN+  ++ ++D +  D+L+ +  +       R R 
Sbjct: 197  GLPEEKAVADELHHLARKYNVKLVATNDLHYVHQDDAKGQDILLCIQTNARYLDPQRMRF 256

Query: 249  TPD-HYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
              D +YLK+RSEM ++F D  EAL+NT+EIA RC   L+    +LP F   E +      
Sbjct: 257  NNDSYYLKSRSEMEALFPDDAEALDNTLEIADRCDLTLEFGHLLLPEFPLPEGET---SM 313

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
            +  L+   V G + R  +   +        ++R+D+EL +I +M +SGYFLIV DFI + 
Sbjct: 314  DAYLKKLCVKGFQERYPKDDGSA-------QKRMDYELGIIRQMGYSGYFLIVWDFINYC 366

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            + ++IPVGPGRGS AGS+ AY   ITDIDPL+++L+FERFLNP+R+SMPD D D C  +R
Sbjct: 367  RTHDIPVGPGRGSAAGSIVAYLTGITDIDPLKYNLIFERFLNPERVSMPDIDTDICYVKR 426

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
              V+ Y+ +KYG   VAQI+TFG+L AKAA++DVGR++++P + V ++ KLIPN P   +
Sbjct: 427  HLVVDYLASKYGESHVAQIVTFGTLAAKAAIKDVGRSMEVPLNVVGQVNKLIPNTPGTTL 486

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
                +      ++    DPS+ +L++ + ++EG+ RH STHAAG+VI    L+  VP+  
Sbjct: 487  KSA-LEGSRDLQQLVQNDPSIAQLMDFAGRVEGMPRHTSTHAAGVVITPGELTNYVPLQI 545

Query: 548  DVRSD----LPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKV-DLSLIP 602
               SD       TQ++    E  GL+K D LGL+TLT++  ++  + +      D+  I 
Sbjct: 546  TSTSDDDHEYICTQYDKDCSEALGLLKMDLLGLRTLTVIDDTVKMIEKNQGIKLDIHHID 605

Query: 603  FDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--V 660
             +D +T  +L    T  +FQ+ES GM + ++ + P+ + D+I LV+LYRPGP+ + +   
Sbjct: 606  LEDPKTCQMLCAGDTAAVFQMESDGMTRLMKELGPESMADLIPLVALYRPGPLGSGMAED 665

Query: 661  YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKK 720
            +   ++GK     +HPL++P++ +T GVI+YQEQVMQI  +L G+SL EAD+LRRAMGKK
Sbjct: 666  FIAGRHGKRTARVLHPLMEPIVADTYGVILYQEQVMQIVSVLGGFSLGEADILRRAMGKK 725

Query: 721  IKEEMDKQKERFIS-GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWM 779
              + +D  KE+F++  A ++ IS+ +   IF LL  FA YGFNKSH+AAYA+++YQTA++
Sbjct: 726  KAKLLDSMKEKFLAGAAREHQISRQLGEEIFALLQHFAGYGFNKSHSAAYALVAYQTAYL 785

Query: 780  KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSL 839
            K +YPVE++AA +   +   EK+  +    R   I+++PP +N+    F V  + + + L
Sbjct: 786  KANYPVEYMAAFLNSVITVAEKVSWYISVCRDMGIKVLPPDINSSEAAFSVDGDNVRFGL 845

Query: 840  AAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSR 898
             AIK VG T    I++       F    DF SRVD  K+N+RV+E+L+ +G++D FGY R
Sbjct: 846  GAIKSVGETAVAVILKERERHGLFKDFFDFASRVDLTKVNKRVVENLIKSGSMDTFGYRR 905

Query: 899  MQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRV 958
             QLL  +D     A   + +R     ++F  +    +  I +              E+ +
Sbjct: 906  RQLLAIMDRALDAAAQDQHDRMTGQLSLFGGDTRQSAAAIPIPDLPEIPKDEVLRLEKEL 965

Query: 959  LGFYFSGHPLDVYKPILRKM-GIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGW 1017
            +GFY +GHPLD ++ +L  M GI    E      G  + +  ++   + + T+KG R+  
Sbjct: 966  IGFYVTGHPLDAFRKVLSSMTGIARCTE-EHYHDGERVTVGGLITGVRIRSTKKGERMAT 1024

Query: 1018 VTFSEPAKEYEANFFP 1033
                +         FP
Sbjct: 1025 FMLEDLTGSIGVIAFP 1040


>gi|153815935|ref|ZP_01968603.1| hypothetical protein RUMTOR_02180 [Ruminococcus torques ATCC 27756]
 gi|317500700|ref|ZP_07958918.1| DNA polymerase III [Lachnospiraceae bacterium 8_1_57FAA]
 gi|145846754|gb|EDK23672.1| hypothetical protein RUMTOR_02180 [Ruminococcus torques ATCC 27756]
 gi|316897894|gb|EFV19947.1| DNA polymerase III [Lachnospiraceae bacterium 8_1_57FAA]
          Length = 1157

 Score =  805 bits (2078), Expect = 0.0,   Method: Composition-based stats.
 Identities = 386/1047 (36%), Positives = 590/1047 (56%), Gaps = 40/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL VH+ YSLL+G+  +   + ++      + AITD   ++  ++F ++A + GI P
Sbjct: 2    SFAHLHVHTEYSLLDGSNKIKEYVARVKELGMNSAAITDHGVMYGVIDFYREAKSQGINP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +           G         +VLL    EGY  L+++VS+ + ++      
Sbjct: 62   ILGCEVYVAPNSRFDREVTGGE--DRYYHLVLLAENNEGYANLMKIVSKGF-VEGYYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L++  + G+I L+   +G + R         A+K  L ++ +FG D  Y+ LQ 
Sbjct: 119  RVDKELLRKYHS-GIIALSACLAGEVSRYLMKGLYDEAKKAALEYRDIFGKDHFYLELQD 177

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   D+     Q+++++    + LVATN+  +   +D +AHD+L+ +     ++ ++R R
Sbjct: 178  HGLPDQGLVNQQLLKMSRETGIELVATNDVHYTYAKDEKAHDILLCIQTGKRLADENRMR 237

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +Y+K+  EM S+F    +ALENT +IA RC   ++     LP++   +       
Sbjct: 238  YEGGQYYIKSEEEMKSLFPYALQALENTQKIADRCLVEIEFGVTKLPKYDVPDG----YT 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                LR     GLE             A + R+RLD+EL  I  M +  YFLIV DFI++
Sbjct: 294  SWEYLRKLCYEGLEK-------RYAERADELRERLDYELGTIKNMGYVDYFLIVWDFIKY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK + I VGPGRGS AGS+ +Y L IT IDP+R+ LLFERFLNP+R+SMPD D+DFC +R
Sbjct: 347  AKDHGIAVGPGRGSAAGSIVSYCLGITTIDPIRYQLLFERFLNPERVSMPDIDVDFCYER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG +RV QI+TFG+L A+  +RDVGR + MPY+ VD + K+IP +P   
Sbjct: 407  RQEVIDYVVGKYGKDRVVQIVTFGTLAARGVIRDVGRVMDMPYAFVDSIAKMIPQEPKMT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +   R+    D  V  L+E++++LEGL RH+S HAAG+VI  + + + VP+ 
Sbjct: 467  IE-KALKVNPELRKMCEDDEEVKYLIEMAKRLEGLPRHSSMHAAGVVISQKSVDEYVPLS 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
            R        TQF M  +E+ GL+K DFLGL+TLT++Q ++    ++   V++  + +DD 
Sbjct: 526  RAA-DGSVTTQFTMTTLEQLGLLKMDFLGLRTLTVIQNAVLMARKKDPSVNMDTLDYDDK 584

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            +    + T  T GIFQLES+GM+  ++ ++P+ +ED+IA +SLYRPGP+D I  Y   KN
Sbjct: 585  KVLEYIGTGKTDGIFQLESAGMKSFMKELKPNSLEDMIAGISLYRPGPMDFIPQYIKGKN 644

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
                I    P ++P+L  T G I+YQEQVMQI + L+GYSL  +D+LRRAM KK  EEM 
Sbjct: 645  DASSISYDCPQLEPILNSTYGCIVYQEQVMQIVRDLAGYSLGRSDLLRRAMSKKKGEEMK 704

Query: 727  KQKERF--------ISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            ++++ F        I G  KNGI + +A  I++ +  FA+Y FNKSHAAAYAV++YQTAW
Sbjct: 705  RERQIFLYGDEASGIPGCVKNGIDEQVANKIYDEMLDFANYAFNKSHAAAYAVVAYQTAW 764

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K +YPVE++AA MT  +DN  K+ ++   +RQ  IQI+PP +N    DF V +  I Y 
Sbjct: 765  LKYYYPVEYMAALMTSVIDNPSKVAEYIYASRQMGIQILPPDINNGEADFSVDEGNIRYG 824

Query: 839  LAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSK-KLNRRVLESLVFAGALDCFGY 896
            L+AIK VG    R ++E      P+ +LEDF +RV SK  LN+R +E+L+ AGALD  G 
Sbjct: 825  LSAIKSVGRPVVRAMLEERRTFGPYKNLEDFITRVSSKEGLNKRTIENLIKAGALDTLGG 884

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFEN 954
            +R Q +     I  +    +K   +   ++F    E+     +I +      +   +   
Sbjct: 885  TRKQFMSIYIQIMDHVNQEKKYSMSGQMSLFDLVGEEEKADFQIRMPDVGEYSKENKLAF 944

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV--------ATIRGNNIRLAAMVVSKQQ 1006
            E+ VLG Y SGHPL+ ++   R+M      +              G    +  M+V K  
Sbjct: 945  EKEVLGVYISGHPLEEHEERWRRMISATTADFQFDEELNRTKVHDGEKSVVGGMIVDKTV 1004

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K T+    + ++T  +     E   FP
Sbjct: 1005 KYTKTNQVMAFLTLEDLLGTVEVVIFP 1031


>gi|331089825|ref|ZP_08338718.1| hypothetical protein HMPREF1025_02301 [Lachnospiraceae bacterium
            3_1_46FAA]
 gi|330403522|gb|EGG83080.1| hypothetical protein HMPREF1025_02301 [Lachnospiraceae bacterium
            3_1_46FAA]
          Length = 1157

 Score =  805 bits (2078), Expect = 0.0,   Method: Composition-based stats.
 Identities = 386/1047 (36%), Positives = 590/1047 (56%), Gaps = 40/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL VH+ YSLL+G+  +   + ++      + AITD   ++  ++F ++A + GI P
Sbjct: 2    SFAHLHVHTEYSLLDGSNKIKEYVARVKELGMNSAAITDHGVMYGVIDFYREAKSQGINP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +           G         +VLL    EGY  L+++VS+ + ++      
Sbjct: 62   ILGCEVYVAPNSRFDREVTGGE--DRYYHLVLLAENNEGYANLMKIVSKGF-VEGYYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L++  + G+I L+   +G + R         A+K  L ++ +FG D  Y+ LQ 
Sbjct: 119  RVDKELLRKYHS-GIIALSACLAGEVSRYLMKGLYDEAKKAALEYRDIFGKDHFYLELQD 177

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   D+     Q+++++    + LVATN+  +   +D +AHD+L+ +     ++ ++R R
Sbjct: 178  HGLPDQGLVNQQLLKMSRETGIELVATNDVHYTYAKDEKAHDILLCIQTGKRLADENRMR 237

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +Y+K+  EM S+F    +ALENT +IA RC   ++     LP++   +       
Sbjct: 238  YEGGQYYIKSEEEMKSLFPYALQALENTQKIADRCLVEIEFGVTKLPKYDVPDG----YT 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                LR     GLE             A + R+RLD+EL  I  M +  YFLIV DFI++
Sbjct: 294  SWEYLRKLCYEGLEK-------RYAERADELRERLDYELGTIKNMGYVDYFLIVWDFIKY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK + I VGPGRGS AGS+ +Y L IT IDP+R+ LLFERFLNP+R+SMPD D+DFC +R
Sbjct: 347  AKDHGIAVGPGRGSAAGSIVSYCLGITTIDPIRYQLLFERFLNPERVSMPDIDVDFCYER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG +RV QI+TFG+L A+  +RDVGR + MPY+ VD + K+IP +P   
Sbjct: 407  RQEVIDYVVRKYGKDRVVQIVTFGTLAARGVIRDVGRVMDMPYAFVDSIAKMIPQEPKMT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +   R+    D  V  L+E++++LEGL RH+S HAAG+VI  + + + VP+ 
Sbjct: 467  IE-KALKVNPELRKMCEDDEEVKYLIEMAKRLEGLPRHSSMHAAGVVISQKSVDEYVPLS 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
            R        TQF M  +E+ GL+K DFLGL+TLT++Q ++    ++   V++  + +DD 
Sbjct: 526  RAA-DGSVTTQFTMTTLEQLGLLKMDFLGLRTLTVIQNAVLMARKKDPSVNMDTLDYDDK 584

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            +    + T  T GIFQLES+GM+  ++ ++P+ +ED+IA +SLYRPGP+D I  Y   KN
Sbjct: 585  KVLEYIGTGKTDGIFQLESAGMKSFMKELKPNSLEDMIAGISLYRPGPMDFIPQYIKGKN 644

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
                I    P ++P+L  T G I+YQEQVMQI + L+GYSL  +D+LRRAM KK  EEM 
Sbjct: 645  DASSISYDCPQLEPILNSTYGCIVYQEQVMQIVRDLAGYSLGRSDLLRRAMSKKKGEEMK 704

Query: 727  KQKERF--------ISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            ++++ F        I G  KNGI + +A  I++ +  FA+Y FNKSHAAAYAV++YQTAW
Sbjct: 705  RERQIFLYGDEASGIPGCVKNGIDEQVANKIYDEMLDFANYAFNKSHAAAYAVVAYQTAW 764

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K +YPVE++AA MT  +DN  K+ ++   +RQ  IQI+PP +N    DF V +  I Y 
Sbjct: 765  LKYYYPVEYMAALMTSVIDNPSKVAEYIYASRQMGIQILPPDINNGEADFSVDEGNIRYG 824

Query: 839  LAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSK-KLNRRVLESLVFAGALDCFGY 896
            L+AIK VG    R ++E      P+ +LEDF +RV SK  LN+R +E+L+ AGALD  G 
Sbjct: 825  LSAIKSVGRPVVRAMLEERRTFGPYKNLEDFITRVSSKEGLNKRTIENLIKAGALDTLGG 884

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFEN 954
            +R Q +     I  +    +K   +   ++F    E+     +I +      +   +   
Sbjct: 885  TRKQFMSIYIQIMDHVNQEKKYSMSGQMSLFDLVGEEEKADFQIRMPDVGEYSKENKLAF 944

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV--------ATIRGNNIRLAAMVVSKQQ 1006
            E+ VLG Y SGHPL+ ++   R+M      +              G    +  M+V K  
Sbjct: 945  EKEVLGVYISGHPLEEHEERWRRMISATTADFQFDEELNRTKVHDGEKSVVGGMIVDKTV 1004

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K T+    + ++T  +     E   FP
Sbjct: 1005 KYTKTNQVMAFLTLEDLLGTVEVVIFP 1031


>gi|291550544|emb|CBL26806.1| DNA polymerase III catalytic subunit, DnaE type [Ruminococcus torques
            L2-14]
          Length = 1157

 Score =  804 bits (2076), Expect = 0.0,   Method: Composition-based stats.
 Identities = 369/1047 (35%), Positives = 582/1047 (55%), Gaps = 40/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL VH+ +SLL+G+  +   + ++      + AITD   ++  ++F ++A   GI P
Sbjct: 2    SFAHLHVHTEFSLLDGSNKIKEYVSRVKELGMNSAAITDHGVMYGVIDFYREAKKQGINP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +           G         +VLL    EGY  L ++VS+ + ++      
Sbjct: 62   ILGCEVYVAPNSRFDREITGG--DDRYYHLVLLAENEEGYANLTKIVSKGF-VEGYYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYVNLQR 188
            R+    L++   +G+I L+   +G + R       + A+K  L ++++FG+   ++ LQ 
Sbjct: 119  RVDKELLRKYH-KGIIALSACLAGEVARFLTKGLYEEAKKTALEYQEIFGEGNFFLELQD 177

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++     Q+ +++    + LVATN+  +   ED + HD+L+ +     +S ++R R
Sbjct: 178  HGIPEQGLVNQQLFKMSEETGIELVATNDIHYTYAEDAKPHDILLCIQTGKKLSDENRMR 237

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +Y+K+  EM+ +F    +ALENT +IA RC   ++     LP++   +       
Sbjct: 238  YDGGQYYVKSEEEMLRLFPYAKQALENTQKIADRCHVEIEFGVTKLPKYDVPDG----YT 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                L+     GLE          G  +++ ++RL +EL  I +M +  YFLIV DFI++
Sbjct: 294  SWEYLQKLCYEGLEK-------RYGDPSEELKERLSYELETIHQMGYVDYFLIVWDFIKY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK + I VGPGRGS AGS+ +Y L IT IDP+R+ LLFERFLNP+R+SMPD D+DFC +R
Sbjct: 347  AKDHGISVGPGRGSAAGSIVSYCLEITTIDPIRYQLLFERFLNPERVSMPDIDVDFCYER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG + VAQI+TFG+L A+  +RDVGR + +PY+ VD + K+IP +    
Sbjct: 407  RQEVIDYVTRKYGKDCVAQIVTFGTLAARGVIRDVGRVMDLPYAYVDSISKMIPQELGIT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +   ++    D +V  L++++++LEGL RH S HAAG+VI  +P+ + VP+ 
Sbjct: 467  ID-KALKMNPDLKKLYDTDETVTNLIDMAKRLEGLPRHCSMHAAGVVICQKPVDEYVPLS 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
            R        TQF M  +E+ GL+K DFLGL+TLT++Q ++    ++  +++++ I ++D 
Sbjct: 526  RAA-DGTITTQFIMTTLEELGLLKMDFLGLRTLTVIQNAVLLARRKQPELNINQIDYNDQ 584

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            +    + T  T G+FQLES+GM+  ++ ++P  +ED+IA +SLYRPGP+D I  Y   KN
Sbjct: 585  KVLDYIGTGKTDGVFQLESAGMKGFMKELKPHNLEDVIAGISLYRPGPMDFIPQYIRGKN 644

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
                I    P ++P+L  T G I+YQEQVMQI + L+GYSL  +D+LRRAM KK    M+
Sbjct: 645  DSSSITYDCPQLEPILAPTYGCIVYQEQVMQIVRDLAGYSLGRSDLLRRAMSKKKAAVME 704

Query: 727  KQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            K+++ FI         G  KNGI +  A  I++ +  FA Y FNKSHAAAYAV+SYQTAW
Sbjct: 705  KERKIFIYGDEETGVPGCIKNGIDEQTANKIYDEMIDFAKYAFNKSHAAAYAVVSYQTAW 764

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K ++PVE++AA MT  +DN  K+ ++    RQ NI+I+PP +N    +F V    I Y 
Sbjct: 765  LKYYFPVEYMAALMTSVIDNPSKVSEYIYACRQMNIKILPPDINKGEANFSVDGGDIRYG 824

Query: 839  LAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKK-LNRRVLESLVFAGALDCFGY 896
            LAAIK +G    + I+E   +   F +LEDF +R+ +K  LN+R +E+L+ AGALD  G 
Sbjct: 825  LAAIKSIGRPVIKAIVEDREELGLFQNLEDFITRLSAKNILNKRTIENLIKAGALDTLGG 884

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDK--ITLEKFSVENSSVRFEN 954
            +R Q +     I  +    +KN       +F        ++  I +      +       
Sbjct: 885  TRKQFMSIYVQIVDHVTQEKKNSMVGQMTLFDLVSEDQKEEFQIRMPDVGEYSKETLLAF 944

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV--------ATIRGNNIRLAAMVVSKQQ 1006
            E+ VLG Y SGHPL+ Y+   +K       +              G    +  M+  K  
Sbjct: 945  EKEVLGIYVSGHPLEAYEEKWKKSISATTADFQLDEETGHTKVHDGAKEIIGGMITEKTI 1004

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K T+    + ++T  +     E   FP
Sbjct: 1005 KHTKTNQMMAFITVEDLLGTVEVVVFP 1031


>gi|161618789|ref|YP_001592676.1| DNA polymerase III subunit alpha [Brucella canis ATCC 23365]
 gi|254704138|ref|ZP_05165966.1| DNA polymerase III subunit alpha [Brucella suis bv. 3 str. 686]
 gi|256044502|ref|ZP_05447406.1| DNA polymerase III subunit alpha [Brucella melitensis bv. 1 str.
            Rev.1]
 gi|256060935|ref|ZP_05451093.1| DNA polymerase III subunit alpha [Brucella neotomae 5K33]
 gi|256113358|ref|ZP_05454216.1| DNA polymerase III subunit alpha [Brucella melitensis bv. 3 str.
            Ether]
 gi|260563856|ref|ZP_05834342.1| DNA polymerase III subunit alpha [Brucella melitensis bv. 1 str. 16M]
 gi|260566613|ref|ZP_05837083.1| DNA polymerase III subunit alpha [Brucella suis bv. 4 str. 40]
 gi|261324935|ref|ZP_05964132.1| DNA polymerase III subunit alpha [Brucella neotomae 5K33]
 gi|261754804|ref|ZP_05998513.1| DNA polymerase III subunit alpha [Brucella suis bv. 3 str. 686]
 gi|265990926|ref|ZP_06103483.1| DNA polymerase III subunit alpha [Brucella melitensis bv. 1 str.
            Rev.1]
 gi|265994764|ref|ZP_06107321.1| DNA polymerase III subunit alpha [Brucella melitensis bv. 3 str.
            Ether]
 gi|161335600|gb|ABX61905.1| DNA polymerase III, alpha subunit [Brucella canis ATCC 23365]
 gi|260153872|gb|EEW88964.1| DNA polymerase III subunit alpha [Brucella melitensis bv. 1 str. 16M]
 gi|260156131|gb|EEW91211.1| DNA polymerase III subunit alpha [Brucella suis bv. 4 str. 40]
 gi|261300915|gb|EEY04412.1| DNA polymerase III subunit alpha [Brucella neotomae 5K33]
 gi|261744557|gb|EEY32483.1| DNA polymerase III subunit alpha [Brucella suis bv. 3 str. 686]
 gi|262765877|gb|EEZ11666.1| DNA polymerase III subunit alpha [Brucella melitensis bv. 3 str.
            Ether]
 gi|263001710|gb|EEZ14285.1| DNA polymerase III subunit alpha [Brucella melitensis bv. 1 str.
            Rev.1]
 gi|326408847|gb|ADZ65912.1| DNA polymerase III subunit alpha [Brucella melitensis M28]
 gi|326538562|gb|ADZ86777.1| DNA polymerase III, alpha subunit [Brucella melitensis M5-90]
          Length = 1163

 Score =  804 bits (2076), Expect = 0.0,   Method: Composition-based stats.
 Identities = 590/1033 (57%), Positives = 761/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|260168558|ref|ZP_05755369.1| DNA polymerase III subunit alpha [Brucella sp. F5/99]
 gi|261758031|ref|ZP_06001740.1| DNA polymerase III subunit alpha [Brucella sp. F5/99]
 gi|261738015|gb|EEY26011.1| DNA polymerase III subunit alpha [Brucella sp. F5/99]
          Length = 1163

 Score =  804 bits (2076), Expect = 0.0,   Method: Composition-based stats.
 Identities = 590/1033 (57%), Positives = 761/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|254706961|ref|ZP_05168789.1| DNA polymerase III subunit alpha [Brucella pinnipedialis M163/99/10]
 gi|254709931|ref|ZP_05171742.1| DNA polymerase III subunit alpha [Brucella pinnipedialis B2/94]
 gi|256031424|ref|ZP_05445038.1| DNA polymerase III subunit alpha [Brucella pinnipedialis M292/94/1]
 gi|256159545|ref|ZP_05457313.1| DNA polymerase III subunit alpha [Brucella ceti M490/95/1]
 gi|256254832|ref|ZP_05460368.1| DNA polymerase III subunit alpha [Brucella ceti B1/94]
 gi|261222013|ref|ZP_05936294.1| DNA polymerase III subunit alpha [Brucella ceti B1/94]
 gi|261314424|ref|ZP_05953621.1| DNA polymerase III subunit alpha [Brucella pinnipedialis M163/99/10]
 gi|261317477|ref|ZP_05956674.1| DNA polymerase III subunit alpha [Brucella pinnipedialis B2/94]
 gi|265988513|ref|ZP_06101070.1| DNA polymerase III subunit alpha [Brucella pinnipedialis M292/94/1]
 gi|265997977|ref|ZP_06110534.1| DNA polymerase III subunit alpha [Brucella ceti M490/95/1]
 gi|260920597|gb|EEX87250.1| DNA polymerase III subunit alpha [Brucella ceti B1/94]
 gi|261296700|gb|EEY00197.1| DNA polymerase III subunit alpha [Brucella pinnipedialis B2/94]
 gi|261303450|gb|EEY06947.1| DNA polymerase III subunit alpha [Brucella pinnipedialis M163/99/10]
 gi|262552445|gb|EEZ08435.1| DNA polymerase III subunit alpha [Brucella ceti M490/95/1]
 gi|264660710|gb|EEZ30971.1| DNA polymerase III subunit alpha [Brucella pinnipedialis M292/94/1]
          Length = 1163

 Score =  804 bits (2076), Expect = 0.0,   Method: Composition-based stats.
 Identities = 590/1033 (57%), Positives = 761/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|225627320|ref|ZP_03785357.1| DNA polymerase III, alpha subunit [Brucella ceti str. Cudo]
 gi|225617325|gb|EEH14370.1| DNA polymerase III, alpha subunit [Brucella ceti str. Cudo]
          Length = 1190

 Score =  804 bits (2076), Expect = 0.0,   Method: Composition-based stats.
 Identities = 590/1033 (57%), Positives = 761/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 41   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 100

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 101  GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 160

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 161  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 219

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 220  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 279

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 280  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 339

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 340  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 399

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 400  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 459

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 460  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 519

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 520  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 579

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 580  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 639

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 640  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 699

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 700  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 759

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 760  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 819

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 820  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 879

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 880  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 939

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 940  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 998

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 999  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1058

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1059 LSDASGQFEAVLF 1071


>gi|17987420|ref|NP_540054.1| DNA polymerase III subunit alpha [Brucella melitensis bv. 1 str. 16M]
 gi|17983111|gb|AAL52318.1| DNA polymerase iii, alpha chain [Brucella melitensis bv. 1 str. 16M]
          Length = 1178

 Score =  804 bits (2076), Expect = 0.0,   Method: Composition-based stats.
 Identities = 590/1033 (57%), Positives = 761/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 29   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 88

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 89   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 148

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 149  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 207

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 208  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 267

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 268  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 327

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 328  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 387

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 388  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 447

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 448  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 507

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 508  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 567

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 568  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 627

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 628  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 687

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 688  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 747

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 748  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 807

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 808  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 867

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 868  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 927

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 928  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 986

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 987  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1046

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1047 LSDASGQFEAVLF 1059


>gi|306843761|ref|ZP_07476360.1| DNA polymerase III, alpha subunit [Brucella sp. BO1]
 gi|306275952|gb|EFM57665.1| DNA polymerase III, alpha subunit [Brucella sp. BO1]
          Length = 1163

 Score =  804 bits (2076), Expect = 0.0,   Method: Composition-based stats.
 Identities = 591/1033 (57%), Positives = 760/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD  PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADDAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRAVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+I+ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDIALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|256369256|ref|YP_003106764.1| DNA polymerase III subunit alpha [Brucella microti CCM 4915]
 gi|255999416|gb|ACU47815.1| DNA polymerase III subunit alpha [Brucella microti CCM 4915]
          Length = 1163

 Score =  804 bits (2076), Expect = 0.0,   Method: Composition-based stats.
 Identities = 590/1033 (57%), Positives = 760/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD  PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADDAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|294852181|ref|ZP_06792854.1| DNA polymerase III subunit alpha [Brucella sp. NVSL 07-0026]
 gi|294820770|gb|EFG37769.1| DNA polymerase III subunit alpha [Brucella sp. NVSL 07-0026]
          Length = 1188

 Score =  804 bits (2076), Expect = 0.0,   Method: Composition-based stats.
 Identities = 589/1033 (57%), Positives = 760/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 39   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 98

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 99   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 158

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 159  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 217

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 218  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 277

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 278  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 337

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 338  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 397

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 398  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 457

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 458  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 517

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 518  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 577

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLK LT+LQ ++  +A++G+ +DLS +
Sbjct: 578  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKMLTVLQTAVKLVARKGIDIDLSHL 637

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 638  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 697

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 698  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 757

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 758  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 817

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 818  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 877

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 878  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 937

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 938  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 996

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 997  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1056

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1057 LSDASGQFEAVLF 1069


>gi|320529018|ref|ZP_08030110.1| DNA polymerase III, alpha subunit [Selenomonas artemidis F0399]
 gi|320138648|gb|EFW30538.1| DNA polymerase III, alpha subunit [Selenomonas artemidis F0399]
          Length = 1130

 Score =  804 bits (2075), Expect = 0.0,   Method: Composition-based stats.
 Identities = 378/1032 (36%), Positives = 590/1032 (57%), Gaps = 26/1032 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL VH+ YSLL+GA  +  ++ +       ++AITD   ++ A+ F ++A A GI P
Sbjct: 2    SFVHLHVHTEYSLLDGASRIKELVQRTKELGMDSVAITDHGVMYGAIAFYKEAMAQGIHP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  Q   +              ++LL     GY+ L+ LVS   + +      
Sbjct: 62   IIGCEVYVAPQSRHERAEVDGVR---YYHLILLAENEIGYRNLVRLVSLANI-EGYYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L++   EG+I L+   +G I R+      +  ++ L  +  +FG D  ++ LQ 
Sbjct: 118  RVDKDLLRQYH-EGIIALSACVAGEIPRSILRGDPERTDEILAEYVDIFGRDNFFLELQD 176

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   +       +  L+  H++ LVATN+  ++  ED E HD+L+ V     ++  +R R
Sbjct: 177  HGLPEEKTVNHALRDLSKKHDIGLVATNDIHYVRAEDSEFHDILLCVQTGRTINDPNRMR 236

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
             + PD+YLK+ +EM ++F D P A+ENT +IA RC          LP +   E      +
Sbjct: 237  FSGPDYYLKSEAEMTALFHDYPGAVENTAKIAARCRVDFTFGELQLPFYPIPEKF---AD 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
            ++  LR            +          + R RLD+EL VI  M ++ YFLIV DFI +
Sbjct: 294  DDAYLRTLCEE-------RLPERYSEITNEIRSRLDYELGVIHGMGYASYFLIVWDFINY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+ + + VGPGRGS AGS+ AY L IT+IDPLR++LLFERFLNP+R+SMPD DIDF    
Sbjct: 347  ARGHGVAVGPGRGSAAGSIVAYLLGITNIDPLRYALLFERFLNPERVSMPDIDIDFDDIN 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R  VI YV+ +YG + VAQI TFG++ AK A+RDVGR L+M +S+V  + KL+P++    
Sbjct: 407  RGRVISYVKERYGEDHVAQIATFGTMGAKGAIRDVGRVLEMSFSEVSNITKLVPSELNIT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+ + + FR     D SV R++++++K+EGL R+ S HAAG+VI   PL+  VP++
Sbjct: 467  ID-RALKESADFRRLYDEDESVRRVIDLARKIEGLPRNTSIHAAGVVIAKEPLTNHVPVW 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-QRGVKVDLSLIPFDD 605
              +     VT+F+   +E  GL+K DFLGL+TL++++ +L  +    G+ +D+  IP +D
Sbjct: 526  --ISEGTLVTEFDKDDVEALGLLKMDFLGLRTLSIIEDALKNIRTSHGIDIDIDNIPLED 583

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNN 663
              T  +L    T  +FQ+ES+GM   ++ +QP    D+I  V+LYRPGP+ + +   + +
Sbjct: 584  DLTAQMLCDGDTGAVFQMESAGMTNLVKDLQPKGFVDLIPTVALYRPGPLGSGMVTDFID 643

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
              +GK+++V +HPL+ P+LKET GV++YQEQVMQI Q+L+G++L +AD+LRRAMGKK  E
Sbjct: 644  GLHGKKEVVYMHPLLAPILKETFGVVLYQEQVMQIVQVLAGFTLGQADLLRRAMGKKKHE 703

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             +  QKE F++G + NGI   +A +IF+LL  FADYGFNKSH+A+Y ++++QTA++K HY
Sbjct: 704  LLMAQKESFLAGCANNGIDAPLANHIFDLLTHFADYGFNKSHSASYGLLAWQTAYLKAHY 763

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEF+A  +T  MD  +KI  + +   Q  I+I+PP +N+    F +    I + LAA++
Sbjct: 764  PVEFMAGVLTSIMDKTDKIPVYIRLCHQMKIRILPPDINSSAATFSIESGAIRFGLAAVR 823

Query: 844  GVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG      +     +  PF SL DFC+RVD + LN+R +ESL+  GA D  G  R  LL
Sbjct: 824  NVGENAIAVLEHVREEGGPFRSLVDFCTRVDLRILNKRAIESLIKCGAFDSLGIDRNHLL 883

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKI-TLEKFSVENSSVRFENEQRVLGF 961
             SL+     A   +++  +    +F  E      +I   +   +     R   E+   GF
Sbjct: 884  ASLNAAVTDAARRQRDLLSGQIGLFGDEAMAEIQQIGDFDDVPLCTPRERLTWEKEATGF 943

Query: 962  YFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            Y +GHPL+  +  L  +   G   +        +R+  ++ S ++  T+KG  + +    
Sbjct: 944  YITGHPLEDNQETLSHLQPIGQIAAAVRRDRQLMRVGGILTSTKRFTTKKGDTMLFADLE 1003

Query: 1022 EPAKEYEANFFP 1033
            +     E   FP
Sbjct: 1004 DFTGTLEVTVFP 1015


>gi|325972730|ref|YP_004248921.1| DNA polymerase III subunit alpha [Spirochaeta sp. Buddy]
 gi|324027968|gb|ADY14727.1| DNA polymerase III, alpha subunit [Spirochaeta sp. Buddy]
          Length = 1155

 Score =  804 bits (2075), Expect = 0.0,   Method: Composition-based stats.
 Identities = 408/1032 (39%), Positives = 607/1032 (58%), Gaps = 18/1032 (1%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
             +   FVHL  H+ +SLL+GA  +   + K  +    ++AITD  N+F AL F   A  A
Sbjct: 10   TQQSRFVHLHNHTDFSLLDGAAPIGRYMAKAKSLGMTSLAITDHGNMFGALRFYNAARDA 69

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQG 125
            GI+PIIGC+   +   + +    G    P    ++LL    +GY  L+EL S  Y     
Sbjct: 70   GIKPIIGCEFYCNPAGHTERPAPGG-RKPNQYHLILLAINEKGYHNLMELNSLSYTQG-F 127

Query: 126  KQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYV 184
                RI    L +   EG+I L+    G I +    +  + A++R L F  +F D R Y+
Sbjct: 128  YFKPRIDDELLVKY-NEGVICLSACLGGEILQHLLNDQYEKAKERALWFSSVFDDGRYYL 186

Query: 185  NLQRHRGYDRYRESQVV-QLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             +Q H   D+ R + ++ QL+    +PLV TN+  ++ ++D  A D+L+ V  ++  +  
Sbjct: 187  EMQDHNLPDQKRTNPLLKQLSEETGIPLVCTNDIHYIEKDDANAQDLLLCVGTNSKKNDP 246

Query: 244  DRPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
            DR R    + Y+K+  +M SIFS  PEALENT +IA RC+  + +  P+LP F   +   
Sbjct: 247  DRMRFPNQEFYMKSEEQMASIFSWCPEALENTGKIADRCNLEIHLPGPLLPDFEVPQGF- 305

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              +   + LR+ +  GL+              ++  +RLD+EL+VI +MKF GYFLIV D
Sbjct: 306  --EGPAHYLRHLSHEGLKK-------RYSVVTEELTKRLDYELDVIIKMKFEGYFLIVMD 356

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            +IQWAKK++IPVGPGRGSGAGS+ AY++ ITD+DP++++LLFERFLNP+R+SMPDFDIDF
Sbjct: 357  YIQWAKKHDIPVGPGRGSGAGSLVAYSIDITDVDPIKYNLLFERFLNPERVSMPDFDIDF 416

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            C +RR EVI YV   YG ERVAQI TFG+L+AKA ++DV R L +P+ + + +CKLIP+D
Sbjct: 417  CFERRQEVINYVTEHYGTERVAQIATFGTLKAKAVVKDVARVLDIPFDESNNICKLIPDD 476

Query: 483  PAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQL 542
            P   +  +A   +    E          L + +++LEGL RH STHAAG+VIG   L   
Sbjct: 477  PKMTL-AKAFEQNKELVELEQKGGIYAELFDAARRLEGLNRHTSTHAAGVVIGKEELVNY 535

Query: 543  VPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIP 602
            VP+YRD ++    TQ+ M  IE+ GL+K DFLGLKTLTL++ + D + ++  K   + I 
Sbjct: 536  VPLYRDAKTGAISTQYTMDLIEECGLVKMDFLGLKTLTLIKHTEDLIHKKDPKFTSTAID 595

Query: 603  FDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYN 662
              D +T+ +L    +  +FQ ES GM+  L+  +P  IED++AL +LYRPGP+  I  + 
Sbjct: 596  EKDPKTFEMLCRGDSTAVFQFESQGMQNILKEAKPSNIEDLVALNALYRPGPMAYIPQFV 655

Query: 663  NRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIK 722
            N K G++ I   +P ++  LK T GVI+YQEQVM++AQ+++GYSL  AD+LRR MGKK  
Sbjct: 656  NCKLGRQPITYANPELEEELKTTYGVIVYQEQVMKVAQIIAGYSLGGADILRRIMGKKKV 715

Query: 723  EEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTH 782
              ++K+K +FI+GA   G S+  A  IFE+L  FA YGFNKSHA AY+V++YQTA++K +
Sbjct: 716  AALEKEKVKFIAGAKALGRSEQHAAEIFEMLEPFAGYGFNKSHAVAYSVVAYQTAFLKAN 775

Query: 783  YPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAI 842
            YP EF AA++T EM + +K  ++ Q A+   ++I+PPSVN     F V + +I Y LA I
Sbjct: 776  YPAEFWAANLTNEMGSPDKFSEYLQVAKDQGLEILPPSVNYSDKHFSVVNGKIVYGLAGI 835

Query: 843  KGVGTTTARHIM-EASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            K VG      ++ E  A  P+  L DF +R+D+K +N ++LESL+ AGA D  G +R  L
Sbjct: 836  KNVGEGVVELLVSEREAHGPYKDLLDFLTRLDAKAMNTKLLESLIKAGAFDTLGTNRPTL 895

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
            L++L +   Y Q  ++       ++F  E     +  T++         + E E+ +LGF
Sbjct: 896  LENLGDAITYVQKRKEATAFGQISLFDDETEASMETFTMKPAEDWKLPEKLEMEKGLLGF 955

Query: 962  YFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            Y SGHPLD +   + +                   + AMV S +   T+KG  + ++  +
Sbjct: 956  YISGHPLDAFSQAINQRVTANTAHLENVAFNRPTNIIAMVSSIRPFTTQKGGIMAFLQLT 1015

Query: 1022 EPAKEYEANFFP 1033
            +    ++A  FP
Sbjct: 1016 DRNATFDATLFP 1027


>gi|23501712|ref|NP_697839.1| DNA polymerase III subunit alpha [Brucella suis 1330]
 gi|23347636|gb|AAN29754.1| DNA polymerase III, alpha subunit [Brucella suis 1330]
          Length = 1163

 Score =  804 bits (2075), Expect = 0.0,   Method: Composition-based stats.
 Identities = 589/1033 (57%), Positives = 761/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA++K 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYIKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|306841939|ref|ZP_07474617.1| DNA polymerase III, alpha subunit [Brucella sp. BO2]
 gi|306287972|gb|EFM59380.1| DNA polymerase III, alpha subunit [Brucella sp. BO2]
          Length = 1163

 Score =  804 bits (2075), Expect = 0.0,   Method: Composition-based stats.
 Identities = 589/1033 (57%), Positives = 760/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD  PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADDAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  R+   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARMAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRAVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPKETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|209885082|ref|YP_002288939.1| DNA polymerase III subunit alpha [Oligotropha carboxidovorans OM5]
 gi|209873278|gb|ACI93074.1| DNA polymerase III subunit alpha [Oligotropha carboxidovorans OM5]
          Length = 1157

 Score =  804 bits (2075), Expect = 0.0,   Method: Composition-based stats.
 Identities = 536/1035 (51%), Positives = 712/1035 (68%), Gaps = 13/1035 (1%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +  SP F+HL VHS+YSLL+G++    +     AD QPA+A+TD +N+F ALEFS+K   
Sbjct: 1    MA-SPGFIHLHVHSAYSLLQGSMKTEKLAALAKADNQPALALTDRDNMFGALEFSEKLAG 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GIQPIIGC L +D  D            P    IVLL  T + Y+ L+ L SR +L   
Sbjct: 60   LGIQPIIGCALAVDFGDVDPAARNAAALAPAR--IVLLAPTEDSYRSLMRLNSRAFLEMP 117

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
             +Q+  I   WL++    GLI LTGG  GPI +A      ++A +R+     LFGDRLY+
Sbjct: 118  AQQTPHIKAEWLEQE-RTGLIALTGGPEGPISQALMAEHPELALQRVEKLADLFGDRLYL 176

Query: 185  NLQRHRGY-DRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             LQRH    +R  ES ++ +AY   LPLVATN   F + EDYE+HD L+ +A   ++++ 
Sbjct: 177  ELQRHGLDSERRIESALIDIAYGKGLPLVATNEPYFATVEDYESHDALLCIAGGRLLAET 236

Query: 244  DRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEK--ECD 301
            +R  +TPDH  K R+EM  +F+DLPEAL +TVEIA+RC+F  +   PILP F        
Sbjct: 237  ERAHLTPDHRFKTRAEMAVLFADLPEALASTVEIAQRCAFRPRKRKPILPHFTVDSDHMA 296

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
            D   +E  EL+ +A  GL  RL    +A+G   +DYR RL +E++VI RM +SGYFLIV+
Sbjct: 297  DAVSKENAELQKQAEEGLARRLKAHGLAEGKTEEDYRTRLAYEMSVITRMNYSGYFLIVS 356

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DFI+WAK   IPVGPGRGSGAGS+ AYALTITD+DPLRF+LLFERFLNP+R+SMPDFDID
Sbjct: 357  DFIKWAKSQGIPVGPGRGSGAGSLVAYALTITDLDPLRFALLFERFLNPERVSMPDFDID 416

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FCQDRR EVI YVQ +YG + VAQIITFG+LQA+  LRDVGR LQMPY QVD+L KL+P 
Sbjct: 417  FCQDRRGEVIDYVQRRYGADHVAQIITFGTLQARGVLRDVGRVLQMPYGQVDKLTKLVPQ 476

Query: 482  DPAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLS 540
            +PA PV+  +AI  + + +  R  DP V R  +I+Q+LEGL RHASTHAAGIVIGDRPLS
Sbjct: 477  NPAAPVTLAKAIEGEPKLQAFRDEDPVVARAFDIAQRLEGLTRHASTHAAGIVIGDRPLS 536

Query: 541  QLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSL 600
            +LVP+YRD +SD+PVTQFNMKW+E AGL+KFDFLGLKTLT+L  ++  L Q  + VDL+ 
Sbjct: 537  ELVPLYRDPKSDMPVTQFNMKWVEPAGLVKFDFLGLKTLTVLDVAVKLLKQSNIHVDLAH 596

Query: 601  IPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVV 660
            +P DD +TY +LT    +G+FQ+ES GMR+AL  M+PD  EDIIALV+LYRPGP+ NI  
Sbjct: 597  LPLDDKQTYDMLTRGDVVGVFQVESQGMRRALVDMRPDRFEDIIALVALYRPGPMANIPT 656

Query: 661  YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKK 720
            Y  RK+G E+   +HP+++P+LKET GVIIYQEQVMQIAQ+++GYSL EAD+LRRAMGKK
Sbjct: 657  YCARKHGDEEPEYLHPVLEPILKETFGVIIYQEQVMQIAQVMAGYSLGEADLLRRAMGKK 716

Query: 721  IKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMK 780
            I+ EM+KQ+ RF+SG+ ++ ISK+ A  IFELLAKFADYGFNKSHAAAYA++SYQTA+MK
Sbjct: 717  IRAEMEKQRVRFVSGSVEHSISKSQADQIFELLAKFADYGFNKSHAAAYALVSYQTAYMK 776

Query: 781  THYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLA 840
             HYPVEF+AASMTL+  N +K+ +F  +A++  I++ PPS+N     F VG+N I+YSLA
Sbjct: 777  AHYPVEFIAASMTLDTGNTDKLSEFRAEAQRLGIKVEPPSINRSEGTFTVGENTIFYSLA 836

Query: 841  AIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRM 899
            A+KGVGT     I+EA  +  PF SL DF +RV  + +N+RVLESL  AGA D    +R 
Sbjct: 837  ALKGVGTHAVDMIVEARKNGGPFTSLSDFAARVPPRAINKRVLESLAAAGAFDTIEPNRA 896

Query: 900  QLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVL 959
             +    D I    Q   +       ++F  + G     ITL        + R + E   +
Sbjct: 897  AVFAGADAILAACQRSHEEAVLGQSDMFGGQTGG--PVITLPHVEPWLPAERLQREYGAV 954

Query: 960  GFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNI--RLAAMVVSKQQKKTRKGSRIGW 1017
            GF+ SGHPLD YK +L+++ ++ + E  + ++      ++AA VVS+ +++T+ G+++G 
Sbjct: 955  GFFLSGHPLDDYKVVLQRLNVQSWAEFASAVKNGRTAGKVAATVVSRMERRTKTGNKMGI 1014

Query: 1018 VTFSEPAKEYEANFF 1032
            +  S+P   +EA  F
Sbjct: 1015 IGLSDPTGHFEAVLF 1029


>gi|86604788|ref|YP_473551.1| DNA polymerase III subunit alpha [Synechococcus sp. JA-3-3Ab]
 gi|86553330|gb|ABC98288.1| DNA polymerase III, alpha subunit [Synechococcus sp. JA-3-3Ab]
          Length = 1161

 Score =  804 bits (2075), Expect = 0.0,   Method: Composition-based stats.
 Identities = 372/1041 (35%), Positives = 599/1041 (57%), Gaps = 26/1041 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            +FV L +HS YSLL+GA  L  +++++ A   P +A+TD   ++ A+E  +   + GI+P
Sbjct: 2    AFVPLHLHSEYSLLDGASQLPLLIEQVVAMGLPGLALTDHGVMYGAIELVKLCKSKGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLD-QGKQ- 127
            IIG ++ +   D    + +           V+L    +GY+ L++L +  +L   QGK  
Sbjct: 62   IIGNEMYVINGDIRDKSRKYPK-----YHQVVLAKNTQGYKNLVKLTTISHLQGVQGKGI 116

Query: 128  --SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVN 185
                 I   +L +   EGLI+ +G  +G + +A      ++A +    +++ FGD  Y+ 
Sbjct: 117  FARPCINKEYLAQY-KEGLIVTSGCLAGEVPQAILQGRPEIARQVAAWYQEQFGDDYYIE 175

Query: 186  LQRHR-GYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
            +Q H    DR+   Q+V++A    +P++ TN+S F+S  D EAHD L+ +     +++K+
Sbjct: 176  IQDHGYREDRFVNVQLVRIARELGIPIILTNDSHFISCWDVEAHDALLCIQTGKSLTEKN 235

Query: 245  RPRVTPDHYLKNRSEMVSIFSDL--PEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
            R R +   YLK+  EM  +  D    E ++  +    +    ++ +       +      
Sbjct: 236  RLRYSGTEYLKSPEEMRRLCRDHLEQEVIDEAIANTLKVLEKIEGYDLFGETRMPDYPVP 295

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
                 ++ L   A  GL  R   G        ++Y++RL FELN+I +  FS YFL+V D
Sbjct: 296  PGHSADSYLTELAWQGLAKRC--GVAYPDQIPENYQERLRFELNIIQQKGFSSYFLVVWD 353

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            ++++A+++ IPVGPGRGS AGS+ AYAL IT+IDP+++ LLFERFLNP+R SMPD D DF
Sbjct: 354  YVRYAREHGIPVGPGRGSAAGSLVAYALQITNIDPVKYGLLFERFLNPERQSMPDIDTDF 413

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            C +RR E+I YV  KYG ERVAQIITF  + +KA L+DVGR L +PY++ D++ KLIP  
Sbjct: 414  CIERRGELIDYVTRKYGQERVAQIITFNRMTSKAILKDVGRVLDIPYAEADKMAKLIPVS 473

Query: 483  PAHPVSLQAIADD----SRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRP 538
               P  L+ +  +      F+E    DP+  R +E+++ LEG  +    HAAG+VI   P
Sbjct: 474  RGKPAKLEEMIGENTPAPEFKEKYEKDPTTHRWIELARLLEGTNKTFGVHAAGVVISKDP 533

Query: 539  LSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-QRGVKVD 597
            L ++VP+  +      +TQ++M+ IE  GL+K DFLGL+ LT++Q++++ +   RGV +D
Sbjct: 534  LDEIVPLQYN-NEGQIITQYSMEDIESLGLLKMDFLGLRNLTMIQRAVELIREHRGVTID 592

Query: 598  LSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDN 657
            L  +P DD +TY LL      GIFQLESSGM+Q +  ++P  +EDI ++++LYRPGP+D 
Sbjct: 593  LDNLPLDDEKTYQLLEKGELEGIFQLESSGMKQVVRELKPSNLEDISSVLALYRPGPLDT 652

Query: 658  IV--VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRR 715
             +   + +RK+G++ +   H L+ P+L++T G I+YQEQ+M+IAQ ++GY+L +AD+LRR
Sbjct: 653  GMIPDFIDRKHGRKPVTYAHDLLKPILQDTYGAILYQEQIMRIAQDMAGYTLGQADLLRR 712

Query: 716  AMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQ 775
            AMGKK   EM+K +E+F+ GA + G++K +A  +F+ +  FA+Y FNKSH+ AY +I++Q
Sbjct: 713  AMGKKKVSEMEKHREQFVRGAVERGVAKEVATELFDQMVAFAEYCFNKSHSTAYGLITFQ 772

Query: 776  TAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRI 835
            TA++K +YP E++AA ++    + +K++++        IQI PP +N   +DF    + I
Sbjct: 773  TAYLKANYPTEYMAALLSSVGGDQDKVQRYITYCLSIGIQIEPPDINRSGLDFTPQGSSI 832

Query: 836  YYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCF 894
             + L A+K VG    ++I+ A  A  PF SL DFC RVD   +NRR +ESL+ AGA D  
Sbjct: 833  LFGLGAVKNVGEGAIQNILAARQAGGPFTSLADFCQRVDLHVVNRRAIESLICAGAFDGI 892

Query: 895  GYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRF 952
              +R QL+  LD I  +A    K++     ++F        F +              + 
Sbjct: 893  SGNRKQLMADLDPILNWAAEQAKSKAIGQASLFDLLGNDQGFIEAPRGPATEDFPPQEKL 952

Query: 953  ENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKG 1012
              E+ +LGFY S HPL   +   R +      +        ++ + A++ + +   T++G
Sbjct: 953  RLERELLGFYVSDHPLRRIQEQARLLAPVNLSDLSGYAADTSVGILALLTAIKTVTTKRG 1012

Query: 1013 SRIGWVTFSEPAKEYEANFFP 1033
             R+  +   +     EA  FP
Sbjct: 1013 DRMAILQLEDLTGSCEAVIFP 1033


>gi|254718932|ref|ZP_05180743.1| DNA polymerase III subunit alpha [Brucella sp. 83/13]
 gi|265983919|ref|ZP_06096654.1| DNA polymerase III subunit alpha [Brucella sp. 83/13]
 gi|306838837|ref|ZP_07471668.1| DNA polymerase III, alpha subunit [Brucella sp. NF 2653]
 gi|264662511|gb|EEZ32772.1| DNA polymerase III subunit alpha [Brucella sp. 83/13]
 gi|306406121|gb|EFM62369.1| DNA polymerase III, alpha subunit [Brucella sp. NF 2653]
          Length = 1163

 Score =  803 bits (2074), Expect = 0.0,   Method: Composition-based stats.
 Identities = 589/1033 (57%), Positives = 761/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  R+   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARMAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  ALQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPKETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|254689079|ref|ZP_05152333.1| DNA polymerase III subunit alpha [Brucella abortus bv. 6 str. 870]
 gi|256257328|ref|ZP_05462864.1| DNA polymerase III subunit alpha [Brucella abortus bv. 9 str. C68]
 gi|260754577|ref|ZP_05866925.1| DNA polymerase III subunit alpha [Brucella abortus bv. 6 str. 870]
 gi|260883604|ref|ZP_05895218.1| DNA polymerase III subunit alpha [Brucella abortus bv. 9 str. C68]
 gi|297248177|ref|ZP_06931895.1| DNA polymerase III subunit alpha [Brucella abortus bv. 5 str. B3196]
 gi|260674685|gb|EEX61506.1| DNA polymerase III subunit alpha [Brucella abortus bv. 6 str. 870]
 gi|260873132|gb|EEX80201.1| DNA polymerase III subunit alpha [Brucella abortus bv. 9 str. C68]
 gi|297175346|gb|EFH34693.1| DNA polymerase III subunit alpha [Brucella abortus bv. 5 str. B3196]
          Length = 1163

 Score =  803 bits (2073), Expect = 0.0,   Method: Composition-based stats.
 Identities = 588/1033 (56%), Positives = 759/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + F   ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFPKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD R D+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRFDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|15893807|ref|NP_347156.1| DNA polymerase III DnaE [Clostridium acetobutylicum ATCC 824]
 gi|15023379|gb|AAK78496.1|AE007566_6 DNA polimerase III, alpha chain (dnaE) [Clostridium acetobutylicum
            ATCC 824]
          Length = 1167

 Score =  803 bits (2073), Expect = 0.0,   Method: Composition-based stats.
 Identities = 375/1059 (35%), Positives = 578/1059 (54%), Gaps = 54/1059 (5%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
             FVHL VH+ YSLL+G+  +  ++++       +IAITD   ++  +EF + A   GI+P
Sbjct: 10   DFVHLHVHTEYSLLDGSGKVKKLVERAKELGMKSIAITDHGAMYGCVEFYKAAKEVGIKP 69

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +         +        +VLLV    GY+ L+E+VS   + +      
Sbjct: 70   IIGCEIYVAGKSMHIKHPDAEN---ETYHLVLLVKNEIGYKNLMEIVSTASI-EGFYYKP 125

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            R+   +L    +EGLI  +    G +      ++ + A+K  L +K+ F D  Y+ LQ H
Sbjct: 126  RVDHEYLMS-HSEGLIASSACFGGEVQSYILKDNLEKAKKAALFYKETFKDGFYLELQYH 184

Query: 190  RGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               D       +V ++   ++PL+ATN+  ++++ED  AHD+L+ +     + +++R R 
Sbjct: 185  ALKDDMKVNDTLVNMSKELDIPLIATNDVHYINKEDSIAHDILLCIQTGKTIDEENRMRY 244

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
                 YLK++ EM   FS + EAL NT +IA  C+F  + H   LP F   E +D     
Sbjct: 245  APEQFYLKSQEEMYEQFSYVKEALLNTSKIADECNFEYKFHESKLPNFPLPEGEDHY--- 301

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L+     GL                  ++RL++EL +I  M +  YFLIV DFI++A
Sbjct: 302  -EYLKKLCYEGLNE-------RYNPITDTIKERLEYELGIIKEMGYVDYFLIVWDFIKFA 353

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            ++N +P GPGRGS AGS+ AY L IT IDP+++SL+FERFLNPDR+SMPD D DFC + R
Sbjct: 354  RENGVPTGPGRGSAAGSIVAYTLGITKIDPIKYSLIFERFLNPDRVSMPDIDSDFCYENR 413

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             +VI YV  KYG + V+QI+TFG++ A+  +RDVGRA+   Y +VD++ K+IPN     +
Sbjct: 414  QKVIDYVVEKYGKDCVSQIVTFGTMAARLCIRDVGRAMNYSYGEVDKIAKMIPNVLNINI 473

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+  +   +     D  +  L++IS+KLEGL RH STHAAG+VI  +PL   VP+ +
Sbjct: 474  D-KALEMNPELKAIYDDDDRIKDLIDISRKLEGLPRHTSTHAAGVVISSQPLVNYVPLLK 532

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
            +   +  V QF M  +E+ GL+K DFLGL+TLT++  ++  + Q R + +D+  I FDD+
Sbjct: 533  N--EESIVAQFTMGILEELGLLKMDFLGLRTLTVINDTIKMVKQNRNIDIDIDDIDFDDY 590

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              Y ++    T+G+FQLES+GM   ++ ++PD +EDIIA +SLYRPGP++ I  Y   KN
Sbjct: 591  GVYKMIGEGKTVGVFQLESAGMTSFMKELKPDSLEDIIAGISLYRPGPMNEIPRYIRNKN 650

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E+I  + P +  +L  T G IIYQEQVMQI + L+GYS+  +D++RRAM KK    M+
Sbjct: 651  NPEEIKYVTPELKHILDVTYGCIIYQEQVMQIVRDLAGYSMGRSDLVRRAMSKKKHHVME 710

Query: 727  KQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            +++  FI             G  KNGIS+ IA  IF+ +  FA Y FNKSHAAAYAV++Y
Sbjct: 711  EERHNFIHGVVDENGNVEVPGCIKNGISEKIANEIFDSMMDFASYAFNKSHAAAYAVVAY 770

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            +TA++  +YP E+LAA +   M N EK+  + + A +  IQ++PP +N     F V ++ 
Sbjct: 771  ETAYLIHYYPAEYLAAMLNSVMGNSEKVAFYIRCAEELKIQVLPPDINGSYSRFTVKEDT 830

Query: 835  IYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + LAAIK VG      I+ A      F S  DFC+++D+ ++N+R +ES++ +G  D 
Sbjct: 831  IRFGLAAIKNVGFNVIESIVRARNEKGNFISFTDFCNKIDTSEVNKRAVESIIKSGGFDT 890

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAH--EKGTFSDKITLEKFSVENSSVR 951
             G  R +LL   + I        K       N+F    +      +I        +    
Sbjct: 891  LGVYRSKLLAVFEKIMDGISGQRKKNIKGQMNLFTDFVQDDYEEVEIQYPDIKEFDKKYL 950

Query: 952  FENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEES-----------------VATIRGNN 994
               E+ + G Y SGHPL+ Y+  L+ M      +                       G  
Sbjct: 951  LAMEKEMTGLYLSGHPLEDYEETLKNMTSIKISDIVAPQSLEDNDGVKLDENTDVQDGTR 1010

Query: 995  IRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + +  +V S  +K TR  + + ++   +     E   FP
Sbjct: 1011 VIIGGIVTSVTKKVTRSNTMMAFIKLEDMYAAIEVVIFP 1049


>gi|317152330|ref|YP_004120378.1| DNA polymerase III subunit alpha [Desulfovibrio aespoeensis Aspo-2]
 gi|316942581|gb|ADU61632.1| DNA polymerase III, alpha subunit [Desulfovibrio aespoeensis Aspo-2]
          Length = 1173

 Score =  802 bits (2072), Expect = 0.0,   Method: Composition-based stats.
 Identities = 423/1043 (40%), Positives = 609/1043 (58%), Gaps = 28/1043 (2%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VHS YSLL+GA+ +N++L +      PA+AITD  ++F A+ F  +A A GI+PI
Sbjct: 4    FVHLHVHSEYSLLDGAIRINDLLARAKDLGMPAVAITDHGSMFGAMTFYTEALAMGIKPI 63

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +   D                 +VLL     GY+ LI+LV+  YL +      R
Sbjct: 64   IGCEVYVAPGDIDDAHAHEVKDKSGGYHLVLLAKNRIGYKNLIKLVTTGYL-EGFYYKPR 122

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHR 190
            +   +L +   EGLI L+   +G + R       +        ++ +F    Y+ LQ + 
Sbjct: 123  VSK-YLLKQHAEGLIALSACLAGEVPRMLMNEGLEAGAAMAGEYESIFPGNFYLELQDNG 181

Query: 191  GYDRYRESQ-VVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV- 248
               + R ++ +++ A    LPLVATN+  +L+ EDYEAHD L+ +   T V  + R R+ 
Sbjct: 182  IGKQTRLNELLIKCAEKTGLPLVATNDCHYLTAEDYEAHDTLLCIQTQTTVDAEKRFRMD 241

Query: 249  TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEE 308
            T + Y K   EM   F+ +PEA+ NT  IA RC+  +++ +   P +   E      +  
Sbjct: 242  TRELYFKTPEEMEQAFAHVPEAIANTQRIAERCNLEIELGSYYFPEYELSEG---VADIN 298

Query: 309  NELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAK 368
             E       GL  RLA  AI        Y +RLD+EL VI +M F  YFLIV DFI WAK
Sbjct: 299  EEFEKLCREGLRKRLA--AIPYPVDEAVYWKRLDYELGVIIKMGFPAYFLIVQDFINWAK 356

Query: 369  KNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRD 428
             N IPVGPGRGS AGS+ A++L IT++DPL + LLFERFLN +R+SMPD D+DFC+ RR 
Sbjct: 357  DNRIPVGPGRGSAAGSIVAWSLRITNLDPLPYDLLFERFLNVERISMPDIDVDFCERRRL 416

Query: 429  EVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVS 488
            EV++Y  +KYGH+RVAQI TFG+++ KA ++DVGRAL M + + DR+ KLIP DP     
Sbjct: 417  EVVKYCADKYGHDRVAQITTFGTMKTKAVIKDVGRALGMTFGETDRIAKLIPEDPGVMAK 476

Query: 489  LQAIADDS-----------RFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDR 537
            L  +                  +    DP V +L++IS +LEGL RHASTHAAG+VI DR
Sbjct: 477  LLGVEKAKISVPNAVKAVIELDDMVATDPRVAKLIDISTRLEGLCRHASTHAAGVVISDR 536

Query: 538  PLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVK-V 596
            P+++ +P+Y+  +    VTQF+MK +EK GLIKFDFLGL+T+T+++  LD + ++G    
Sbjct: 537  PMTEFLPLYKG-KKGEIVTQFDMKKVEKVGLIKFDFLGLRTMTVIEDCLDIIREQGKHAP 595

Query: 597  DLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPID 656
            DL  +  DD  TY +     T GIFQ+ESSGMR+ L  ++P+C EDIIA+++LYRPGP+ 
Sbjct: 596  DLDTLALDDPATYDIFAKGDTDGIFQVESSGMRKYLRMLRPNCFEDIIAMLALYRPGPLG 655

Query: 657  NIVV--YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLR 714
              +V  +  RK+G+  +   HP ++  LK T GV++YQEQVM  A +++ YSL E D+LR
Sbjct: 656  MGMVDEFIKRKHGEVAVSYPHPSLEDTLKPTYGVMVYQEQVMATAMIIANYSLGEGDLLR 715

Query: 715  RAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            RAMGKKI EEM  Q+ RF+ GA +N I + +A  IF+ + KFA YGFNKSH+AAYA+ISY
Sbjct: 716  RAMGKKIAEEMAMQRARFLEGARENKIDEAVANAIFDTMEKFAAYGFNKSHSAAYALISY 775

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
             TA++K H+PVEF+AA M+ EM+N EKI  +    R  +I +  P +N     F V D  
Sbjct: 776  HTAYLKAHFPVEFMAALMSTEMNNTEKIVMYINACRDMDITVKQPDINAGQARFSVLDGD 835

Query: 835  IYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I +++AAIK VG      I+    A  PF  +  FC R++ +++ +RVLESL+ AGALDC
Sbjct: 836  ILFAMAAIKNVGEEAINEIVAERVAGGPFKDIFAFCERINLRRVTKRVLESLIKAGALDC 895

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEK---FSVENSSV 950
            F  SR  LL+ L+    + Q   K + +   ++     G  +              +   
Sbjct: 896  FSCSRAALLEDLEKAVGFGQKKAKEKESGMLSMLDMLGGASAQAAHTPTCSSCEEFDDRE 955

Query: 951  RFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTR 1010
            + E E+ VLGF+ SGHPL  Y+  L ++     E+  +   G  +R+A ++   +Q  T+
Sbjct: 956  KLEMEKEVLGFFLSGHPLLAYRHELARLRTATLEDCKSMPNGTEVRVAVIIPDYKQFITK 1015

Query: 1011 KGSRIGWVTFSEPAKEYEANFFP 1033
            KG  + + T  +     E    P
Sbjct: 1016 KGDPMAFCTAEDLTTSGEITMLP 1038


>gi|86608659|ref|YP_477421.1| DNA polymerase III subunit alpha [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557201|gb|ABD02158.1| DNA polymerase III, alpha subunit [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 1165

 Score =  802 bits (2072), Expect = 0.0,   Method: Composition-based stats.
 Identities = 380/1045 (36%), Positives = 600/1045 (57%), Gaps = 30/1045 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFV L +HS YSLL+GA  L  +++++ A   P +A+TD   ++ ALE  +   + GI P
Sbjct: 2    SFVPLHLHSEYSLLDGASQLPRLVEQVVAMGLPGLALTDHGVMYGALELVKLCKSKGITP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLD-QGKQ- 127
            IIG ++ +   D    + +           V+L    +GY+ L++L +  +L   QGK  
Sbjct: 62   IIGNEMYVINGDIRDKSRKYPK-----YHQVVLAKNTQGYKNLVKLTTISHLHGIQGKGI 116

Query: 128  --SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVN 185
                 I   +L +   EGLI+ +G  +G + +A      ++A +    +++ FGD  Y+ 
Sbjct: 117  FSRPCINKEYLVQY-KEGLIVTSGCLAGEVPQAILQRRPEIAREVAAWYQEQFGDDYYIE 175

Query: 186  LQRHR-GYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
            +Q H    DR+   Q+V++A    +P++ TN+S F+S  D EAHD L+ +     +++K+
Sbjct: 176  IQDHGYQEDRFVNVQLVRIARELGIPIILTNDSHFISCWDVEAHDALLCIQTGKSLTEKN 235

Query: 245  RPRVTPDHYLKNRSEMVSIFSDL--PEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
            R R T   YLK+  EM  +  D    E ++  +    +    ++ +       +      
Sbjct: 236  RLRYTGTEYLKSPEEMRRLCRDHLEQEVIDEAIANTLKVLEKIEGYDLFGEMRMPDYPVP 295

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
                 ++ L   A  GL  R   G        Q+Y++RL FELN+I +  FS YFL+V D
Sbjct: 296  PGHSADSYLTELAWQGLAKRC--GVAQPDQIPQNYQERLRFELNIIQQKGFSSYFLVVWD 353

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            ++++A++  IPVGPGRGS AGS+ AYAL IT+IDP+++ LLFERFLNP+R SMPD D DF
Sbjct: 354  YVRYAREQGIPVGPGRGSAAGSLVAYALQITNIDPVKYGLLFERFLNPERQSMPDIDTDF 413

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            C +RR E+I YV  KYG ERVAQIITF  + +KA L+DVGR L +PYS+ D++ KLIP  
Sbjct: 414  CIERRGELIDYVTRKYGQERVAQIITFNRMTSKAILKDVGRVLDIPYSEADKMAKLIPVS 473

Query: 483  PAHPVSLQAIADD----SRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRP 538
               P  L+ +  +      F+E    DP+  R +E+++ LEG  +    HAAG+VI   P
Sbjct: 474  RGKPAKLEEMIGEDTPAPEFKEKYEKDPTTHRWIELARLLEGTNKTFGVHAAGVVIAKDP 533

Query: 539  LSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVD 597
            L ++VP+  +      +TQ++M+ IE  GL+K DFLGL+ LT++Q++++ + +   V +D
Sbjct: 534  LDEIVPLQYN-NEGQIITQYSMEDIESLGLLKMDFLGLRNLTMIQRAVELIREHNGVNID 592

Query: 598  LSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDN 657
            L  +P DD +TY LL      GIFQLESSGM+Q +  ++P  +EDI ++++LYRPGP+D 
Sbjct: 593  LDNLPLDDKKTYQLLEKGELEGIFQLESSGMKQVVRELKPSNLEDISSVLALYRPGPLDT 652

Query: 658  IV--VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRR 715
             +   + +RK+G++ +   H L+ P+L++T G I+YQEQ+M+IAQ ++GY+L +AD+LRR
Sbjct: 653  GMIPDFIDRKHGRKPVTYAHELLKPILQDTYGAILYQEQIMRIAQDMAGYTLGQADLLRR 712

Query: 716  AMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQ 775
            AMGKK   EM+K +E+F+ GA+K G+S+ +A  +F+ +  FA+Y FNKSH+ AY +I++Q
Sbjct: 713  AMGKKKVSEMEKHREQFVQGAAKRGVSQEVATELFDQMVAFAEYCFNKSHSTAYGLITFQ 772

Query: 776  TAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRI 835
            TA++K +YP E++AA ++    + +K++++        IQI PP +N   +DF    + I
Sbjct: 773  TAYLKANYPTEYMAALLSSVGGDQDKVQRYITYCLSIGIQIQPPDINRSGMDFTPQGSSI 832

Query: 836  YYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCF 894
             + L A+K VG    ++I+ A  AD PF SL DFC RVD + +NRR LE+L+ AGA DC 
Sbjct: 833  LFGLGAVKNVGEGAIQNILAARQADGPFTSLADFCQRVDLRIVNRRALEALICAGAFDCI 892

Query: 895  GYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIF------AHEKGTFSDKITLEKFSVENS 948
              +R QL+  LD I  +A    K++     ++F            F +            
Sbjct: 893  SGNRKQLIADLDPILSWAAQRAKSKAIGQASLFDLLGSSGSAGNGFVEAPRGPVTEDFPP 952

Query: 949  SVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKK 1008
              +   E+ +LGFY S HPL   +   R +      +        ++ + A+V + +   
Sbjct: 953  QEKLRLERELLGFYVSDHPLRRIQEQARLLAPVNLADLGGCAADASVGVLALVTAIKNVT 1012

Query: 1009 TRKGSRIGWVTFSEPAKEYEANFFP 1033
            T+KG R+  +   +     EA  FP
Sbjct: 1013 TKKGDRMAILQLEDLTGSCEAVIFP 1037


>gi|325507930|gb|ADZ19566.1| DNA polymerase III DnaE [Clostridium acetobutylicum EA 2018]
          Length = 1164

 Score =  802 bits (2072), Expect = 0.0,   Method: Composition-based stats.
 Identities = 375/1059 (35%), Positives = 578/1059 (54%), Gaps = 54/1059 (5%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
             FVHL VH+ YSLL+G+  +  ++++       +IAITD   ++  +EF + A   GI+P
Sbjct: 7    DFVHLHVHTEYSLLDGSGKVKKLVERAKELGMKSIAITDHGAMYGCVEFYKAAKEVGIKP 66

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +         +        +VLLV    GY+ L+E+VS   + +      
Sbjct: 67   IIGCEIYVAGKSMHIKHPDAEN---ETYHLVLLVKNEIGYKNLMEIVSTASI-EGFYYKP 122

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
            R+   +L    +EGLI  +    G +      ++ + A+K  L +K+ F D  Y+ LQ H
Sbjct: 123  RVDHEYLMS-HSEGLIASSACFGGEVQSYILKDNLEKAKKAALFYKETFKDGFYLELQYH 181

Query: 190  RGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               D       +V ++   ++PL+ATN+  ++++ED  AHD+L+ +     + +++R R 
Sbjct: 182  ALKDDMKVNDTLVNMSKELDIPLIATNDVHYINKEDSIAHDILLCIQTGKTIDEENRMRY 241

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
                 YLK++ EM   FS + EAL NT +IA  C+F  + H   LP F   E +D     
Sbjct: 242  APEQFYLKSQEEMYEQFSYVKEALLNTSKIADECNFEYKFHESKLPNFPLPEGEDHY--- 298

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L+     GL                  ++RL++EL +I  M +  YFLIV DFI++A
Sbjct: 299  -EYLKKLCYEGLNE-------RYNPITDTIKERLEYELGIIKEMGYVDYFLIVWDFIKFA 350

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            ++N +P GPGRGS AGS+ AY L IT IDP+++SL+FERFLNPDR+SMPD D DFC + R
Sbjct: 351  RENGVPTGPGRGSAAGSIVAYTLGITKIDPIKYSLIFERFLNPDRVSMPDIDSDFCYENR 410

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             +VI YV  KYG + V+QI+TFG++ A+  +RDVGRA+   Y +VD++ K+IPN     +
Sbjct: 411  QKVIDYVVEKYGKDCVSQIVTFGTMAARLCIRDVGRAMNYSYGEVDKIAKMIPNVLNINI 470

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+  +   +     D  +  L++IS+KLEGL RH STHAAG+VI  +PL   VP+ +
Sbjct: 471  D-KALEMNPELKAIYDDDDRIKDLIDISRKLEGLPRHTSTHAAGVVISSQPLVNYVPLLK 529

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
            +   +  V QF M  +E+ GL+K DFLGL+TLT++  ++  + Q R + +D+  I FDD+
Sbjct: 530  N--EESIVAQFTMGILEELGLLKMDFLGLRTLTVINDTIKMVKQNRNIDIDIDDIDFDDY 587

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
              Y ++    T+G+FQLES+GM   ++ ++PD +EDIIA +SLYRPGP++ I  Y   KN
Sbjct: 588  GVYKMIGEGKTVGVFQLESAGMTSFMKELKPDSLEDIIAGISLYRPGPMNEIPRYIRNKN 647

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E+I  + P +  +L  T G IIYQEQVMQI + L+GYS+  +D++RRAM KK    M+
Sbjct: 648  NPEEIKYVTPELKHILDVTYGCIIYQEQVMQIVRDLAGYSMGRSDLVRRAMSKKKHHVME 707

Query: 727  KQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            +++  FI             G  KNGIS+ IA  IF+ +  FA Y FNKSHAAAYAV++Y
Sbjct: 708  EERHNFIHGVVDENGNVEVPGCIKNGISEKIANEIFDSMMDFASYAFNKSHAAAYAVVAY 767

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            +TA++  +YP E+LAA +   M N EK+  + + A +  IQ++PP +N     F V ++ 
Sbjct: 768  ETAYLIHYYPAEYLAAMLNSVMGNSEKVAFYIRCAEELKIQVLPPDINGSYSRFTVKEDT 827

Query: 835  IYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + LAAIK VG      I+ A      F S  DFC+++D+ ++N+R +ES++ +G  D 
Sbjct: 828  IRFGLAAIKNVGFNVIESIVRARNEKGNFISFTDFCNKIDTSEVNKRAVESIIKSGGFDT 887

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAH--EKGTFSDKITLEKFSVENSSVR 951
             G  R +LL   + I        K       N+F    +      +I        +    
Sbjct: 888  LGVYRSKLLAVFEKIMDGISGQRKKNIKGQMNLFTDFVQDDYEEVEIQYPDIKEFDKKYL 947

Query: 952  FENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEES-----------------VATIRGNN 994
               E+ + G Y SGHPL+ Y+  L+ M      +                       G  
Sbjct: 948  LAMEKEMTGLYLSGHPLEDYEETLKNMTSIKISDIVAPQSLEDNDGVKLDENTDVQDGTR 1007

Query: 995  IRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            + +  +V S  +K TR  + + ++   +     E   FP
Sbjct: 1008 VIIGGIVTSVTKKVTRSNTMMAFIKLEDMYAAIEVVIFP 1046


>gi|254701591|ref|ZP_05163419.1| DNA polymerase III subunit alpha [Brucella suis bv. 5 str. 513]
 gi|261752144|ref|ZP_05995853.1| DNA polymerase III subunit alpha [Brucella suis bv. 5 str. 513]
 gi|261741897|gb|EEY29823.1| DNA polymerase III subunit alpha [Brucella suis bv. 5 str. 513]
          Length = 1163

 Score =  802 bits (2072), Expect = 0.0,   Method: Composition-based stats.
 Identities = 588/1033 (56%), Positives = 759/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPR   +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRLTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTIT +DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITGVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|322382903|ref|ZP_08056738.1| DNA polymerase III DnaE-like protein [Paenibacillus larvae subsp.
            larvae B-3650]
 gi|321153172|gb|EFX45627.1| DNA polymerase III DnaE-like protein [Paenibacillus larvae subsp.
            larvae B-3650]
          Length = 1210

 Score =  802 bits (2071), Expect = 0.0,   Method: Composition-based stats.
 Identities = 365/1050 (34%), Positives = 592/1050 (56%), Gaps = 44/1050 (4%)

Query: 17   HSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPIIGCQLD 76
            HS YSLL+GA  ++++ ++ A     A+A+TD   ++  + F +     GI+PIIGC++ 
Sbjct: 2    HSEYSLLDGAARIHDLTERAAELGMSALALTDHGVMYGTIAFYKACKQRGIKPIIGCEVY 61

Query: 77   IDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVRICLSWL 136
                   +  N+ + P   +  ++LL     GY+ L++L S  +L +      RI    L
Sbjct: 62   FTTGSIRQKGNRQEQP---IYHLILLAKNNTGYRNLMKLCSIGHL-EGFHYKPRIDAEHL 117

Query: 137  QEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHRGYDRY- 195
                +EGLI L+      + +    +  + A K    ++ +FG+  Y+ +Q H   ++  
Sbjct: 118  AA-HSEGLICLSACLGSEVSQHLLHDRKEDARKAAERYRSIFGEDFYLEIQDHGMMEQKK 176

Query: 196  RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV-TPDHYL 254
                +++L+    +PL+ATN+  ++ E D+E  DVL+ +     V  +DR ++ T   YL
Sbjct: 177  VMHSMIELSRETGIPLIATNDVHYVREPDHEVQDVLICIGTGKTVEDEDRLKMGTSQLYL 236

Query: 255  KNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEENELRNK 314
            K R  M ++F+ +PEA+ NT ++A +C   +++   ILP F               L+  
Sbjct: 237  KTREAMAALFAHVPEAVLNTEKVAAQCQVEIELGHSILPSFE---PIPESLTAAEYLKQL 293

Query: 315  AVAG---LEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAKKNN 371
             + G         +         +   Q+L +EL+VI  M FS YFLIV DFI++A +  
Sbjct: 294  CLEGISGRYGTRQEWNDPSSDFRKQVEQKLYYELDVIESMGFSDYFLIVWDFIRYAHEQG 353

Query: 372  IPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRDEVI 431
            I  GPGRGS AGS+ AYAL ITD+DP+ ++LLFERFLNP+R++MPD DIDF  +RRDEVI
Sbjct: 354  IMTGPGRGSSAGSLVAYALNITDVDPIEYNLLFERFLNPERITMPDIDIDFNDERRDEVI 413

Query: 432  RYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPVSLQA 491
             YV  KYG ERVAQIITFG++ AKAA+RDVGR L +PY++VD+  KLIPN     +    
Sbjct: 414  DYVVRKYGKERVAQIITFGTMAAKAAVRDVGRVLNLPYNEVDKAAKLIPNHLGMTIDHA- 472

Query: 492  IADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYRDVRS 551
            +  +S  RE     P    LL +++++EG+ RHASTHAAG+VI   PL+  VP+  +   
Sbjct: 473  LEVNSDLRELAEKQPKTAELLNMAKRVEGMPRHASTHAAGVVISRDPLTDYVPLQ-EGTE 531

Query: 552  DLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSL-DFLAQRGVKVDLSLIPFDDHETYH 610
              P+TQ++M+ +E  GL+K DFLGL+TL++++++L     Q G  VD +     D +TY 
Sbjct: 532  QTPLTQYSMEHLESIGLLKIDFLGLRTLSIIERTLAWIKEQEGKLVDWTQTDKSDPKTYE 591

Query: 611  LLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKNGKEK 670
            LL+   T G+FQLES GMR+ L+ ++P   EDII++++LYRPGP++ I  Y   K+ + +
Sbjct: 592  LLSRGETTGVFQLESPGMRRVLKELKPSRFEDIISVLALYRPGPMEFIPQYIACKHKQTE 651

Query: 671  IVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMDKQKE 730
             V  HP ++ +LK+T G+I+YQEQ+MQIA  ++G+SL EAD+LRRA+ KK +E +D+Q+ 
Sbjct: 652  PVYPHPSLETILKDTYGIIVYQEQIMQIASRMAGFSLGEADLLRRAVSKKKREVLDEQRS 711

Query: 731  RFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAA 790
             F+ G+   G +   A ++++++ +FADYG+ ++HA AY V+++QTA++K HYP  F+A+
Sbjct: 712  HFVEGSLGQGFTAEEANHVYDMIVRFADYGYPRAHATAYGVLAFQTAYLKAHYPRHFMAS 771

Query: 791  SMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVG------------------- 831
             +T    N  K+ ++  + R+  + ++PP +N   V F                      
Sbjct: 772  MLTAVTGNQRKMAEYVDECRRMKLDVLPPDINESGVLFTPVASPGFGTEPARYAGEPAEE 831

Query: 832  --------DNRIYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLE 883
                    +  I + LAAIK VG +    +++    + F SL DFC RVD +  N+RV+E
Sbjct: 832  GMADKIPVNGAIRFGLAAIKNVGASAIEAVLKERRKETFTSLLDFCRRVDLRICNKRVIE 891

Query: 884  SLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKF 943
            SL+ AGA D     R QL+  LD+  + A    K + +   ++F   +     ++ +   
Sbjct: 892  SLIQAGAFDTLPGHRAQLVAMLDDTAEAALKWRKEKDDLQLHLFGFVEEPHW-EVEVPDV 950

Query: 944  SVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVS 1003
             +     + + E+ ++G Y SGHPLD ++ +L ++      +       + + +A MV S
Sbjct: 951  PMLTKLQQLDYERELIGMYLSGHPLDAHEDLLGRLEADPLYQLQEYPDHSEVVVAGMVAS 1010

Query: 1004 KQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
             +   T++G  + ++   +   + E   FP
Sbjct: 1011 SKTIVTKRGEPMAFMELEDRIAKVEIVLFP 1040


>gi|238926991|ref|ZP_04658751.1| DNA-directed DNA polymerase [Selenomonas flueggei ATCC 43531]
 gi|238885225|gb|EEQ48863.1| DNA-directed DNA polymerase [Selenomonas flueggei ATCC 43531]
          Length = 1130

 Score =  802 bits (2071), Expect = 0.0,   Method: Composition-based stats.
 Identities = 378/1034 (36%), Positives = 596/1034 (57%), Gaps = 30/1034 (2%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            +F HL VH+ YSLL+GA  +  ++ +       A+A+TD   ++ A+ F ++A A GI P
Sbjct: 2    AFAHLHVHTEYSLLDGASRIKELVCRTKELGMDAVAMTDHGVMYGAVAFYKEAKAQGIHP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +   +      T       ++LL     GY+ L++L+S   + +      
Sbjct: 62   IIGCEVYLAPRQRQERAEVNGTR---YYHLILLAENECGYRNLVQLISLANI-EGYYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            RI    L+    +GLI L+   +G I +A      ++A+  +  +  +FG D  ++ +Q 
Sbjct: 118  RIDKELLRRFH-KGLIALSACVAGEIPQAVLRGDMELADALVREYSGIFGRDNFFLEIQD 176

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   +       + +LA  H + LVATN+  +++ ED E HD+L+ V     ++  DR R
Sbjct: 177  HGLPEEKKVNRTLRRLAEKHNIGLVATNDVHYVNTEDSEFHDILLCVQTGRTLNDPDRMR 236

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
             + PD+YLK+  EM ++F+D P A+ENT +IA RC          LP +           
Sbjct: 237  FSGPDYYLKSEEEMTALFADYPGAIENTAKIAERCQVDFTFGELQLPFYPLPGGYT---T 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
            +++ LR      +  R             +  QRLD+EL VI +M ++ YFLIV DFI +
Sbjct: 294  DDDYLRALCTERIPARYPAAGN-------EVHQRLDYELGVIHKMGYASYFLIVWDFINY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+ + + VGPGRGS AGS+ A+ L IT+IDPLR++LLFERFLNP+R+SMPD DIDF    
Sbjct: 347  ARGHGVAVGPGRGSAAGSIVAFLLGITNIDPLRYALLFERFLNPERVSMPDIDIDFDDIN 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R  VI YV+ +YG + VAQI TFG++ AK A+RDV R L+MP+ +V  + KL+P +    
Sbjct: 407  RGRVISYVKERYGEDHVAQIATFGTMGAKGAIRDVARVLEMPFGEVSTITKLVPAELNIT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+ + + FR     D    R++++++K+EGL R+ S HAAG+VI   PL+  VP++
Sbjct: 467  LD-RALKESADFRRRYEEDEEAHRVIDLARKIEGLPRNTSIHAAGVVIAKSPLTSQVPVW 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDD 605
              V     VT+++   +E  GL+K DFLGL+TL+++  +++ + Q  GV +++  IP  D
Sbjct: 526  --VSEGTLVTEYDKDDVEALGLLKMDFLGLRTLSIIADAVENIRQSHGVDINMDRIPLID 583

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNN 663
             +T  +L    T  +FQ+ES+GM   ++ +QP    D+I  V+LYRPGP+ + +   + +
Sbjct: 584  EKTSQMLCNGDTGAVFQMESAGMTNLVKELQPKGFVDLIPTVALYRPGPLGSGMVTDFID 643

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
              +GK+ +V +HPL++P+LKET GV++YQEQVMQI Q+L+G++L +AD+LRRAMGKK  E
Sbjct: 644  GLHGKKDVVYMHPLLEPILKETFGVVLYQEQVMQIVQVLAGFTLGQADLLRRAMGKKKHE 703

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             +  QKE F+ G  KNGI+  +A +IF+LL  FADYGFNKSH+AAY ++++QTA++K HY
Sbjct: 704  LLMAQKEIFLQGCEKNGIAAELANHIFDLLTHFADYGFNKSHSAAYGLLAWQTAYLKAHY 763

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEF+A  +T  MD  +KI  + Q   Q  I I+PP +N     F + D  I + LAA++
Sbjct: 764  PVEFMAGVLTSIMDKTDKIPVYIQLCHQMKINILPPDINASTASFSIEDGAIRFGLAAVR 823

Query: 844  GVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG      +++  A+   F SL +FC+RVD + +N+R +ESL+  GA DC G  R QLL
Sbjct: 824  NVGEAAIGSMVQVRAEGGKFHSLVNFCARVDMRTMNKRAIESLIKCGAFDCLGRERNQLL 883

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKI-TLEKFSVENSSVRFENEQRVLGF 961
             SLD   + A   +++R +    +F+ +      +I          +  R   E+   GF
Sbjct: 884  YSLDFAMQDAARSQRDRMSGQIGLFSSDTMESVQQIQDFPDVPPTTAEERLMWEKEATGF 943

Query: 962  YFSGHPLDVYKPILRKMGIKGYEESVA--TIRGNNIRLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y +GHPLD Y+  L  +      +           +R+  ++ + ++  T+KG  + +  
Sbjct: 944  YITGHPLDDYRDTLSSL--LPINDIRGELRKDRQLVRIGGILTNTKRYTTKKGDTMLFAE 1001

Query: 1020 FSEPAKEYEANFFP 1033
              + +   E   FP
Sbjct: 1002 MEDFSGRIEVTVFP 1015


>gi|148559880|ref|YP_001258802.1| DNA polymerase III subunit alpha [Brucella ovis ATCC 25840]
 gi|148371137|gb|ABQ61116.1| DNA polymerase III, alpha subunit [Brucella ovis ATCC 25840]
          Length = 1163

 Score =  802 bits (2071), Expect = 0.0,   Method: Composition-based stats.
 Identities = 590/1033 (57%), Positives = 761/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRIVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGGDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|302385506|ref|YP_003821328.1| DNA polymerase III, alpha subunit [Clostridium saccharolyticum WM1]
 gi|302196134|gb|ADL03705.1| DNA polymerase III, alpha subunit [Clostridium saccharolyticum WM1]
          Length = 1160

 Score =  802 bits (2071), Expect = 0.0,   Method: Composition-based stats.
 Identities = 367/1047 (35%), Positives = 564/1047 (53%), Gaps = 40/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            +F HL VH+ YSLL+G+  +  ++ +       ++AITD   ++  ++F + A   GI+P
Sbjct: 2    AFTHLHVHTEYSLLDGSCKIKELVARAKELGMDSMAITDHGVMYGVIDFYRAAREVGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +           G         +VLL    +GYQ L+++VS+ + +D      
Sbjct: 62   IIGCEVYVTSGSRFDRETAGGE--DRYYHLVLLAENNQGYQNLMKIVSKGF-VDGFYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L+E  +EG+I L+   +G + R       +   +  L ++++FG +  ++ LQ 
Sbjct: 119  RVDYEVLREY-SEGIIALSACLAGEVQRLVSRGLYEKGMEAALRYQEIFGKENFFLELQD 177

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H    +      ++++++   + LVATN+  +   ED   HD+L+ +     V+ ++R R
Sbjct: 178  HGIPAQNTVNQGLLRMSHETGIQLVATNDIHYTYAEDATPHDILLCIQTGKKVADENRMR 237

Query: 248  VTPDHYLKNRSEMVSI-FSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 Y     + +   FS   EA++NT  IA RC+  ++     LP++   E  D    
Sbjct: 238  YEGGQYYCKSEDEMRTLFSYAGEAIDNTHRIAERCNVEIEFGVTKLPKYDVPEGYD---- 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
              + L    + G                   ++RLD+EL+VI  M +  YFLIV DFI +
Sbjct: 294  SWSYLNKLCLDGFHRHYP-------LDDGTLKERLDYELDVIHSMGYVDYFLIVWDFIHY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+  +I VGPGRGS AGS+ +Y L IT+IDP+R++LLFERFLNP+R+SMPD D+DFC +R
Sbjct: 347  ARSQDIIVGPGRGSAAGSIVSYCLGITNIDPIRYNLLFERFLNPERISMPDIDVDFCFER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG ++V QI+TFG+L AK  +RDVGR L M Y++ D + K+IP D    
Sbjct: 407  RQEVIDYVVQKYGKDQVVQIVTFGTLAAKGVVRDVGRVLDMSYARCDSIAKMIPGDLGMT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+      R A   DP V  L+++S +LEGL RH S HAAG+VI    + + VP+ 
Sbjct: 467  LE-KALRQSPDLRNAYEGDPEVKYLIDMSMRLEGLPRHTSMHAAGVVISRTSVDEYVPLS 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLD-FLAQRGVKVDLSLIPFDD 605
            R        TQF M  +E+ GL+K DFLGL+TLT++Q ++      R + +D+  I ++D
Sbjct: 526  RAA-DGTITTQFPMTTLEELGLLKMDFLGLRTLTVIQNAVKAIEKNRNLSLDMDRIDYND 584

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
                  + T    G+FQLESSGM+  ++ ++P+ +EDIIA +SLYRPGP+D I  Y   K
Sbjct: 585  KAVLDSIGTGRDDGVFQLESSGMKSFMKELKPESLEDIIAGISLYRPGPMDFIPKYLKGK 644

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            N +  I      ++P+L  T G I+YQEQVMQI + L+GY++  +D++RRAM KK    M
Sbjct: 645  NDRSSITYECKQLEPILNPTYGCIVYQEQVMQIVRDLAGYTMGRSDLVRRAMSKKKTYVM 704

Query: 726  DKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            +K+++ F+         G   NGI + IA  I++ +  FA Y FNKSHAAAYAV+SYQTA
Sbjct: 705  EKERQNFVYGNPEEEVTGCISNGIDEKIANQIYDEMIDFAKYAFNKSHAAAYAVVSYQTA 764

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            ++K +YP EF+AA +T  MDNV K+ ++    RQ  I I+PP +N     F V    I Y
Sbjct: 765  FLKYYYPEEFMAALLTSVMDNVSKVSEYILSCRQMGIPILPPDINEGESGFSVSGRSIRY 824

Query: 838  SLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
             L+AIK VG +    I+     +  F  +EDF  R+ +K++N+R LE+ + +GALD    
Sbjct: 825  GLSAIKSVGKSVVELIVAEREQNGLFHDMEDFIDRMSNKEVNKRTLENFIKSGALDTLPG 884

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIF--AHEKGTFSDKITLEKFSVENSSVRFEN 954
            +R Q L +   + +      KN       +F  A E+     ++T               
Sbjct: 885  TRKQKLLTAPELLEQRSKERKNTMEGQMTLFDIAGEEEKTHFQVTFPDVGEFLKEDLLAF 944

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEES--------VATIRGNNIRLAAMVVSKQQ 1006
            E+  LG Y SGHP++ Y+   R        E              G+ + +  M+  K  
Sbjct: 945  EKETLGIYLSGHPMEAYETTWRNHITATTIEFVVDEETGKAGVPDGSYVTVGGMITGKTV 1004

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K TR    + ++T  + A   E   FP
Sbjct: 1005 KTTRNNKMMAFITLEDLAGAVEVIVFP 1031


>gi|225852339|ref|YP_002732572.1| DNA polymerase III subunit alpha [Brucella melitensis ATCC 23457]
 gi|256264162|ref|ZP_05466694.1| DNA polymerase III subunit alpha [Brucella melitensis bv. 2 str.
            63/9]
 gi|225640704|gb|ACO00618.1| DNA polymerase III, alpha subunit [Brucella melitensis ATCC 23457]
 gi|263094380|gb|EEZ18225.1| DNA polymerase III subunit alpha [Brucella melitensis bv. 2 str.
            63/9]
          Length = 1163

 Score =  802 bits (2071), Expect = 0.0,   Method: Composition-based stats.
 Identities = 590/1033 (57%), Positives = 761/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAALF 1044


>gi|308068343|ref|YP_003869948.1| DNA polymerase III alpha subunit [Paenibacillus polymyxa E681]
 gi|305857622|gb|ADM69410.1| DNA polymerase III alpha subunit [Paenibacillus polymyxa E681]
          Length = 1225

 Score =  802 bits (2071), Expect = 0.0,   Method: Composition-based stats.
 Identities = 397/1030 (38%), Positives = 600/1030 (58%), Gaps = 16/1030 (1%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
             SFVHL VHS YSLL+GA     ++ + +A    A+A+TD   ++ A+ F +     GI+
Sbjct: 2    SSFVHLHVHSEYSLLDGAARTAELVKQASAYGMKALALTDHGVMYGAIPFYRACVENGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC+  +      +   +G      +  ++LL     GYQ L++L S  +L +     
Sbjct: 62   PIIGCEAYMTAGSRKE---RGSRKDQPIYHLILLAKNKTGYQNLMKLCSIGHL-EGFHYK 117

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             RI +  L     EG+I L+    G + +         A +    ++ +FGD  Y+ LQ 
Sbjct: 118  PRIDMEALAA-HHEGIICLSACLGGEVPQHLLHGREAEARRAAERYRNIFGDDFYLELQD 176

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++ R    ++ LA   ++PLVATN+  +L+E D +  DVL+ +     V  ++R R
Sbjct: 177  HGLSEQKRVNPLLIALAKELDIPLVATNDVHYLTEPDADVQDVLICIGTGKTVDDEERLR 236

Query: 248  -VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T   +LK++ +M  +F  + EA+ NTV IA +C   L+    ILP +           
Sbjct: 237  IPTRQLFLKSQEDMARLFPHVAEAIANTVRIAEKCELELEFGQSILPEY---RPLPEGMT 293

Query: 307  EENELRNKAVAGLEVRL-AQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
              + LRN  V GLE R  +     +    +   QRL +ELN I  M FS YFLIV DFI 
Sbjct: 294  SSSYLRNLCVQGLERRYGSDSRWEQPEERERLNQRLSYELNTIDSMGFSDYFLIVWDFIA 353

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            +A K+ I  GPGRGS AGS+ AY L IT++DP++++LLFERFLNP+R+SMPD DIDF  +
Sbjct: 354  FAHKHKIATGPGRGSSAGSLVAYVLNITNVDPMKYNLLFERFLNPERISMPDIDIDFSDE 413

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RRDEVI YV  KYG+E VAQIITFG+L A+AA+RDVGR L +PY +VD+  KLIP     
Sbjct: 414  RRDEVIDYVVQKYGNEHVAQIITFGTLAARAAVRDVGRVLNVPYGEVDKAAKLIPAQLGI 473

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
             +   A+      +      P    LL+++ K+EG+ RHASTHAAG+VI   PL+  VP+
Sbjct: 474  NI-RHALEITPELKTLYETKPKTRELLDMAIKVEGMPRHASTHAAGVVISRTPLTDAVPL 532

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFD 604
              +    +P+TQ++M+ +E+ GL+K DFLGL+TL+++++ + ++A+  G   D S IP +
Sbjct: 533  Q-EGSEGVPLTQYSMENLERIGLLKMDFLGLRTLSIIERCIHWIAEDHGETPDFSRIPDN 591

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNR 664
            D  TY LL    T G+FQLES+G+R+ L+ ++P   EDII++++LYRPGP+  I  +   
Sbjct: 592  DPHTYDLLGKGDTGGVFQLESAGVRRVLKDLKPSVFEDIISVLALYRPGPMGFIPNFIQA 651

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+G+ +I   HP ++P+LK+T G+I+YQEQ+MQIA  ++G+SL EAD+LRRA+ KK +E 
Sbjct: 652  KHGQIEISYPHPDLEPILKDTYGIIVYQEQIMQIASRMAGFSLGEADLLRRAVSKKKREV 711

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            +D ++  F+ G+ K G ++  A  +++++ +FADYGF ++HAAAY V+++QTA++K HYP
Sbjct: 712  LDLERGHFVEGSIKQGYTEEEAGRVYDMIVRFADYGFPRAHAAAYGVLAFQTAYLKAHYP 771

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKV-GDNRIYYSLAAIK 843
            V+F+A+ +T  M +  K+ ++  + R+ +I ++PP VN   V F       I + LAAIK
Sbjct: 772  VQFMASMLTAVMGSHRKVAEYVVECRRMDITVLPPDVNESGVLFTPLQQGGIRFGLAAIK 831

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
             VGT     I+    ++ FDSL DFC RVD +  N+RV+ESL+ AGA D     R QLL 
Sbjct: 832  NVGTQAMESILAVRKERLFDSLLDFCRRVDLRVCNKRVIESLIQAGAFDSLTGHRAQLLA 891

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
             LD     A    K R +   ++F   +    D I        ++S + E E+ +LG Y 
Sbjct: 892  MLDETVDAAVKWRKERDDLQIDMFGFVEMPNWD-IEYPNVPQFSASQQLELERELLGLYL 950

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEP 1023
            SGHPLD ++ +L         E         +  A MVVS +   T++G  + ++   + 
Sbjct: 951  SGHPLDDFESLLESSEADRLMELGDVPDETVVVTAGMVVSLKTITTKQGKAMAFIELEDQ 1010

Query: 1024 AKEYEANFFP 1033
             +  E   FP
Sbjct: 1011 IERCEVVLFP 1020


>gi|153853950|ref|ZP_01995283.1| hypothetical protein DORLON_01274 [Dorea longicatena DSM 13814]
 gi|149753332|gb|EDM63263.1| hypothetical protein DORLON_01274 [Dorea longicatena DSM 13814]
          Length = 1158

 Score =  802 bits (2071), Expect = 0.0,   Method: Composition-based stats.
 Identities = 370/1047 (35%), Positives = 570/1047 (54%), Gaps = 39/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL VH+ YSLL+G+  +   + ++      ++AITD   ++  ++F + A AAGI+P
Sbjct: 2    SFAHLHVHTEYSLLDGSNKIKECVARVKELGMNSVAITDHGVMYGVIDFYRAARAAGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +           G +       +VLL     GY  L+++VSR +  +      
Sbjct: 62   ILGCEVYVAPGSRFDKEAVG-SGDDRYYHLVLLAENDLGYHNLMKIVSRGFT-EGYYYKP 119

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+ L  LQE   EG+I L+   +G + +       +  +   L ++ +FG    ++ LQ 
Sbjct: 120  RVDLEVLQEFH-EGIIALSACLAGEVQKNILRGMYEEGKAAALRYQDIFGKGNFFLELQD 178

Query: 189  HRGYDRYRESQ-VVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++   +Q +++++    + LVATN+  +   ED + HD+L+ +     ++ +DR R
Sbjct: 179  HGMQEQQIVNQSLLRMSQETGIELVATNDVHYTYAEDVKPHDILLCIQTGKKLADEDRMR 238

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +Y+K+  EM  +F    +ALENT +IA RC+  ++     LP++   E       
Sbjct: 239  YEGGQYYIKSEEEMKQLFPYALQALENTQKIADRCNVEIEFGVTKLPKYDVPEG----YT 294

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                L      GL+ R   G           ++RL++EL+VI  M +  YFLIV DFI +
Sbjct: 295  SWEYLNKLCFDGLKERYPDGD-------DSLKERLEYELSVIKSMGYVDYFLIVWDFINY 347

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+   I VGPGRGS AGS+ +Y L IT IDP+++ LLFERFLNP+R+SMPD D+DFC +R
Sbjct: 348  ARTQGIKVGPGRGSAAGSIVSYCLGITSIDPIKYQLLFERFLNPERVSMPDIDVDFCFER 407

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG +RV QI+TFG++ A+  +RDVGR + +PY+ VD + K++P +    
Sbjct: 408  RQEVIDYVGRKYGADRVVQIVTFGTMAARGVIRDVGRVMDLPYAFVDSIAKMVPTELNIT 467

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +  F++    D  V  L+++S++LEGL RH S HAAG+VIG R + + VP+ 
Sbjct: 468  LD-KALKMNPEFKKLYQEDEQVKELIDMSRRLEGLPRHTSMHAAGVVIGQRAIEEFVPLS 526

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-QRGVKVDLSLIPFDD 605
                     TQF M  +E+ GL+K DFLGL+TLT++Q +    +   G  +D++ I +DD
Sbjct: 527  LGS-DGSVTTQFTMTTLEELGLLKMDFLGLRTLTVIQDAERLASISSGKTIDINKIDYDD 585

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
                  + T  T G+FQLES+GM+  ++ ++P  +EDIIA +SLYRPGP+D I  Y   K
Sbjct: 586  KAVLASIGTGKTDGVFQLESAGMKNFMKELKPQNLEDIIAGISLYRPGPMDFIPQYIKGK 645

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            N  + I    P ++P+L  T G I+YQEQVMQI + L+GY+L  +D+LRRAM KK  + M
Sbjct: 646  NNPDSITYDCPQLEPILAPTYGCIVYQEQVMQIVRDLAGYTLGRSDLLRRAMSKKKGDVM 705

Query: 726  DKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
             K+++ F+         G   NGI +  A  I++ +  FA Y FNKSHAAAYAV+SYQTA
Sbjct: 706  QKERQNFVYGNPDEGVPGCIANGIDEKTANKIYDEMIDFAKYAFNKSHAAAYAVVSYQTA 765

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            W+K +YPVEF+AA MT  +DN  K+ ++    RQ  I+I+PP +N     F V    I Y
Sbjct: 766  WLKYYYPVEFMAALMTSVIDNPGKVSEYIYSCRQMGIKILPPDINKGEGSFSVDGGNIRY 825

Query: 838  SLAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
             LAAIK +G      I++   +   F +L+DF  R+  K++N+R +ES + +GA D  G 
Sbjct: 826  GLAAIKSIGKPVIESIIQERKNGGEFSNLKDFIERLSGKEVNKRTIESFIKSGAFDSLGG 885

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFEN 954
            +R Q +     I        K       ++F    +       I L          +   
Sbjct: 886  TRKQFMVVYVQILDQVNRERKYSMTGQLSLFDIVSDDQKSEFDIPLPDVGEYEKETKLAF 945

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV--------ATIRGNNIRLAAMVVSKQQ 1006
            E+ VLG Y SGHPL+ Y+   +K   +   +              G    +  M+ +K  
Sbjct: 946  EKEVLGVYLSGHPLEDYEEKWKKNISRTTLDFQIDDETGRTKVHDGAKEIVGGMITNKTI 1005

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K T+    + ++T  +     E   FP
Sbjct: 1006 KYTKTNKVMAFITLEDLVGSVEVVIFP 1032


>gi|209548886|ref|YP_002280803.1| DNA polymerase III subunit alpha [Rhizobium leguminosarum bv.
            trifolii WSM2304]
 gi|209534642|gb|ACI54577.1| DNA polymerase III, alpha subunit [Rhizobium leguminosarum bv.
            trifolii WSM2304]
          Length = 1165

 Score =  802 bits (2070), Expect = 0.0,   Method: Composition-based stats.
 Identities = 640/1031 (62%), Positives = 807/1031 (78%), Gaps = 6/1031 (0%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            +P F+HL+VHS+YSLLEGAL L  IL K   D QPAIAITDTNNLF ALEFSQKA   G+
Sbjct: 16   TPGFIHLRVHSAYSLLEGALPLKKILYKATGDSQPAIAITDTNNLFIALEFSQKAMDDGL 75

Query: 68   QPIIGCQLDIDMQDNLKMTNQGKT-PFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            QPIIGCQ+ IDM+D L+   +G       +PSIVLL +T  GY+RL+++VSR YL  +  
Sbjct: 76   QPIIGCQVSIDMEDGLETEKRGGQQALVKLPSIVLLAATDAGYERLVDVVSRAYLGGESN 135

Query: 127  QSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNL 186
            Q++ I  SWL+E GTEGLI LTG  +GP+D A         E RLL  K+LFGDRLYV L
Sbjct: 136  QAIHIRASWLEEAGTEGLIALTGALTGPVDAAIKEGHPAQGEARLLALKRLFGDRLYVEL 195

Query: 187  QRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
            QRH  YD+  E ++V LAY H+LPLVATN + F + +DY+AHD LMAVAH+ +VS   R 
Sbjct: 196  QRHGTYDKRHEQKIVGLAYAHDLPLVATNEAFFPTRDDYDAHDALMAVAHNAIVSDDSRF 255

Query: 247  RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFI--EKECDDIQ 304
            R+TPDHYLK+R+EM  +F+DLPEALENT+EIA+RCSF+L+   PILPRF     + ++ +
Sbjct: 256  RLTPDHYLKSRAEMAKLFADLPEALENTIEIAKRCSFVLKTRKPILPRFTGATDDAEEAE 315

Query: 305  KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFI 364
            + E +ELR +AV GL++RLA   ++ GY   DYR+RLDFEL+VI RM+F GYFLIVADFI
Sbjct: 316  RAEASELRRQAVEGLDMRLATLGMSPGYEEMDYRERLDFELSVIERMRFPGYFLIVADFI 375

Query: 365  QWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQ 424
            +WAK+++IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNP+R+SMPDFDIDFCQ
Sbjct: 376  KWAKQHDIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPERVSMPDFDIDFCQ 435

Query: 425  DRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA 484
            DRR+EVIRYVQ KYG E+VAQIITFGSLQA+AALRDVGR L+MPY QVD++CKL+PN+PA
Sbjct: 436  DRREEVIRYVQAKYGREQVAQIITFGSLQARAALRDVGRVLEMPYGQVDKICKLVPNNPA 495

Query: 485  HPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
            +P    +AI ++ + +E    +P V RLL+I+QK+EGLYRHASTHAAGIVIGDRPLS+LV
Sbjct: 496  NPTPLSKAIEEEPKLQEEAAKEPVVARLLDIAQKIEGLYRHASTHAAGIVIGDRPLSKLV 555

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPF 603
            PMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+ ++DF+A+RG+ VDL+ IP 
Sbjct: 556  PMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLKVAVDFVAKRGINVDLAAIPL 615

Query: 604  DDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNN 663
            DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI  YN 
Sbjct: 616  DDKLTYEMLSRGETVGVFQVESAGMRKALIGMKPDCIEDIIALVALYRPGPMENIPTYNA 675

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G E++ SIHP+ID +LKETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKIK 
Sbjct: 676  RKHGDEELESIHPMIDHLLKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIKA 735

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
            EMD+Q+ERF+ GA KNG+SK  A NIFELLAKFA+YGFNKSHAAAYA++SYQTA+MK HY
Sbjct: 736  EMDQQRERFVVGAVKNGVSKPQADNIFELLAKFANYGFNKSHAAAYAIVSYQTAYMKAHY 795

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            PVEFLAASMTL+M N EK+  F QDA++  I+++ PSV T    F+ GDNRIYY+LAA+K
Sbjct: 796  PVEFLAASMTLDMSNTEKVNDFRQDAKRLGIEVIAPSVQTSFRHFQTGDNRIYYALAALK 855

Query: 844  GVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQ 903
            GVG +   HI+E   DKPF  +EDFC R+D +++NRRVLESL+FAGA DCFG  R QL  
Sbjct: 856  GVGESAVDHIVEVRGDKPFAGIEDFCLRIDPRQVNRRVLESLIFAGAFDCFGTDRAQLSA 915

Query: 904  SLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYF 963
             LD I  YAQ  ++N+ +   +IF     +  +KI+L  FS   +S R   E +VLGFY 
Sbjct: 916  GLDRILGYAQRAQENKLSGQSDIFGSTLTSGPEKISLPPFSPWLASERLLKEFQVLGFYL 975

Query: 964  SGHPLDVYKPILRKMGIKGYEESVATIRGN--NIRLAAMVVSKQQKKTRKGSRIGWVTFS 1021
            + HPLD Y  +L+KM ++ + E    I+    N RLA  V+SKQ++KTR G+++G + FS
Sbjct: 976  TAHPLDSYANLLQKMRVQTFAEFSQAIKQGAFNARLAGTVISKQERKTRTGNKMGIIVFS 1035

Query: 1022 EPAKEYEANFF 1032
            + + ++EA  F
Sbjct: 1036 DSSGQFEAVLF 1046


>gi|220928884|ref|YP_002505793.1| DNA polymerase III DnaE [Clostridium cellulolyticum H10]
 gi|219999212|gb|ACL75813.1| DNA polymerase III, alpha subunit [Clostridium cellulolyticum H10]
          Length = 1159

 Score =  802 bits (2070), Expect = 0.0,   Method: Composition-based stats.
 Identities = 375/1056 (35%), Positives = 593/1056 (56%), Gaps = 51/1056 (4%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VH+ YSLL+GA  + +++ ++      ++AITD   ++  +EF ++A   GI+PI
Sbjct: 4    FVHLHVHTEYSLLDGANRIKDLIQRVKELGMDSVAITDHGVMYGVVEFYKEAVENGIKPI 63

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++    +          + +     +VLL     GY+ L+++VS  +  +      R
Sbjct: 64   LGCEVYTAKRTMQDKQPGIDSDYG---HLVLLAKNQIGYKNLMKIVSLGFT-EGYYYKPR 119

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +    L+   +EG+I L+   SG I  A   N  + A +      ++FG    Y+ LQ +
Sbjct: 120  VDYETLERY-SEGIIALSACLSGDIPSAILSNDYEKAVELANRLNRIFGQGNFYLELQHN 178

Query: 190  RGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++      +++++    +PLVATN++ +L++E  ++H++L+ +     ++  +R R 
Sbjct: 179  GINEQNLVNQHLIKMSGELGIPLVATNDAHYLTKESAKSHEILLCIQTGKTINDDNRMRF 238

Query: 249  TPDH-YLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
              D  Y+K+  EM   F ++ +ALENTV+IA  C+  L+     LP F  +E        
Sbjct: 239  NTDEVYVKSPEEMYDNFKNIKQALENTVKIAEMCNVELEFGKLHLPSFDVEEG----YTP 294

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               LR +   GL+ R  +        +++   RL++EL+VI++M +  YFLIV DFI++A
Sbjct: 295  YEYLREQCYKGLKSRYGE------SCSEEIVHRLEYELSVISQMGYVDYFLIVWDFIRYA 348

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            +  +I VGPGRGS AGS+ +YAL IT IDPL+++LLFERFLNP+R+SMPD DIDFC +RR
Sbjct: 349  RDQDIMVGPGRGSAAGSIVSYALGITSIDPLKYNLLFERFLNPERISMPDIDIDFCYERR 408

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RV+QIITFG++ A+A +RDVGRAL +PY  VD + K+IP      +
Sbjct: 409  QEVIDYVIRKYGKDRVSQIITFGTMAARAVIRDVGRALDIPYGDVDAIAKMIPFQIGMNI 468

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +A+  +   ++    D     L++ ++ LEGL RHASTHAAG+VI   P+ + VP+  
Sbjct: 469  D-KALELNQELKKRYDTDEETQVLIDTARTLEGLPRHASTHAAGVVISKEPIVEYVPLQL 527

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDDH 606
            +   +   TQ     +E+ GL+K DFLGL+TLT+++ ++D + Q  G K+D+  I FDD 
Sbjct: 528  N--DNSVTTQVTAVPLEELGLLKMDFLGLRTLTVIRDAVDLVEQGHGRKIDIQQIDFDDK 585

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            + Y ++    T+G+FQLES+GM Q ++ +QP  +EDIIA +SLYRPGP+D I  Y   KN
Sbjct: 586  DVYKMIGEGRTVGVFQLESAGMTQFMKELQPTSLEDIIAGISLYRPGPMDQIPRYIRNKN 645

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              + I   HP+++ +L  T G ++YQEQVMQI + L GYS+  +D++RRAM KK    M+
Sbjct: 646  NPKHIRYHHPMLEKILDVTYGCMVYQEQVMQIVRELGGYSMGRSDLVRRAMSKKKISVME 705

Query: 727  KQKERFIS------------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            ++++ FI             GA KNG+ +  A  IF+ +  FA Y FNKSHAAAYAV++Y
Sbjct: 706  QERKNFIYGITDEEGNEIVKGAVKNGVDEITANKIFDEMMDFASYAFNKSHAAAYAVVAY 765

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTAW+K +YP+EF+AAS+   + + +K+ ++  + +  NI+++PP +N   V F V +  
Sbjct: 766  QTAWLKFYYPIEFMAASINSFLGSSDKVSQYVNECKILNIKVLPPDINESNVKFTVINKN 825

Query: 835  IYYSLAAIKGVGTTTARH-IMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDC 893
            I + LAAIK VG    +  I+E   +  F S  DFC R++ + +N+R +ESL+ +GA D 
Sbjct: 826  IRFGLAAIKNVGENAIKSVIVERQQNGEFKSFLDFCQRIEGRDINKRCIESLIKSGAFDS 885

Query: 894  FGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFS-DKITLEKFSVENSSVRF 952
                R +L+   + +        K   +   +IF          +          ++V  
Sbjct: 886  LKVFRSKLMAVYERLLDGISQNRKKNMDGQLSIFDMMSEPQELLQEDYPDIKEYPANVLL 945

Query: 953  ENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEES---------------VATIRGNNIRL 997
              E+ +LG Y SGHPL  Y+ IL         E                        + +
Sbjct: 946  AMEKEMLGLYVSGHPLSEYQDILETNVNLYSSEMFIDTDENSNDIELNSKKLQDSMKVTV 1005

Query: 998  AAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
              +VVSK+ K T+  + + +V   +     E   FP
Sbjct: 1006 GGIVVSKKTKATKNNNLMAFVGLEDLYGTMELIVFP 1041


>gi|146341074|ref|YP_001206122.1| DNA polymerase III subunit alpha [Bradyrhizobium sp. ORS278]
 gi|146193880|emb|CAL77897.1| DNA polymerase III, alpha subunit [Bradyrhizobium sp. ORS278]
          Length = 1174

 Score =  802 bits (2070), Expect = 0.0,   Method: Composition-based stats.
 Identities = 533/1037 (51%), Positives = 706/1037 (68%), Gaps = 14/1037 (1%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +  +  FVHL VHS+YSLL+G++ +  + +   AD+QPA+A+TDT+N+F ALEFS K   
Sbjct: 1    MSSA-GFVHLHVHSAYSLLKGSIKIAKLGELAKADRQPALALTDTDNMFGALEFSDKMAG 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GIQPI GC+L ID  D +    +          IVLL +  EGY+ L+ L SR +L   
Sbjct: 60   YGIQPIAGCELAIDFGD-MDPNARNAGAVAQPSRIVLLAANEEGYRHLMRLNSRAFLETP 118

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
              Q+  I   WL E G +GLI LTGG  GPI  A   + + +A +R       FGDRLY+
Sbjct: 119  THQAPHIKFDWLTE-GVDGLIALTGGPDGPISLALQHDMAALAAQRCERLAGQFGDRLYI 177

Query: 185  NLQRHR-GYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             LQRH    +R  E  ++ +AY   LPLVATN   F S +DYEAHD L+ +A   +++  
Sbjct: 178  ELQRHGTERERRVEGGLIDIAYDKGLPLVATNEPYFASTDDYEAHDALLCIAGGHLIADT 237

Query: 244  DRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD-- 301
            DR ++TPDH  K R+EM  +F+DLPEAL +TVEIA RCS+  +   PILP F        
Sbjct: 238  DRVQLTPDHRFKTRAEMAVLFADLPEALASTVEIAERCSYRPRTRKPILPFFTVGAGTGD 297

Query: 302  --DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
              D    E  EL+ +A  GLE RL    +A G   +DY++RL FEL+VI RMK++GYFLI
Sbjct: 298  TVDAASAEAAELKRQAEEGLERRLKVHGMAPGMTEEDYQKRLAFELDVIMRMKYAGYFLI 357

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V+DFI+WAK + IPVGPGRGSGAGS+ A+ LTITD+DP+RF+LLFERFLNP+R+SMPDFD
Sbjct: 358  VSDFIKWAKAHGIPVGPGRGSGAGSLVAWVLTITDLDPMRFALLFERFLNPERVSMPDFD 417

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            IDFCQDRR EVI YVQ +YG ++VAQIITFG+LQA+  LRDVGR LQMPY QVD+L KL+
Sbjct: 418  IDFCQDRRGEVISYVQQRYGRDQVAQIITFGTLQARGVLRDVGRVLQMPYGQVDKLTKLV 477

Query: 480  PNDPAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRP 538
            P +PA PV+   AI  + + +  R  DP V R  +I+ +LEGL RHASTHAAGIVIGDRP
Sbjct: 478  PQNPAAPVTLAAAIEGEPKLQAFRDEDPVVARAFDIAMRLEGLTRHASTHAAGIVIGDRP 537

Query: 539  LSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDL 598
            LS+LVPMYRD +SD+PVTQFNMKW+E AGL+KFDFLGLKTLT+L  ++  L QR V VDL
Sbjct: 538  LSELVPMYRDPKSDMPVTQFNMKWVEPAGLVKFDFLGLKTLTVLDVAVKLLKQRDVHVDL 597

Query: 599  SLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNI 658
            + +P DD  +Y +L     +G+FQ+ES GMR+AL  M+PD  EDIIALV+LYRPGP+ NI
Sbjct: 598  ATLPIDDAASYQMLARGDVVGVFQVESQGMRRALIDMRPDRFEDIIALVALYRPGPMANI 657

Query: 659  VVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMG 718
              Y  RK+G+E+   +HP+++P+LKET GVIIYQEQVMQ+AQ +SGYSL EAD+LRRAMG
Sbjct: 658  PTYCARKHGEEEPEYLHPILEPILKETFGVIIYQEQVMQVAQQMSGYSLGEADLLRRAMG 717

Query: 719  KKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            KKI+ EMDKQ+ RF+ GA KNG+ K  A  IF+LLAKFADYGFNKSHAAAYA++SY TA+
Sbjct: 718  KKIRAEMDKQRVRFVEGAVKNGVPKDQADTIFDLLAKFADYGFNKSHAAAYALVSYHTAY 777

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            MK HYPVEF+AASMTL+++N +K+ +F  +A++  I++ PPS+N     F+V  N I+Y+
Sbjct: 778  MKAHYPVEFIAASMTLDLNNTDKLSEFRAEAQRLGIKVEPPSINRSGPTFEVSGNTIFYA 837

Query: 839  LAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            LAA+KGVG      I+EA     PF SL DF SRV  + +N+R++E+L  AGA DC   +
Sbjct: 838  LAALKGVGPQAIEMIVEARNKGGPFTSLADFASRVSPRAINKRIIETLAAAGAFDCLDKN 897

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQR 957
            R ++    D I    Q   +  T+   ++F +     +  I L        + R   E  
Sbjct: 898  RARVFAGADAIVAACQRANEAATSGQNDMFGNAAD--APAIILPNIENWLPAERLRREYD 955

Query: 958  VLGFYFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRI 1015
             +GF+ SGHPLD Y   L+++ ++ + E   A   G    ++AA VVS+ +++T+ G+++
Sbjct: 956  AIGFFLSGHPLDDYAAALKRLRVQSWAEFSRAVKTGATAGKVAATVVSRMERRTKTGNKM 1015

Query: 1016 GWVTFSEPAKEYEANFF 1032
            G +  S+P   +EA  F
Sbjct: 1016 GIMGLSDPTGHFEAVLF 1032


>gi|163843098|ref|YP_001627502.1| DNA polymerase III subunit alpha [Brucella suis ATCC 23445]
 gi|163673821|gb|ABY37932.1| DNA polymerase III, alpha subunit [Brucella suis ATCC 23445]
          Length = 1163

 Score =  801 bits (2069), Expect = 0.0,   Method: Composition-based stats.
 Identities = 590/1033 (57%), Positives = 762/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF+ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFAALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|291280374|ref|YP_003497209.1| DNA polymerase III subunit alpha [Deferribacter desulfuricans SSM1]
 gi|290755076|dbj|BAI81453.1| DNA polymerase III, alpha subunit [Deferribacter desulfuricans SSM1]
          Length = 1160

 Score =  801 bits (2069), Expect = 0.0,   Method: Composition-based stats.
 Identities = 408/1047 (38%), Positives = 615/1047 (58%), Gaps = 34/1047 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            + K   FVHL +H+ YSLL+GA+ ++ ++ K+  +   A+AITD   ++  ++F  +A A
Sbjct: 1    MSK--DFVHLHLHTQYSLLDGAIHISELMQKLKENGSKAVAITDHGTMYGIVDFYTQALA 58

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
              I+PIIGC++ +            K        +VLL  T  G + L  LVS+ ++ + 
Sbjct: 59   NDIKPIIGCEVYVAPDSRFNKNYDKKE--DKNYHLVLLAQTNTGLKNLQYLVSKAHI-EG 115

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLY 183
                 RI    L +  ++GLI L+   +G   R       + A+K  L + ++ G D  +
Sbjct: 116  FYYKPRIDKELLAK-HSKGLIALSACLAGEPARKLLNEGYEAAKKAALEYYEIMGKDNYF 174

Query: 184  VNLQRHRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + +Q +   ++     ++++++    +PLVATN+  FL+ EDY +H VLM + +   ++ 
Sbjct: 175  LEIQDNGINEQNLVNKKLIEISKETGIPLVATNDCHFLNREDYYSHQVLMCIQYQQTLND 234

Query: 243  KDRP-RVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
             +R    + + Y+K+  EM   F+++ EAL NTV+IA RC+  +      LP +   E  
Sbjct: 235  PNRRDSHSSELYVKSPKEMWKSFNEVEEALINTVKIAERCNVSMTFGELHLPVYDVPEG- 293

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
                  +  L + +  GL  RLA+  +        Y +RL++EL +I    + GY+LIV 
Sbjct: 294  ---YTLKTYLEHISKEGLHKRLAKVPL---ELHSKYYERLEYELKIIHEKGYDGYYLIVW 347

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DFI +A+KN IPVGPGRGSGAGS+ AYA+ ITDIDP+++ LLFERFLNP+R SMPDFDID
Sbjct: 348  DFINYARKNKIPVGPGRGSGAGSLVAYAVGITDIDPIKYKLLFERFLNPERKSMPDFDID 407

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FC +RR+EVI YV+NKYGH+RVAQIITFG L A+  +RDVGR L++P   VD++ K+IP 
Sbjct: 408  FCMNRREEVIDYVRNKYGHDRVAQIITFGKLLARGVIRDVGRVLEIPLKTVDKIAKMIPE 467

Query: 482  DPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
             P   +  +A+  DS  +    +      LL+ + KLEGL R+A  HAAG+VI D+PL +
Sbjct: 468  KPGLTLK-KALEMDSELKPNIESIEKGKELLDHALKLEGLLRNAGMHAAGVVIADKPLVE 526

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGV-KVDLSL 600
             VP+ +  ++D  VTQF    +EK GL+KFDFLGLK LT++  +   + +      D+S 
Sbjct: 527  YVPLCKG-QNDEVVTQFEKDTLEKVGLVKFDFLGLKNLTVIDYASKLIRETKDSDFDISS 585

Query: 601  IPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP--IDNI 658
            IP DD +T+ LL++  T G+FQLESSGM+  L+ ++P   EDIIALV+LYRPGP     +
Sbjct: 586  IPLDDKKTFELLSSGETTGVFQLESSGMKNLLKKLKPTTFEDIIALVALYRPGPIGSGML 645

Query: 659  VVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMG 718
              +  RK+G +++    P ++ +LKET G+I+YQEQVMQIAQ+++GYSL  AD+LRRAMG
Sbjct: 646  DDFVKRKHGLQEVTYPLPELEEILKETYGIIVYQEQVMQIAQIVAGYSLGSADLLRRAMG 705

Query: 719  KKIKEEMDKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYA 770
            KK  EEM K +E F+         GA K G  + IA  IF+L+AKFA+YGFNKSH+AAYA
Sbjct: 706  KKKPEEMAKHREIFLYGDEKLGIEGAVKRGFDEKIASEIFDLMAKFAEYGFNKSHSAAYA 765

Query: 771  VISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKV 830
            ++SYQTA++K HYPVE++AA ++ E++  +K+  F  + ++  I+++ P +N    DF +
Sbjct: 766  MVSYQTAYLKAHYPVEYMAALLSNELEKGDKVVGFIDECKKMGIKVLKPDINESFRDFII 825

Query: 831  GDNRIYYSLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAG 889
              + I + L AIK VG      I++    +  + S+ D C RVD + +NR+VLESL+ AG
Sbjct: 826  TGDSIRFGLGAIKNVGFGAIDEIIKERKTNGKYKSIYDLCKRVDLRTVNRKVLESLIKAG 885

Query: 890  ALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNK---HENIFAHEKGTFSDKITLEKFSVE 946
            ALD FG +R Q LQ LD+  +  Q  ++ +       E+I         ++         
Sbjct: 886  ALDSFGKNRRQHLQVLDDAIESGQKEQQLKNEGIITIEDILKENGIDEIEEEHYPDVEEM 945

Query: 947  NSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQ 1006
              +   + E+ VLGFY + HPL  Y  IL     K   +   T   N I +  +V   + 
Sbjct: 946  PENELLKFEKEVLGFYLTNHPLVNYSNILDIF-TKRSSDIETTDENNLIMVGGIVKGVKN 1004

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
              T+   R+ +VT  +     +   FP
Sbjct: 1005 YITKTNERMAFVTLEDLEGTMDVVVFP 1031


>gi|166032119|ref|ZP_02234948.1| hypothetical protein DORFOR_01822 [Dorea formicigenerans ATCC 27755]
 gi|166027842|gb|EDR46599.1| hypothetical protein DORFOR_01822 [Dorea formicigenerans ATCC 27755]
          Length = 1156

 Score =  801 bits (2069), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/1047 (36%), Positives = 572/1047 (54%), Gaps = 39/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL VH+ YSLL+G+  +   + ++      ++AITD   +F  ++F + A A GI+P
Sbjct: 2    SFAHLHVHTEYSLLDGSNKIKECVARVKELGMNSVAITDHGCMFGVIDFYRAARAQGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +           G +       +VLL    EGY  L+++VSR Y  +      
Sbjct: 62   ILGCEVYVAPGSRFDKEAVG-SGDDRYYHLVLLAENDEGYHNLMKIVSRGYT-EGYYYKP 119

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+ L  L+E   EG+I L+   +G + +              L ++++FG    ++ LQ 
Sbjct: 120  RVDLELLREFH-EGIIALSACLAGEVQKNITRGMYSEGRAAALRYEEIFGKGNFFLELQD 178

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++      +++++    + LVATN+  +   ED  AHD+L+ +     ++ +DR R
Sbjct: 179  HGIPEQQTVNQALMRMSQETGIELVATNDIHYTYAEDARAHDILLCIQTGKKLADEDRMR 238

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +Y+K+  EM  +F    +ALENT +IA RC   ++     LP++   +       
Sbjct: 239  YEGGQYYIKSEEEMKKLFPYALQALENTQKIADRCDVEIEFGVTKLPKYDVPDG----LS 294

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                L      GLE R           +QD + RLD+EL+VI +M +  YFLIV DFI +
Sbjct: 295  SWEYLNKLCYEGLERRYPN-------PSQDLKDRLDYELSVIHKMGYVDYFLIVWDFIHY 347

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+   I VGPGRGSGAGS+ AY L IT IDP+++ LLFERFLNP+R+SMPD D+DFC +R
Sbjct: 348  ARSQKIMVGPGRGSGAGSIVAYCLEITSIDPIKYQLLFERFLNPERVSMPDIDVDFCYER 407

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG +RV QI+TFG+L A+  +RDVGR + +PY+ VD + KLIP +    
Sbjct: 408  RQEVIDYVGRKYGADRVVQIVTFGTLAARGVIRDVGRVMDLPYAFVDNIAKLIPKELNIT 467

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+   S  R++   DP V  L+++S +LEGL RH S HAAG+VI  +P+ + VP+ 
Sbjct: 468  LD-KALKTSSELRKSYEEDPQVKELIDMSMRLEGLPRHTSMHAAGVVISQKPVEEYVPLS 526

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSLIPFDD 605
                     TQF    +E+ GL+K DFLGL+TLT+++ +  F     G +++++ I FDD
Sbjct: 527  LGS-DGSVTTQFVATTLEELGLLKMDFLGLRTLTVIRDAEKFASYSSGKEININKINFDD 585

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
                  + T  T G+FQLES+GM+  ++ ++P  +EDIIA +SLYRPGP+D I  Y   K
Sbjct: 586  KAVLDSIGTGKTDGVFQLESAGMKNFMKELKPQSLEDIIAGISLYRPGPMDFIPQYIKGK 645

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
               E I    P ++P+L  T G I+YQEQVMQI + L+GY+L  +D++RRAM KK  + M
Sbjct: 646  EHPELITYDCPQLEPILSPTYGCIVYQEQVMQIVRDLAGYTLGRSDLVRRAMSKKKADVM 705

Query: 726  DKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
             K+++ F+         G   NGI +  A  I++ +  FA Y FNKSHAAAYAV+SYQTA
Sbjct: 706  AKERQNFVYGNPEEGVPGCIANGIDEKTANKIYDEMTDFAKYAFNKSHAAAYAVVSYQTA 765

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            W+K +YPVE++AA MT  +DN  K+ ++    RQ  I+I+PP +N     F V +  I Y
Sbjct: 766  WLKYYYPVEYMAALMTSVIDNPGKVAEYIYSCRQMGIKILPPDINHGYSSFSVDNGSIRY 825

Query: 838  SLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
             LAAIK +G    + I+     +  F +L+DF  R+  K +N+R +E+ + +GA D  G 
Sbjct: 826  GLAAIKSIGRPVIKEIVAERKANGEFKNLKDFIERMSGKDINKRTIENFIKSGAFDELGG 885

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFEN 954
            +R Q +     I       +KN       +F    E+      I L        S +   
Sbjct: 886  TRKQFMVIYVQILDQVNREKKNSMTGQMTLFDIVGEEQKSEFDIPLPNVGEYEKSTKLAF 945

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV--------ATIRGNNIRLAAMVVSKQQ 1006
            E+ VLG Y SGHP++ Y+   RK   K  ++              G    +  ++ SK  
Sbjct: 946  EKEVLGIYLSGHPMEEYEEQWRKGISKTTQDFQFDEELGFSRVSDGAAEIIGGIIASKTI 1005

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K T+    + ++T  +     E   FP
Sbjct: 1006 KYTKNNKTMCFLTIEDIMGSVEVVVFP 1032


>gi|254713932|ref|ZP_05175743.1| DNA polymerase III subunit alpha [Brucella ceti M644/93/1]
 gi|254717010|ref|ZP_05178821.1| DNA polymerase III subunit alpha [Brucella ceti M13/05/1]
 gi|261218817|ref|ZP_05933098.1| DNA polymerase III subunit alpha [Brucella ceti M13/05/1]
 gi|261321684|ref|ZP_05960881.1| DNA polymerase III subunit alpha [Brucella ceti M644/93/1]
 gi|260923906|gb|EEX90474.1| DNA polymerase III subunit alpha [Brucella ceti M13/05/1]
 gi|261294374|gb|EEX97870.1| DNA polymerase III subunit alpha [Brucella ceti M644/93/1]
          Length = 1163

 Score =  801 bits (2068), Expect = 0.0,   Method: Composition-based stats.
 Identities = 589/1033 (57%), Positives = 760/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKG G     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGAGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|323700171|ref|ZP_08112083.1| DNA polymerase III, alpha subunit [Desulfovibrio sp. ND132]
 gi|323460103|gb|EGB15968.1| DNA polymerase III, alpha subunit [Desulfovibrio desulfuricans ND132]
          Length = 1184

 Score =  801 bits (2068), Expect = 0.0,   Method: Composition-based stats.
 Identities = 417/1050 (39%), Positives = 611/1050 (58%), Gaps = 36/1050 (3%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL VH+ YSLL+GA+ +N++L +      PA+AITD  ++F A+ F   A   GI+PI
Sbjct: 4    FVHLHVHTEYSLLDGAIRINDLLTRAKDLGMPAVAITDHGSMFGAVVFYMAAKELGIKPI 63

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            IGC++ +   D        +        ++LL     GY+ LI+LVS  YL D      R
Sbjct: 64   IGCEVYVAEGDVDDEEAHLRKEHGGGYHLILLAKNQRGYKNLIKLVSTGYL-DGFYYKPR 122

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHR 190
            +    L++  +EGLI L+   +G I R       +       T++ +F    Y+ LQ + 
Sbjct: 123  VSKHLLKKY-SEGLIALSACLAGEIPRKLMNEGLEAGADMARTYESIFPGNFYLELQDNG 181

Query: 191  GYDRYRESQVV-QLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV- 248
               + R ++++ + A    LPLVATN+  +L+ ED+EAHD L+ +   T V  + R R+ 
Sbjct: 182  IGKQTRLNELLVKCAEKTGLPLVATNDCHYLTAEDFEAHDTLLCIQTQTTVDAEKRFRME 241

Query: 249  TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEE 308
            T + Y K   EM   F+ +PEA+ NT  IA +C+  +++     P +   E   +     
Sbjct: 242  TKELYFKTPEEMEKAFAHVPEAILNTQRIAEQCNLEIELGNYYFPEYKLPEGVSMN---- 297

Query: 309  NELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWAK 368
             E       GL+ RL    I        Y +RLD+EL VI +M F  YFLIV DFI WAK
Sbjct: 298  EEFERLCREGLQRRL--NTITYEVDEGKYWKRLDYELGVIKQMGFPAYFLIVQDFINWAK 355

Query: 369  KNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRRD 428
             + IPVGPGRGS AGS+ A++L IT++DPL + LLFERFLN +R+SMPD D+DFC+ RR 
Sbjct: 356  DHRIPVGPGRGSAAGSIVAWSLKITNLDPLPYDLLFERFLNVERVSMPDIDVDFCERRRL 415

Query: 429  EVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDP----- 483
            EV++Y   KYG +RVAQI TFG+++ KA ++DVGRAL M + + DR+ KLIP+DP     
Sbjct: 416  EVVKYCAEKYGVDRVAQITTFGTMKTKAVIKDVGRALGMSFGETDRIAKLIPDDPAVMAK 475

Query: 484  ------AHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDR 537
                  A      A+   +   +    DP V +L++IS +LEGL RHASTHAAG+VI ++
Sbjct: 476  LLGVEKAKITVPNAVKAVTELDDMVATDPKVAKLIDISTRLEGLCRHASTHAAGVVISNK 535

Query: 538  PLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-GVKV 596
            P+++ +P+Y+  +    VTQF+MK +EK GLIKFDFLGL+T+T+++  LD + ++     
Sbjct: 536  PMTEYLPLYKG-KKGEIVTQFDMKKVEKVGLIKFDFLGLRTMTVIEDCLDIIREQGKKAP 594

Query: 597  DLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPI- 655
            DL  +  DD ET+ +     T GIFQ+ESSGMR+ L  + PDC EDI+A+++LYRPGP+ 
Sbjct: 595  DLETLHLDDPETFAIFAKGDTDGIFQVESSGMRKYLRMLGPDCFEDIVAMLALYRPGPLG 654

Query: 656  -------DNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLS 708
                     +  +  RK+G+  +   HP ++  LK T GV++YQEQVM  A +++ YSL 
Sbjct: 655  MIGSHGVSMVDEFIMRKHGEIAVTYPHPSLEETLKPTYGVMVYQEQVMATAMVIANYSLG 714

Query: 709  EADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAA 768
            E D+LRRAMGKKI EEM KQ+ RF+ G+ +NGI   +A +IF+ + KFA YGFNKSH+AA
Sbjct: 715  EGDLLRRAMGKKIAEEMAKQRSRFLEGSRENGIDDAVANDIFDTMEKFAAYGFNKSHSAA 774

Query: 769  YAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDF 828
            YA+ISY TA++K H+PVEF+AA M+ EM+N +KI  +    R  +I +  P +N     F
Sbjct: 775  YALISYHTAYLKAHFPVEFMAALMSTEMNNTDKIIMYVNACRDMDITVRQPDINAGQARF 834

Query: 829  KVGDNRIYYSLAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVF 887
             V +  I +++AAIK VG      I+   A+  PF ++ DFC RV+ +++ +RVLESL+ 
Sbjct: 835  SVKNGEILFAMAAIKNVGEEAINEIVAERAEQGPFLNIFDFCERVNLRRVTKRVLESLIK 894

Query: 888  AGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIF----AHEKGTFSDKITLEKF 943
            AGALDCF  SR  LL+ LD      Q   K + +   N+        K   + + T    
Sbjct: 895  AGALDCFSCSRAALLEDLDKAVALGQKKAKEKESGMLNMLDLLGGGGKSDATAQPTCSLC 954

Query: 944  SVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVS 1003
                   + + E+ VLGF+ SGHPL  Y+  ++++     E+      G  +R+A ++  
Sbjct: 955  EEFEDREKLQLEKEVLGFFLSGHPLLAYRHDMQRLRTVTLEDCKTIPNGTEVRVAVIIPD 1014

Query: 1004 KQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
             +Q  TRKG  + +    +     E    P
Sbjct: 1015 FKQHITRKGDPMAFCNAEDLTTYGEITMLP 1044


>gi|18309342|ref|NP_561276.1| DNA polymerase III DnaE [Clostridium perfringens str. 13]
 gi|18144018|dbj|BAB80066.1| DNA polymerase III, subunit alpha [Clostridium perfringens str. 13]
          Length = 1192

 Score =  801 bits (2068), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/1078 (35%), Positives = 599/1078 (55%), Gaps = 67/1078 (6%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL +HS YSLL+G+  +  ++ +       +IA+TD   ++  ++  ++A A GI+PI
Sbjct: 6    FCHLHLHSGYSLLDGSGKIKPLIKRAKELGMESIALTDHGVMYGCVDLYKEAKAEGIKPI 65

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +  +     +N           +VLLV   +GY+ L+++VS   + +      R
Sbjct: 66   LGCEVYVVPKSRKIKSNDEDN---KTYHLVLLVKNEKGYENLMKIVSVASI-EGFYYKPR 121

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHR 190
            I   +L+E  +EG+I L+    G + +A    +   A +  + ++  F D  Y+ LQ H 
Sbjct: 122  IDREYLKE-HSEGIIALSACLGGEVQKAILNGNIDKAREAAIFYRDTFKDGFYLELQNHG 180

Query: 191  GYDRYRESQV-VQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV- 248
              ++ + ++V +QLA    +PLVATN+  ++++ED +AHD+LM +     V   +R R  
Sbjct: 181  IEEQKKVNEVNIQLAKELNIPLVATNDVHYINQEDSKAHDILMCIQTGKTVDDPNRRRYP 240

Query: 249  TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEE 308
            +   YLK+  EM  +F  +PEALENT++IA  C+F  + H   LP+F   E      E  
Sbjct: 241  SDQFYLKSPEEMWDMFDYIPEALENTLKIAEECNFDYEFHVSKLPKFPLPEGV----EPF 296

Query: 309  NELRNKAVAGLEVRLAQGAI-------------AKGYHAQDYR---QRLDFELNVIARMK 352
              LR     GL  RL +                  G +    +   +RL++EL VI +M 
Sbjct: 297  EYLRKTCFDGLIDRLEELKPLKEKGIYDIDKVYEIGENNDKVKEDIERLEYELGVIKQMG 356

Query: 353  FSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDR 412
            +  YFLIV DFI++A  N IP GPGRGS AG++ AY L IT IDP+++SLLFERFLNP+R
Sbjct: 357  YVDYFLIVWDFIKYANDNGIPTGPGRGSAAGALVAYTLGITKIDPMKYSLLFERFLNPER 416

Query: 413  MSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQV 472
            +SMPD D DFC + R  VI YV  KYGH+ V+QIITFG++ A+A +RDVGRA+   Y++V
Sbjct: 417  VSMPDIDSDFCYEGRQRVIDYVVEKYGHDNVSQIITFGTMAARACIRDVGRAMNYTYAEV 476

Query: 473  DRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGI 532
            DR+ K IP      +  +A+  +   +     +  V  L+++S++LEGL RH+STHAAG+
Sbjct: 477  DRIAKQIPTVLGVTID-KALDLNPELKTIYDTEERVRELIDVSRRLEGLPRHSSTHAAGV 535

Query: 533  VIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-Q 591
            VI  +PL + VP+ ++   +  VTQF+M  +E+ GL+K DFLGL+TLT+++ ++D +   
Sbjct: 536  VIASQPLVEYVPLQKN--DESIVTQFDMTTLEELGLLKMDFLGLRTLTVMRDAVDMIKYN 593

Query: 592  RGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYR 651
            RGV +DL  + FDD E Y ++    T+G+FQLES+GM   ++ ++PDC+EDIIA +SLYR
Sbjct: 594  RGVDIDLDNLDFDDKEVYKMIGEGNTVGVFQLESAGMTSFMKELKPDCLEDIIAGISLYR 653

Query: 652  PGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEAD 711
            PGP+  I  Y + K   + +  I P ++ +L  T GV++YQEQVM+I + L+GYS+  +D
Sbjct: 654  PGPMAEIPRYISGKRDPKSVEYIVPELENILNVTYGVMVYQEQVMEIVRKLAGYSMGRSD 713

Query: 712  VLRRAMGKKIKEEMDKQKERFIS------------GASKNGISKTIAVNIFELLAKFADY 759
            ++RRAM KK  + M+++++ FI             G  +NGIS   A  IF+ +  FA Y
Sbjct: 714  LVRRAMSKKKHKVMEEERKNFIYGIEDENGNIEVPGCLRNGISAEAANKIFDSMMDFASY 773

Query: 760  GFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPP 819
             FNKSHAAAYAVI +QTA++  +YPVEFLAA +   M N +K+ ++ + A +  IQ++PP
Sbjct: 774  AFNKSHAAAYAVIGFQTAYLMRYYPVEFLAAMLNSVMGNSDKVSEYIRSAEKLGIQVLPP 833

Query: 820  SVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLN 878
             +N     F V  + I + + AIK VG     +I ++      F SL DFC+++D   +N
Sbjct: 834  DINESYTKFTVKGDTIRFGMGAIKNVGVNVVENIAKSRDEKGKFTSLMDFCNKIDLSIVN 893

Query: 879  RRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAH--EKGTFSD 936
            +R +ESL+ AG  D     R QLL   + I        K   +   ++F    E+   + 
Sbjct: 894  KRSVESLIKAGTFDSLKVYRSQLLSVFEKIMDGVYSQRKKNIDGQMSLFGALQEESESNL 953

Query: 937  KITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVA-------- 988
            +I        N       E+ + G Y SGHPLD Y+  L++      E+ +         
Sbjct: 954  EIRYPNIKEFNKKYMLAMEKEMTGLYMSGHPLDDYEKPLKEQTSITIEKIIEAQKNLNEQ 1013

Query: 989  -------------TIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
                            G  + +  ++ +  +K TR  + + +    +     E   FP
Sbjct: 1014 KNVELEDLVLDSSLTDGTRVIIGGILTNVSRKVTRNNTLMAFAKVEDLTGYLECVIFP 1071


>gi|315652846|ref|ZP_07905820.1| DNA-directed DNA polymerase III alpha subunit [Eubacterium saburreum
            DSM 3986]
 gi|315485048|gb|EFU75456.1| DNA-directed DNA polymerase III alpha subunit [Eubacterium saburreum
            DSM 3986]
          Length = 1152

 Score =  801 bits (2068), Expect = 0.0,   Method: Composition-based stats.
 Identities = 376/1046 (35%), Positives = 573/1046 (54%), Gaps = 37/1046 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL VH+ YSLL+G+  +  I+ +       ++AITD   ++  ++F ++A A GI+P
Sbjct: 2    SFTHLHVHTGYSLLDGSCKIKEIISRAKKLNMASLAITDHGVMYGVIDFYKEAKANGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +      +   +          ++LL    +GY+ L ++VS+ +  +      
Sbjct: 62   ILGCEVYVSPSSRFEKQAKQG---DRYYHLILLAKNNKGYENLTKIVSKGFT-EGFYYKP 117

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            RI    L+E   EG+I L+   +G I +       + A+K    +K LFG D  Y+ LQ 
Sbjct: 118  RIDFELLKEYH-EGIIALSACLAGEIPKLISRGREEEAKKVAKKYKDLFGEDNFYLELQN 176

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++      +V++    ++PLVATN+  +++ ED +AHD+L+ +     VS  DR R
Sbjct: 177  HGIPEQKFVNQSLVKIGKELDIPLVATNDIHYINAEDAKAHDILLCIQTGKTVSDPDRMR 236

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                  +LK+  EM ++F   PEA+ENT +IA  C+  ++     LP +           
Sbjct: 237  YEGGQFFLKSEDEMKALFPYAPEAVENTGKIADMCNVEIKFGETKLPEYPVPN----NLS 292

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                L +   +G E    +       + ++  +R+ +EL VI  M +  YFLIV D+I +
Sbjct: 293  AREYLESLCKSGFERNYPKDY----ENREEIEKRMYYELGVIETMGYIDYFLIVWDYINY 348

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+   I VGPGRGS AGSV +Y L ITDIDP++++L+FERFLNP+R+SMPD D+DF  +R
Sbjct: 349  ARSVGISVGPGRGSAAGSVVSYCLGITDIDPIKYNLIFERFLNPERVSMPDIDVDFADER 408

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG ERV QIITFG+LQA+  +RDVGRA+++PY++ D + K+IP D    
Sbjct: 409  RGEVIDYVVGKYGSERVCQIITFGTLQARGVIRDVGRAMEIPYARCDSIAKMIPRDKDIT 468

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +S  A+  +   +E   +D  V  L++ S KLEGL RHAS HAAG+VI  + + + VP+ 
Sbjct: 469  LS-LALERNKELKELYDSDEVVHELIDYSLKLEGLPRHASIHAAGVVISKKAVDEYVPLA 527

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDD 605
                 D   TQF M  +E+ GL+K DFLGL+TLT+LQ +L+ + +   V +DL  I + D
Sbjct: 528  LG-IDDAVTTQFTMTTLEELGLLKMDFLGLRTLTVLQNALEMIKKNHGVDIDLKKIDYSD 586

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
             + Y  ++T  T  +FQLES GM+  ++ ++P+ +EDIIA +SLYRPGP+D I  Y + K
Sbjct: 587  KKVYEFISTGKTDAVFQLESGGMQNFMKRLKPENLEDIIAGISLYRPGPMDFIPKYIDGK 646

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            N K K+    P +  +L+ T G I+YQEQVMQI + L+GY++  +D +RRAM KK    M
Sbjct: 647  NSKGKVSYDTPKLISILEPTYGCIVYQEQVMQIVRDLAGYTMGGSDEVRRAMSKKKAHVM 706

Query: 726  DKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            + +++ FI         G  KNGI + +A  IF+ +  FA Y FNKSHAA YAVISYQTA
Sbjct: 707  EMERKNFIYGNEEKKIKGCIKNGIDEKVANRIFDEMIDFASYAFNKSHAACYAVISYQTA 766

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            ++K +YP EF+AAS+T   DN  K+ ++        I+I+PP VN     F V  + I +
Sbjct: 767  YLKYYYPKEFMAASLTSVSDNPAKLSEYMGSLTDMGIKILPPDVNLGEGAFSVDKDGIRF 826

Query: 838  SLAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
             LA IKGVG   A  ++     +  + +LE+F +R+  K LN+R +ES + AGALD    
Sbjct: 827  GLATIKGVGKAVADVLVRERTLNGRYLTLENFINRLPQKDLNKRSIESFIKAGALDGLAG 886

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKI--TLEKFSVENSSVRFEN 954
            +R + + + + +        K       + F        D     +            + 
Sbjct: 887  NRHEKILNAELLIDKKSKESKAVIPGQISFFDVVDKDDRDSFVSEMIHIDEYKKEELLKY 946

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIR-------GNNIRLAAMVVSKQQK 1007
            E  VLG Y SGHPL+ Y  +L K       +             G  + +  ++    ++
Sbjct: 947  EMEVLGMYVSGHPLEEYITMLEKYTDVRSIDFYPDEDGNILIESGRKVVVGGLLSEVNKR 1006

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             T+KG  +   T  +     E   FP
Sbjct: 1007 FTKKGDMMAICTLEDMYGRIELVVFP 1032


>gi|258621011|ref|ZP_05716045.1| DNA polymerase III subunit alpha [Vibrio mimicus VM573]
 gi|258586399|gb|EEW11114.1| DNA polymerase III subunit alpha [Vibrio mimicus VM573]
          Length = 1159

 Score =  801 bits (2068), Expect = 0.0,   Method: Composition-based stats.
 Identities = 430/1048 (41%), Positives = 621/1048 (59%), Gaps = 38/1048 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P F+HL+VHS +S+++G   +  ++ K+AA   PA+A+TD  NL   ++F   A  
Sbjct: 1    MSD-PKFIHLRVHSDFSMVDGLSKVPPLVKKVAAMGMPAMALTDFTNLCGLVKFYSTAHN 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GI+PIIG    +          Q +     +  + +L     GY+ L  L+S+ YL   
Sbjct: 60   CGIKPIIGADFTL----------QSEEFGDELTKLTVLAKNNVGYKNLTLLISKAYLRGH 109

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
             +    I  +WL E   EGLI+L+GG SG I RA    + Q  EK L  ++  F D  Y+
Sbjct: 110  VQHQPVIDKAWLME-HAEGLIVLSGGKSGEIGRALLKGNQQQVEKCLEFYQTHFADHFYL 168

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             L R    D        ++LA  +ELP+VATN  +F++EE +EAH++ +A+     +   
Sbjct: 169  ELVRTGRADEESYLHFALELAEQYELPVVATNEVVFITEESFEAHEIRVAIHDGYTLEDP 228

Query: 244  DRPR-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             RP+  +P  YL++ +EM  +F+D+PEALEN+VEIA+RC+  +++       +       
Sbjct: 229  RRPKNYSPKQYLRSEAEMCELFADIPEALENSVEIAKRCNVTVRLGE-----YFLPNFPT 283

Query: 303  IQKEEENELRNKAVAGLEVRLA---QGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
                 E+ L  K+  GLE RL         +     +Y +RL  EL+VI +M F GYFLI
Sbjct: 284  EGMAIEDFLVMKSREGLEERLEFLFPDPEVRAQRRPEYDERLQIELDVINQMGFPGYFLI 343

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V +FIQW+K N+IPVGPGRGSGAGS+ AYAL ITD+DPL + LLFERFLNP+R+SMPDFD
Sbjct: 344  VMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLNPERVSMPDFD 403

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            +DFC D+RD+VI +V   YG + V+QIITFG++ AKA +RDVGR L  P+  VDR+ KL+
Sbjct: 404  VDFCMDKRDQVIDHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPFGFVDRISKLV 463

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P DP   +    IA +   +E   AD  V  L++  + LEG  R+A  HA G+VI    +
Sbjct: 464  PPDPGMTLEKAFIA-EPALQELYDADEEVKELIDKCRILEGCTRNAGKHAGGVVISPTAI 522

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKV--- 596
            +   P+Y D   + PVTQF+   +E AGL+KFDFLGL+TLT++  +L  +  R  K+   
Sbjct: 523  TDFAPIYCDAEGNFPVTQFDKNDVETAGLVKFDFLGLRTLTIIDWALGLVNPRLKKMGQP 582

Query: 597  --DLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
               +  IP DD  ++  L    T  +FQLES GM++ ++ +QPDC EDIIALV+L+RPGP
Sbjct: 583  PVRIEAIPLDDTRSFRNLQDAKTTAVFQLESRGMKELIKRLQPDCFEDIIALVALFRPGP 642

Query: 655  IDNIVV--YNNRKNGKEKIVS-----IHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSL 707
            + + +V  + +RK+G+E I        H  +  +L+ T G+I+YQEQVMQIAQ+LSGY+L
Sbjct: 643  LQSGMVDNFIDRKHGREAISYPDEKWQHESLKEILEPTYGIILYQEQVMQIAQVLSGYTL 702

Query: 708  SEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
              AD+LRRAMGKK  EEM KQ+  F  GA KNG+   +A+ IF+L+ KFA YGFNKSH+A
Sbjct: 703  GGADMLRRAMGKKKPEEMAKQRAVFQEGAEKNGVDGELAMKIFDLVEKFAGYGFNKSHSA 762

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
            AYA++SYQT W+KTHYP EF+AA MT +MDN EK+     + +   + ++PP +N+    
Sbjct: 763  AYALVSYQTLWLKTHYPAEFMAAVMTADMDNTEKVVGLVDECKNMGLTVLPPDINSGLYR 822

Query: 828  FKVGDN-RIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESL 885
            F V DN  I Y + AIKGVG      I+EA   D  F  L DFC+R+D KK+N+RV+E L
Sbjct: 823  FNVDDNGAIVYGIGAIKGVGEGPIEAILEARNKDGYFKDLFDFCARIDLKKVNKRVIEKL 882

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFS 944
            + AGALD  G  R  ++ S+D+  + A    +       ++F        + +    +  
Sbjct: 883  ILAGALDRLGPHRAAMMASVDDAVRAASQHHQAEAFGQTDMFGVLTDAPEEVEQKYTQVP 942

Query: 945  VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSK 1004
                 VR E E+  LG Y +GHP+D Y   L K       E+  T R  ++ +A +V++ 
Sbjct: 943  EWPEKVRLEGERETLGLYLTGHPVDEYLKELVKYTSCRLNEAAPTRRDQSLTVAGLVIAA 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            +   T++G+RIG +T  + +   E   +
Sbjct: 1003 RVMTTKRGTRIGLMTLDDRSGRMEVMLY 1030


>gi|82523671|emb|CAI78453.1| DNA polymerase III, alpha subunit [uncultured candidate division WS3
            bacterium]
          Length = 1160

 Score =  800 bits (2067), Expect = 0.0,   Method: Composition-based stats.
 Identities = 389/1035 (37%), Positives = 592/1035 (57%), Gaps = 27/1035 (2%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL  HS YSLL+GA  ++ ++ +    + PA+AITD  ++F A+EF  +A   GI+
Sbjct: 4    SDFVHLHNHSQYSLLDGACRIDRMVQRALEFRMPALAITDHGSMFGAIEFYSEAREHGIK 63

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIG +  +    + +          +   ++LL+  AEGY+ L++L S  Y +D     
Sbjct: 64   PIIGMEAYVTPGSHAEKP--AGKGMESYSHLLLLIRNAEGYRNLMKLSSASY-VDGFYYK 120

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGD-RLYVNLQ 187
             R+    L++ G +GL+  T    G   +     +   A + ++   ++FGD  +Y+ + 
Sbjct: 121  PRVDKELLRKYG-DGLLACTACLKGEPAQHVLAGNEDAARESIIELVEIFGDGHVYLEVH 179

Query: 188  RHRGYDRYRESQV-VQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
             H   +     Q  V+L     +PLVA N+  ++  E   AHDVL+ +     + + +R 
Sbjct: 180  NHGMPEEAVIRQAYVRLGRELGVPLVAANDCHYVRREQAAAHDVLLCIQTGREIDEPNRM 239

Query: 247  RV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
            R+   + Y+K+  EM  +F D P A ENT+E+A +C+  L      +P F   +      
Sbjct: 240  RMPNDEFYMKSPEEMRELFLDCPGAYENTIEVAEKCNLQLDFDHVHMPEFPIPQGYT--- 296

Query: 306  EEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
            +    L      GLE               +   R   EL++I +M F+GYFLIV DFI 
Sbjct: 297  DAAAHLEALTREGLEE-------RYETVTPEVEARAALELSMIGQMGFAGYFLIVHDFIH 349

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
             A++  IPVGPGRGS A S+ +YAL IT++DPL F L+FERFLNP R SMPDFDIDFC +
Sbjct: 350  EARRRGIPVGPGRGSAAASIVSYALGITELDPLEFGLVFERFLNPARKSMPDFDIDFCYE 409

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RR+E+I YV  KYG E VAQIITFG++QA+AA+RDVGR L+ PYS+VDR+ K++P +   
Sbjct: 410  RRNEIIEYVTEKYGRESVAQIITFGTMQARAAIRDVGRVLKFPYSEVDRVAKMVPRELNI 469

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
             +  +A+A     +  R +D    +LL+ +  LEGL RHAS HAAG++I    +    P+
Sbjct: 470  TLE-EALAKTPELKALRDSDERYAKLLDYAGDLEGLARHASVHAAGVIIAPGRIDDWAPL 528

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFD 604
            YR        TQ+ M  + + GL+KFDFLGL+TLT++  +L  + + RG+ +    IP D
Sbjct: 529  YR-SNKGEITTQYPMNSLARIGLLKFDFLGLRTLTVIHDALAMIRENRGIDLAPDRIPLD 587

Query: 605  DHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYN 662
            D ETY LL T  T+GIFQ+ESSGMR  L  ++P+ +ED+ A+ +L+RPGP+ + +   Y 
Sbjct: 588  DPETYELLGTGHTVGIFQVESSGMRDLLRKVRPERLEDMTAVNALFRPGPLGSGMVDDYV 647

Query: 663  NRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIK 722
             RK+G++K+  IHP + P+L+ET GV+ YQEQVMQI+  L+G+S+S+ADVL  AM KK+ 
Sbjct: 648  KRKHGRQKVSYIHPKLAPVLEETYGVMAYQEQVMQISSALAGFSMSQADVLLNAMRKKVV 707

Query: 723  EEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTH 782
            E+M  Q+E F++G  +NGIS+ IAV +F+ +  F+ YGFNK H+A YAV++ +TA++KTH
Sbjct: 708  EQMATQREDFLAGCRENGISERIAVKVFDQMEFFSGYGFNKPHSACYAVLAVRTAYLKTH 767

Query: 783  YPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKV-GDNRIYYSLAA 841
            +  EF+AA++T EMDN +++     + R+  I+++PP VN   V+F+      I + L+A
Sbjct: 768  FAPEFMAATLTSEMDNSDRVVALTGECRRLGIRVLPPDVNEGHVEFRATSRGDIQFGLSA 827

Query: 842  IKGVGTTTARHIMEA-SADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQ 900
            +K VG    R ++ A      F+ + D  SRVD + +NRRVLESLV AGALD     R Q
Sbjct: 828  VKNVGRAAVRSMVAARREHGSFEDVFDLTSRVDLRLVNRRVLESLVAAGALDGLHGHRAQ 887

Query: 901  LLQSLDNIQKYAQWVEKNRTNKHENI---FAHEKGTFSDKITLEKFSVENSSVRFENEQR 957
              +++       Q  +++R +   ++      + G+      L + +     V    E+ 
Sbjct: 888  QYEAIGAALDLGQRAQRDRDSGQTSLMDILDTDAGSELRPRRLPEATPWPDGVALAKEKE 947

Query: 958  VLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGW 1017
            VLG Y SGHPL  Y+  L         +    +    +RL  ++   +    RKG ++ +
Sbjct: 948  VLGMYVSGHPLARYEKELSTFATATTMDLAEMVDDEPVRLGGIITHVKTTADRKGEQMAF 1007

Query: 1018 VTFSEPAKEYEANFF 1032
            VT  +     E   F
Sbjct: 1008 VTLEDFTGSVELVVF 1022


>gi|237815260|ref|ZP_04594258.1| DNA polymerase III, alpha subunit [Brucella abortus str. 2308 A]
 gi|237790097|gb|EEP64307.1| DNA polymerase III, alpha subunit [Brucella abortus str. 2308 A]
          Length = 1190

 Score =  800 bits (2067), Expect = 0.0,   Method: Composition-based stats.
 Identities = 588/1033 (56%), Positives = 759/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 41   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 100

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 101  GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 160

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 161  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 219

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + F   ED+EAHD L+A+A   ++S  D
Sbjct: 220  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFPKAEDFEAHDALLAIAEGQILSNDD 279

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 280  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 339

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 340  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 399

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 400  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 459

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 460  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 519

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 520  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 579

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 580  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 639

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 640  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 699

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 700  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 759

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 760  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 819

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 820  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 879

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IK VG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 880  IKSVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 939

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 940  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 998

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 999  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1058

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1059 LSDASGQFEAVLF 1071


>gi|62289774|ref|YP_221567.1| DNA polymerase III subunit alpha [Brucella abortus bv. 1 str. 9-941]
 gi|82699702|ref|YP_414276.1| DNA polymerase III subunit alpha [Brucella melitensis biovar Abortus
            2308]
 gi|189024017|ref|YP_001934785.1| DNA polymerase III subunit alpha [Brucella abortus S19]
 gi|254697213|ref|ZP_05159041.1| DNA polymerase III subunit alpha [Brucella abortus bv. 2 str.
            86/8/59]
 gi|254730110|ref|ZP_05188688.1| DNA polymerase III subunit alpha [Brucella abortus bv. 4 str. 292]
 gi|260545478|ref|ZP_05821219.1| DNA polymerase III subunit alpha subunit [Brucella abortus NCTC 8038]
 gi|260757800|ref|ZP_05870148.1| DNA polymerase III subunit alpha [Brucella abortus bv. 4 str. 292]
 gi|260761623|ref|ZP_05873966.1| DNA polymerase III subunit alpha [Brucella abortus bv. 2 str.
            86/8/59]
 gi|62195906|gb|AAX74206.1| DnaE-2, DNA polymerase III, alpha subunit [Brucella abortus bv. 1
            str. 9-941]
 gi|82615803|emb|CAJ10801.1| Phosphoesterase PHP, N-terminal:PHP domain C-terminal region:OB-fold
            nucleic acid binding domain:DNA polymerase III alpha sub
            [Brucella melitensis biovar Abortus 2308]
 gi|189019589|gb|ACD72311.1| DNA polymerase III subunit alpha [Brucella abortus S19]
 gi|260096885|gb|EEW80760.1| DNA polymerase III subunit alpha subunit [Brucella abortus NCTC 8038]
 gi|260668118|gb|EEX55058.1| DNA polymerase III subunit alpha [Brucella abortus bv. 4 str. 292]
 gi|260672055|gb|EEX58876.1| DNA polymerase III subunit alpha [Brucella abortus bv. 2 str.
            86/8/59]
          Length = 1163

 Score =  800 bits (2067), Expect = 0.0,   Method: Composition-based stats.
 Identities = 588/1033 (56%), Positives = 759/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + F   ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFPKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPEALENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPEALENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +P V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKEPVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IK VG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKSVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|168204460|ref|ZP_02630465.1| DNA polymerase III, alpha subunit [Clostridium perfringens E str.
            JGS1987]
 gi|170664100|gb|EDT16783.1| DNA polymerase III, alpha subunit [Clostridium perfringens E str.
            JGS1987]
          Length = 1192

 Score =  800 bits (2066), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/1078 (35%), Positives = 599/1078 (55%), Gaps = 67/1078 (6%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL +HS YSLL+G+  +  ++ +       +IA+TD   ++  ++  ++A A GI+PI
Sbjct: 6    FCHLHLHSGYSLLDGSGKIKPLIKRAKELGMESIALTDHGVMYGCVDLYKEAKAEGIKPI 65

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +  +     +N           +VLLV   +GY+ L+++VS   + +      R
Sbjct: 66   LGCEVYVVPKSRKIKSNDEDN---KTYHLVLLVKNEKGYENLMKIVSVASI-EGFYYKPR 121

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHR 190
            I   +L+E  +EG+I L+    G + +A    +   A +    ++  F D  Y+ LQ H 
Sbjct: 122  IDREYLKE-HSEGIIALSACLGGEVQKAILNGNIDKAREAATFYRDTFKDGFYLELQNHG 180

Query: 191  GYDRYRESQV-VQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV- 248
              ++ + ++V +QLA    +PLVATN+  ++++ED +AHD+LM +     V   +R R  
Sbjct: 181  IEEQKKVNEVNIQLAKELNIPLVATNDVHYINQEDSKAHDILMCIQTGKTVDDPNRRRYP 240

Query: 249  TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEE 308
            +   YLK+  EM  +F  +PEALENT++IA  C+F  + H   LP+F   E      E  
Sbjct: 241  SDQFYLKSPEEMWDMFDYIPEALENTLKIAEECNFDYEFHVSKLPKFPLPEGV----EPF 296

Query: 309  NELRNKAVAGLEVRLAQGAI-------------AKGYHAQDYR---QRLDFELNVIARMK 352
              LR     GL  RL +                  G + +  +   +RL++EL VI +M 
Sbjct: 297  EYLRKTCFDGLIDRLEELKPLKEKGIYDIDKVYEIGENNEKVKEDIERLEYELGVIKQMG 356

Query: 353  FSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDR 412
            +  YFLIV DFI++A  N IP GPGRGS AG++ AY L IT IDP+++SLLFERFLNP+R
Sbjct: 357  YVDYFLIVWDFIKYANDNGIPTGPGRGSAAGALVAYTLGITKIDPMKYSLLFERFLNPER 416

Query: 413  MSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQV 472
            +SMPD D DFC + R  VI YV  KYGH+ V+QIITFG++ A+A +RDVGRA+   Y++V
Sbjct: 417  VSMPDIDSDFCYEGRQRVIDYVVEKYGHDNVSQIITFGTMAARACIRDVGRAMNYTYAEV 476

Query: 473  DRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGI 532
            DR+ K IP      +  +A+  +   +     +  V  L+++S++LEGL RH+STHAAG+
Sbjct: 477  DRIAKQIPTVLGVTID-KALDLNPELKTIYDTEERVKELIDVSRRLEGLPRHSSTHAAGV 535

Query: 533  VIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-Q 591
            VI  +PL + VP+ ++   +  VTQF+M  +E+ GL+K DFLGL+TLT+++ ++D +   
Sbjct: 536  VIASQPLVEYVPLQKN--DESIVTQFDMTTLEELGLLKMDFLGLRTLTVMRDAVDMIKYN 593

Query: 592  RGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYR 651
            RGV +DL  + FDD E Y ++    T+G+FQLES+GM   ++ ++PDC+EDIIA +SLYR
Sbjct: 594  RGVDIDLDNLDFDDKEVYKMIGEGNTVGVFQLESAGMTSFMKELKPDCLEDIIAGISLYR 653

Query: 652  PGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEAD 711
            PGP+  I  Y + K   + +  I P ++ +L  T GV++YQEQVM+I + L+GYS+  +D
Sbjct: 654  PGPMAEIPRYISGKRDPKSVEYIVPELENILNVTYGVMVYQEQVMEIVRKLAGYSMGRSD 713

Query: 712  VLRRAMGKKIKEEMDKQKERFIS------------GASKNGISKTIAVNIFELLAKFADY 759
            ++RRAM KK  + M+++++ FI             G  +NGIS   A  IF+ +  FA Y
Sbjct: 714  LVRRAMSKKKHKVMEEERKNFIYGIEDENGNIEVPGCLRNGISAEAANKIFDSMMDFASY 773

Query: 760  GFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPP 819
             FNKSHAAAYAVI +QTA++  +YPVEFLAA +   M N +K+ ++ + A +  IQ++PP
Sbjct: 774  AFNKSHAAAYAVIGFQTAYLMRYYPVEFLAAMLNSVMGNSDKVSEYIRSAEKLGIQVLPP 833

Query: 820  SVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLN 878
             +N     F V  + I + + AIK VG     +I ++      F SL DFC+++D   +N
Sbjct: 834  DINESYTKFTVKGDTIRFGMGAIKNVGVNVVENIAKSRDEKGRFTSLMDFCNKIDLSIVN 893

Query: 879  RRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAH--EKGTFSD 936
            +R +ESL+ AG  D     R QLL   + I        K   +   ++F    E+   + 
Sbjct: 894  KRSVESLIKAGTFDSLKVYRSQLLSVFEKIMDGVYSQRKKNIDGQMSLFGALQEESESNL 953

Query: 937  KITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVA-------- 988
            +I        N       E+ + G Y SGHPLD Y+  L++      E+ +         
Sbjct: 954  EIRYPNIKEFNKKYMLAMEKEMTGLYMSGHPLDDYEKPLKEQTSITIEKIIEAQKNLNEQ 1013

Query: 989  -------------TIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
                            G  + +  ++ +  +K TR  + + +    +     E   FP
Sbjct: 1014 KNVELEDLVLDSSLTDGTRVIIGGILTNVSRKVTRNNTLMAFAKVEDLTGYLECVIFP 1071


>gi|312897946|ref|ZP_07757359.1| DNA polymerase III, alpha subunit [Megasphaera micronuciformis F0359]
 gi|310620980|gb|EFQ04527.1| DNA polymerase III, alpha subunit [Megasphaera micronuciformis F0359]
          Length = 1158

 Score =  800 bits (2066), Expect = 0.0,   Method: Composition-based stats.
 Identities = 378/1033 (36%), Positives = 572/1033 (55%), Gaps = 29/1033 (2%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL  H+ YSL +G   +  ++ +      PA+A+TD  N++  +   + A   GI+PI
Sbjct: 4    FVHLHNHTQYSLFDGLTRIPEMVKRAKDLGMPAVAVTDHGNMYGLIHLYKAAKKEGIKPI 63

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQG-KQSV 129
            +GC++ +      +  ++ +     +  ++LL     GYQ L+++VS+ ++  +      
Sbjct: 64   LGCEIYMTRGSRFEQKSKER-----LCHLILLAKDFHGYQNLVKIVSKAFVDGENSYHRP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R     L++   EGLI L+    G + +     +   A + L  F  LFG D  Y+ +Q 
Sbjct: 119  RADFDLLEQYH-EGLIALSACIEGQVQQDILNGNEMQARQTLERFISLFGKDDFYLEIQN 177

Query: 189  HR-GYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H    +R         A  + L LVATN+  +L ++D  A +V + ++  + +   +  R
Sbjct: 178  HGLAEEREVRRVFKDWAEEYGLKLVATNDFHYLDKDDAPAQEVKLCISTGSTLDDPNHFR 237

Query: 248  VTPDHYLKN-RSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
             + + +    R EM  +F DLPEAL+ T+EIA +C+  +      LP+F   + +     
Sbjct: 238  FSNNEFYMKSREEMEKLFPDLPEALDTTLEIADKCNVEISFDERHLPQFPVPDGE----T 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
            +E+ LR                         R+RLD+EL VI  M F  YFLIV D++++
Sbjct: 294  DESYLRKLCEE-------ALPTRYSVITDAVRERLDYELGVINAMGFPSYFLIVWDYVKY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+ + IPVGPGRGS AGSV AY L IT +DPL++ LLFERFLNP+R++MPD D+DFC + 
Sbjct: 347  ARDHKIPVGPGRGSAAGSVVAYLLGITGLDPLKYDLLFERFLNPERITMPDIDMDFCYEN 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R  +I YV  KYG + VAQIITFG+L A+A LRDVGR L MP S+V+R+ K +PN+    
Sbjct: 407  RSRIIDYVTRKYGKDHVAQIITFGTLAARAVLRDVGRVLDMPLSEVNRIMKTVPNELGIT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +    +     FR+       V RL++  ++LEGL RH+STHAAG+VI   P+   VPM 
Sbjct: 467  LDKA-LQTSKEFRKDYETKAEVRRLVDFGKRLEGLVRHSSTHAAGVVISAAPVDDYVPMQ 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKV-DLSLIPFDD 605
               +     TQ++   +E+ GL+K DFLGL+TLT++  ++  + +      D+  I  DD
Sbjct: 526  Y-SKEGYLTTQYDKDLVEELGLLKMDFLGLRTLTVIGDAVAMINRNYGIDLDIDKISLDD 584

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNN 663
              T  LLT   T G+FQ+ES G+   ++ + P   E +I LV+LYRPGP+ + +   +  
Sbjct: 585  EATCRLLTEGDTAGVFQMESQGITNLVKELAPKHFEHMIPLVALYRPGPLGSGMVEDFIK 644

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
              +G++K+  +HPL++P+LK+T GVI+YQEQVMQIA  + G+SL EAD+LRRAMGKK + 
Sbjct: 645  GSHGEKKVTYLHPLLEPILKDTYGVILYQEQVMQIASAMGGFSLGEADLLRRAMGKKKEG 704

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             +  Q+  F+ G  KN I   IA  +F+L+  FA YGFNKSH+AAYA +++QTA++K HY
Sbjct: 705  VLKAQRAHFLEGTRKNHIDDDIANKVFDLMVYFAGYGFNKSHSAAYAYVAWQTAYLKAHY 764

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
              EF+AA+MT  + +V KI  +  + ++ ++ ++ P VN     F V    I + LA IK
Sbjct: 765  CAEFMAATMTSMISDVAKISYYAAECKRHHVPVLSPDVNESESVFSVQGGNIRFGLAGIK 824

Query: 844  GVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG    R I+EA   D PF S EDFCSRVDS+ +NRR LESL+  GA+D FG  R QL+
Sbjct: 825  SVGENAIRTILEARKKDGPFTSFEDFCSRVDSRIVNRRGLESLIQCGAMDSFGKKRSQLM 884

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFY 962
              LD          K+  +    +F       S  +          S+R   E+   GFY
Sbjct: 885  AVLDQAMSMGALRRKDNESGQMGLFDDVVSDVSTDLVYPDMEEYPLSMRLAMEKEYDGFY 944

Query: 963  FSGHPLDVYKPILRKMG--IKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTF 1020
            FSGHPLD Y  ++ K+      Y+E      G  I +  ++ + ++  T++   +  +T 
Sbjct: 945  FSGHPLDAYTEVMNKLTPLAVLYDEEARGYDGKMITVGGLITAVRRVTTKRNDAMAIITV 1004

Query: 1021 SEPAKEYEANFFP 1033
             +         FP
Sbjct: 1005 EDFTHTVTVVVFP 1017


>gi|258627365|ref|ZP_05722149.1| DNA polymerase III subunit alpha [Vibrio mimicus VM603]
 gi|258580403|gb|EEW05368.1| DNA polymerase III subunit alpha [Vibrio mimicus VM603]
          Length = 1159

 Score =  800 bits (2066), Expect = 0.0,   Method: Composition-based stats.
 Identities = 430/1048 (41%), Positives = 621/1048 (59%), Gaps = 38/1048 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P F+HL+VHS +S+++G   +  ++ K+AA   PA+A+TD  NL   ++F   A  
Sbjct: 1    MSD-PKFIHLRVHSDFSMVDGLSKVPPLVKKVAAMGMPAMALTDFTNLCGLVKFYSTAHN 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GI+PIIG    +          Q +     +  + +L     GY+ L  L+S+ YL   
Sbjct: 60   CGIKPIIGADFTL----------QSEEFGDELTKLTVLAKNNVGYKNLTLLISKAYLRGH 109

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
             +    I  +WL E   EGLI+L+GG SG I RA    + Q  EK L  ++  F D  Y+
Sbjct: 110  VQHQPVIDKAWLME-HAEGLIVLSGGKSGEIGRALLKGNQQQVEKCLEFYQTHFADHFYL 168

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             L R    D        ++LA  +ELP+VATN  +F++EE +EAH++ +A+     +   
Sbjct: 169  ELVRTGRADEESYLHFALELAEQYELPVVATNEVVFITEESFEAHEIRVAIHDGYTLEDP 228

Query: 244  DRPR-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             RP+  +P  YL++ +EM  +F+D+PEALEN+VEIA+RC+  +++       +       
Sbjct: 229  RRPKNYSPKQYLRSEAEMCELFADIPEALENSVEIAKRCNVTVRLGE-----YFLPNFPT 283

Query: 303  IQKEEENELRNKAVAGLEVRLA---QGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
                 E+ L  K+  GLE RL         +     +Y +RL  EL+VI +M F GYFLI
Sbjct: 284  EGMAIEDFLVMKSREGLEERLEFLFPNPEVRAQRRPEYDERLQIELDVINQMGFPGYFLI 343

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V +FIQW+K N+IPVGPGRGSGAGS+ AYAL ITD+DPL + LLFERFLNP+R+SMPDFD
Sbjct: 344  VMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLNPERVSMPDFD 403

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            +DFC D+RD+VI +V   YG + V+QIITFG++ AKA +RDVGR L  P+  VDR+ KL+
Sbjct: 404  VDFCMDKRDQVIDHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPFGFVDRISKLV 463

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P DP   +    IA +   +E   AD  V  L++  + LEG  R+A  HA G+VI    +
Sbjct: 464  PPDPGMTLEKAFIA-EPALQELYDADEEVKELIDKCRILEGCTRNAGKHAGGVVISPTAI 522

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKV--- 596
            +   P+Y D   + PVTQF+   +E AGL+KFDFLGL+TLT++  +L  +  R  K+   
Sbjct: 523  TDFAPIYCDAEGNFPVTQFDKNDVETAGLVKFDFLGLRTLTIIDWALGLVNPRLKKMGQP 582

Query: 597  --DLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
               +  IP DD  ++  L    T  +FQLES GM++ ++ +QPDC EDIIALV+L+RPGP
Sbjct: 583  PVRIEAIPLDDARSFRNLQDAKTTAVFQLESRGMKELIKRLQPDCFEDIIALVALFRPGP 642

Query: 655  IDNIVV--YNNRKNGKEKIVS-----IHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSL 707
            + + +V  + +RK+G+E I        H  +  +L+ T G+I+YQEQVMQIAQ+LSGY+L
Sbjct: 643  LQSGMVDNFIDRKHGREAISYPDEKWQHESLKEILEPTYGIILYQEQVMQIAQVLSGYTL 702

Query: 708  SEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
              AD+LRRAMGKK  EEM KQ+  F  GA KNG+   +A+ IF+L+ KFA YGFNKSH+A
Sbjct: 703  GGADMLRRAMGKKKPEEMAKQRAVFQEGAEKNGVDGELAMKIFDLVEKFAGYGFNKSHSA 762

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
            AYA++SYQT W+KTHYP EF+AA MT +MDN EK+     + +   + ++PP +N+    
Sbjct: 763  AYALVSYQTLWLKTHYPAEFMAAVMTADMDNTEKVVGLVDECKNMGLTVLPPDINSGLYR 822

Query: 828  FKVGDN-RIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESL 885
            F V DN  I Y + AIKGVG      I+EA   D  F  L DFC+R+D KK+N+RV+E L
Sbjct: 823  FNVDDNGAIVYGIGAIKGVGEGPIEAILEARNKDGYFKDLFDFCARIDLKKVNKRVIEKL 882

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFS 944
            + AGALD  G  R  ++ S+D+  + A    +       ++F        + +    +  
Sbjct: 883  ILAGALDRLGPHRAAMMASVDDAVRAASQHHQAEAFGQTDMFGVLTDAPEEVEQKYTQVP 942

Query: 945  VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSK 1004
                 VR E E+  LG Y +GHP+D Y   L K       E+  T R  ++ +A +V++ 
Sbjct: 943  EWPEKVRLEGERETLGLYLTGHPVDEYLKELVKYTSCRLNEAAPTRRDQSLTVAGLVIAA 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            +   T++G+RIG +T  + +   E   +
Sbjct: 1003 RVMTTKRGTRIGLMTLDDRSGRMEVMLY 1030


>gi|254693562|ref|ZP_05155390.1| DNA polymerase III subunit alpha [Brucella abortus bv. 3 str. Tulya]
 gi|261213827|ref|ZP_05928108.1| DNA polymerase III subunit alpha [Brucella abortus bv. 3 str. Tulya]
 gi|260915434|gb|EEX82295.1| DNA polymerase III subunit alpha [Brucella abortus bv. 3 str. Tulya]
          Length = 1163

 Score =  800 bits (2066), Expect = 0.0,   Method: Composition-based stats.
 Identities = 588/1033 (56%), Positives = 760/1033 (73%), Gaps = 8/1033 (0%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              +P FVHL+VHS+YSLLEGAL L  I+ +  AD+ PAIA+TDTNNLF ALEF+QKA   
Sbjct: 14   SATPGFVHLRVHSAYSLLEGALPLGKIIKQALADEAPAIAVTDTNNLFGALEFAQKASKD 73

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQ-GKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            G+QPIIGCQLD+   D+   +    +     +  +VL+ +T  GY  ++ LVSR +L   
Sbjct: 74   GVQPIIGCQLDVAFGDHNDNSRSVNRKLALDLAPLVLIAATEAGYANIVRLVSRAFLDTP 133

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
                + I   WL  + +E +I LTGG  GPI R+F  + +  A  RL   K+ FG+RLYV
Sbjct: 134  AGDPIHIEAGWLPAL-SEDVIALTGGPLGPIGRSFTADRADRARARLAFLKETFGNRLYV 192

Query: 185  NLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
             LQR  GYDR  E+  V+LAY  +LPLVATN + FL  ED+EAHD L+A+A   ++S  D
Sbjct: 193  ELQRQAGYDRTVEASTVELAYEMDLPLVATNEAFFLKAEDFEAHDALLAIAEGQILSNDD 252

Query: 245  RPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD-- 302
            R R+TPDH LK+R+EM  +F+DLPE+LENTVEIA RCS+  Q   PILPRF  +  D   
Sbjct: 253  RRRLTPDHCLKSRAEMAELFADLPESLENTVEIAGRCSWYTQTRKPILPRFTGESDDPEA 312

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVAD 362
              + E +EL  +A  GL+ RL    +A+GY  + Y +RL++E+ +I RMKF GYFLIVAD
Sbjct: 313  AVQAEADELARQAREGLKKRLETAGLAEGYTPEQYAERLEYEIGIITRMKFPGYFLIVAD 372

Query: 363  FIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDF 422
            FI+WAK + IPVGPGRGSGAGS+ AYALTITD+DPLRFSLLFERFLNPDR+SMPDFDIDF
Sbjct: 373  FIKWAKAHGIPVGPGRGSGAGSLVAYALTITDVDPLRFSLLFERFLNPDRVSMPDFDIDF 432

Query: 423  CQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            CQDRR+EVIRYVQ KYG ++VAQIITFG+LQA+A LRDVGR L+MPY QVDRLCKL+P +
Sbjct: 433  CQDRREEVIRYVQEKYGRDQVAQIITFGTLQARAVLRDVGRVLEMPYGQVDRLCKLVPQN 492

Query: 483  PAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            PA+PVS  QAI  + +  E R  +  V RLL+++ KLEGLYRHASTHAAGIVIGDRPLS+
Sbjct: 493  PANPVSLAQAIESEPKINEEREKESVVGRLLDMALKLEGLYRHASTHAAGIVIGDRPLSE 552

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI 601
            LVPMYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+LQ ++  +A++G+ +DLS +
Sbjct: 553  LVPMYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLQTAVKLVARKGIDIDLSHL 612

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVY 661
            P DD  TY +L+   T+G+FQ+ES+GMR+AL GM+PD +EDIIALV+LYRPGP++NI  Y
Sbjct: 613  PLDDALTYEMLSRGETVGVFQVESAGMRKALLGMKPDRVEDIIALVALYRPGPMENIPTY 672

Query: 662  NNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKI 721
            N RKNG+E+I SIHP ID ++KETQGVI+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI
Sbjct: 673  NARKNGEEEIASIHPKIDHLIKETQGVIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKI 732

Query: 722  KEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKT 781
            +EEMDKQ+ RF+ GA + G+ K  A  IF+LLAKFADYGFNKSHAAAYA++SYQTA+MK 
Sbjct: 733  REEMDKQRVRFVDGAVERGVDKAQANMIFDLLAKFADYGFNKSHAAAYAIVSYQTAYMKA 792

Query: 782  HYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAA 841
            HYPVEFLAASMT +M N +K+  F ++A +  I+++PPSV T    F+VG+ +I+YSLAA
Sbjct: 793  HYPVEFLAASMTYDMSNTDKLNDFRREANRLGIEVVPPSVKTSFRPFEVGEKKIFYSLAA 852

Query: 842  IKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQL 901
            IKGVG     HI++  A+K F+SLEDFC R+D K +NRRVLESL+ AGA+DCFG  R  +
Sbjct: 853  IKGVGEAAVDHIVDVRAEKQFESLEDFCERIDPKIINRRVLESLINAGAMDCFGRDRAAM 912

Query: 902  LQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGF 961
               +D I  +AQ  ++N  +   +IF    G   + + L   +    S     E + +GF
Sbjct: 913  CAGMDRILGFAQRTQENAVSGQSDIFG-LSGAPRETLILPPTAPWLPSEMLHREFQAVGF 971

Query: 962  YFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGWVT 1019
            Y S HPLD Y+ +L +M ++ + +   A  RG +  RLA  V ++Q++KTR G+++G V 
Sbjct: 972  YLSAHPLDEYRDVLNRMRVQSWADFSAAVKRGASAGRLAGTVTARQERKTRTGNKMGIVQ 1031

Query: 1020 FSEPAKEYEANFF 1032
             S+ + ++EA  F
Sbjct: 1032 LSDASGQFEAVLF 1044


>gi|254520595|ref|ZP_05132651.1| DNA polymerase III DnaE [Clostridium sp. 7_2_43FAA]
 gi|226914344|gb|EEH99545.1| DNA polymerase III DnaE [Clostridium sp. 7_2_43FAA]
          Length = 1187

 Score =  800 bits (2066), Expect = 0.0,   Method: Composition-based stats.
 Identities = 376/1075 (34%), Positives = 589/1075 (54%), Gaps = 61/1075 (5%)

Query: 8    SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGI 67
            S  F HL +H+ YSLL+G+  +  I+ +       +IAITD   ++  + F ++A   GI
Sbjct: 5    SKKFTHLHLHTEYSLLDGSGKIKKIISRAKELGMDSIAITDHGVMYGCVSFYKEAIEQGI 64

Query: 68   QPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQ 127
            +PI+GC++ +  +      N  +    +   +VLLV   EGY+ L+E+VS+  +      
Sbjct: 65   KPILGCEIYVAAKSMDIKINDKEN---STHHLVLLVKNEEGYKNLMEIVSQASIRG-FYY 120

Query: 128  SVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQ 187
              R+   +L+   ++GLI L+    G +      ++ + A++  L +K +F D  Y+ +Q
Sbjct: 121  KPRVDHDFLRS-HSDGLIALSACLGGEVQSWHLKDNYEKAKEVALLYKDIFKDGFYLEIQ 179

Query: 188  RHRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRP 246
             H   ++       ++L+    +PL+ATN+  ++++ D E+HDVLM +     +   +R 
Sbjct: 180  NHGMDEQRKVIEGNIKLSKETGIPLIATNDVHYINQRDSESHDVLMCIQTGKTIDDPNRR 239

Query: 247  RV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQK 305
            R  +   YLK+  +M  +FS +PEALENT++IA  C+F  + H   LP+F   E      
Sbjct: 240  RYPSDQFYLKSPEQMWDMFSHIPEALENTIKIAEECNFDYEFHVSKLPKFPVPEG----I 295

Query: 306  EEENELRNKAVAGLEVRLA------------QGAIAKGYHAQD---YRQRLDFELNVIAR 350
            E    L+N   +GL  R              +  +      ++   Y +RL++EL+VI +
Sbjct: 296  EPYEYLKNVCYSGLIERYEVFKEFLNRPLNVEELVDYYKTNEEACGYIERLEYELSVIKQ 355

Query: 351  MKFSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNP 410
            M +  YFLI  DFI+++ +N IP GPGRGS AGS+ AY L IT IDP+++SLLFERFLNP
Sbjct: 356  MGYVDYFLITWDFIRFSNENGIPTGPGRGSAAGSIVAYTLGITKIDPIKYSLLFERFLNP 415

Query: 411  DRMSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYS 470
            +R+SMPD D DFC +RR EVI YV  KYG   V+QIITFG++  +A +RDVGRA+   Y+
Sbjct: 416  ERVSMPDIDSDFCYERRQEVIDYVVEKYGINNVSQIITFGTMAPRACIRDVGRAMNYSYA 475

Query: 471  QVDRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAA 530
            +VDR+ K+IP      +    +  +   + A   +  V  L+++S+ LEGL RH+STHAA
Sbjct: 476  EVDRIAKMIPTMLGITIDKA-LEINPELKAAYNNEERVKALIDVSKDLEGLPRHSSTHAA 534

Query: 531  GIVIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA 590
            G+VI  +PL + VP+ R+   D  V QF+M  +E+ GL+K DFLGL+TLT++  ++  + 
Sbjct: 535  GVVIASKPLVEYVPLQRN--EDSIVAQFDMTTLEELGLLKMDFLGLRTLTVMNDAVKMIK 592

Query: 591  QRG-VKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSL 649
            +   + ++L  I F+D + Y+++    T G+FQLES GM   ++ ++PDC+EDIIA +SL
Sbjct: 593  ENQGIDINLDKINFEDKDVYNMIGEGKTAGVFQLESPGMTSFMKELKPDCLEDIIAGISL 652

Query: 650  YRPGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSE 709
            YRPGP+  I  Y   K   +K+    P ++ +L  T GV++YQEQVM+I + L+GYS+  
Sbjct: 653  YRPGPMGEIPRYVECKQNPDKVEYEVPELEDILNVTYGVMVYQEQVMEIVRKLAGYSMGR 712

Query: 710  ADVLRRAMGKKIKEEMDKQKERFISG------------ASKNGISKTIAVNIFELLAKFA 757
            +D++RRAM KK  + M+++++ FI G              +NGIS+  A  IF+ +  FA
Sbjct: 713  SDLVRRAMSKKKHKVMEEERKNFIYGVVDDNGNIEVPGCKRNGISEEAANKIFDQMMDFA 772

Query: 758  DYGFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIM 817
             Y FNKSHAAAYAVI YQTA++  +YPVE +AA +   M   EK+  +   A    IQ++
Sbjct: 773  SYAFNKSHAAAYAVIGYQTAYLMKYYPVETIAAMLNSVMGTSEKVAHYINFAESLGIQVL 832

Query: 818  PPSVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKK 876
            PP +N     F V  ++I + LAAIK VG      I+E+  +   F+SL DF +++D   
Sbjct: 833  PPDINESYSKFTVKGDKIIFGLAAIKNVGYNVVETIVESRNNKGEFESLMDFINKIDLSS 892

Query: 877  LNRRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD 936
            +N+R +ESL+ AGALDCF   R +LL   + +        K   +   ++F  E+     
Sbjct: 893  VNKRAIESLIKAGALDCFDVFRSKLLAVYEKLMDSVSSERKRNIDGQISLFGMEEEIELP 952

Query: 937  KITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYE------------ 984
            +I                E+ + G Y SGHPLD Y   L+       +            
Sbjct: 953  EINYPNIKEFAKKNILAMEKEMTGLYLSGHPLDEYADSLKVQTTTNIDKVYKSYEIISDT 1012

Query: 985  ----ESVA--TIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
                +           + L  ++    QK TR  + + ++   +     E   FP
Sbjct: 1013 FNQTDLPEDIIHDEERVILGGIIAESNQKITRSNTMMAFLKLEDLTGIIEVIVFP 1067


>gi|262170786|ref|ZP_06038464.1| DNA polymerase III alpha subunit [Vibrio mimicus MB-451]
 gi|261891862|gb|EEY37848.1| DNA polymerase III alpha subunit [Vibrio mimicus MB-451]
          Length = 1159

 Score =  800 bits (2065), Expect = 0.0,   Method: Composition-based stats.
 Identities = 430/1048 (41%), Positives = 621/1048 (59%), Gaps = 38/1048 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P F+HL+VHS +S+++G   +  ++ K+AA   PA+A+TD  NL   ++F   A  
Sbjct: 1    MSD-PKFIHLRVHSDFSMVDGLSKVPPLVKKVAAMGMPAMALTDFTNLCGLVKFYSTAHN 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GI+PIIG    +          Q +     +  + +L     GY+ L  L+S+ YL   
Sbjct: 60   CGIKPIIGADFTL----------QSEEFGDELTKLTVLAKNNVGYKNLTLLISKAYLRGH 109

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
             +    I  +WL E   EGLI+L+GG SG I RA    + Q  EK L  ++  F D  Y+
Sbjct: 110  VQHQPVIDKAWLME-HAEGLIVLSGGKSGEIGRALLKGNQQQVEKCLEFYQTHFADHFYL 168

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             L R    D        ++LA  +ELP+VATN  +F++EE +EAH++ +A+     +   
Sbjct: 169  ELVRTGRADEESYLHFALELAEQYELPVVATNEVVFITEESFEAHEIRVAIHDGYTLEDP 228

Query: 244  DRPR-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             RP+  +P  YL++ +EM  +F+D+PEALEN+VEIA+RC+  +++       +       
Sbjct: 229  RRPKNYSPKQYLRSEAEMCELFADIPEALENSVEIAKRCNVTVRLGE-----YFLPNFPT 283

Query: 303  IQKEEENELRNKAVAGLEVRLA---QGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
                 E+ L  K+  GLE RL         +     +Y +RL  EL+VI +M F GYFLI
Sbjct: 284  EGMAIEDFLVMKSREGLEERLEFLFPDLEVRAQRRPEYDERLQIELDVINQMGFPGYFLI 343

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V +FIQW+K N+IPVGPGRGSGAGS+ AYAL ITD+DPL + LLFERFLNP+R+SMPDFD
Sbjct: 344  VMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLNPERVSMPDFD 403

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            +DFC D+RD+VI +V   YG + V+QIITFG++ AKA +RDVGR L  P+  VDR+ KL+
Sbjct: 404  VDFCMDKRDQVIDHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPFGFVDRISKLV 463

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P DP   +    IA +   +E   AD  V  L++  + LEG  R+A  HA G+VI    +
Sbjct: 464  PPDPGMTLEKAFIA-EPALQELYDADEEVKELIDKCRILEGCTRNAGKHAGGVVISPTAI 522

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKV--- 596
            +   P+Y D   + PVTQF+   +E AGL+KFDFLGL+TLT++  +L  +  R  K+   
Sbjct: 523  TDFAPIYCDAEGNFPVTQFDKNDVETAGLVKFDFLGLRTLTIIDWALGLVNPRLKKMGQP 582

Query: 597  --DLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
               +  IP DD  ++  L    T  +FQLES GM++ ++ +QPDC EDIIALV+L+RPGP
Sbjct: 583  PVRIEAIPLDDARSFRNLQDAKTTAVFQLESRGMKELIKRLQPDCFEDIIALVALFRPGP 642

Query: 655  IDNIVV--YNNRKNGKEKIVS-----IHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSL 707
            + + +V  + +RK+G+E I        H  +  +L+ T G+I+YQEQVMQIAQ+LSGY+L
Sbjct: 643  LQSGMVDNFIDRKHGREAISYPDEKWQHESLKEILEPTYGIILYQEQVMQIAQVLSGYTL 702

Query: 708  SEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
              AD+LRRAMGKK  EEM KQ+  F  GA KNG+   +A+ IF+L+ KFA YGFNKSH+A
Sbjct: 703  GGADMLRRAMGKKKPEEMAKQRAVFQEGAEKNGVDGELAMKIFDLVEKFAGYGFNKSHSA 762

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
            AYA++SYQT W+KTHYP EF+AA MT +MDN EK+     + +   + ++PP +N+    
Sbjct: 763  AYALVSYQTLWLKTHYPAEFMAAVMTADMDNTEKVVGLVDECKNMGLTVLPPDINSGLYR 822

Query: 828  FKVGDN-RIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESL 885
            F V DN  I Y + AIKGVG      I+EA   D  F  L DFC+R+D KK+N+RV+E L
Sbjct: 823  FNVDDNGAIVYGIGAIKGVGEGPIEAILEARNKDGYFKDLFDFCARIDLKKVNKRVIEKL 882

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFS 944
            + AGALD  G  R  ++ S+D+  + A    +       ++F        + +    +  
Sbjct: 883  ILAGALDRLGPHRAAMMASVDDAVRAASQHHQAEAFGQTDMFGVLTDAPEEVEQKYTQVP 942

Query: 945  VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSK 1004
                 VR E E+  LG Y +GHP+D Y   L K       E+  T R  ++ +A +V++ 
Sbjct: 943  EWPEKVRLEGERETLGLYLTGHPVDEYLKELVKYTSCRLNEAAPTRRDQSLTVAGLVIAA 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            +   T++G+RIG +T  + +   E   +
Sbjct: 1003 RVMTTKRGTRIGLMTLDDRSGRMEVMLY 1030


>gi|220904502|ref|YP_002479814.1| DNA polymerase III, alpha subunit [Desulfovibrio desulfuricans subsp.
            desulfuricans str. ATCC 27774]
 gi|219868801|gb|ACL49136.1| DNA polymerase III, alpha subunit [Desulfovibrio desulfuricans subsp.
            desulfuricans str. ATCC 27774]
          Length = 1160

 Score =  800 bits (2065), Expect = 0.0,   Method: Composition-based stats.
 Identities = 418/1039 (40%), Positives = 610/1039 (58%), Gaps = 24/1039 (2%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL  H+ YSLL+GA+ + ++  +      PA AITD  NLF A  F Q     GI 
Sbjct: 2    SDFVHLHCHTEYSLLDGAIRIKDLCARAKDFGMPACAITDHGNLFGAAYFYQGCKDFGIN 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PI GC++ +      K T+           ++LL     GY  L++LVS  +L D     
Sbjct: 62   PIFGCEVYVCHDHTDKKTDSPLAR--RRHHLILLAQNKTGYHNLVKLVSHGFL-DGFYYK 118

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             R+    L++  +EGLI L+   +G I RA   +   +A K    +  ++ +R Y+ LQ 
Sbjct: 119  PRVDKGLLRKY-SEGLICLSACIAGEIPRAILADDMDLARKLTHEYADIYPNRFYLELQS 177

Query: 189  HRGYDRYR-ESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            +   ++ +  + ++ LA T  LPLVATN+  +L+ +D EAH+VL+ +   T +    R +
Sbjct: 178  NGLKEQEKANAGLIDLAETCNLPLVATNDCHYLNADDAEAHEVLLCIQTQTTMDDPKRMQ 237

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T + Y K+  EM   F  +PEAL NT  IA  C+  L       P +   E   +   
Sbjct: 238  FGTHELYYKSIEEMEKSFGHVPEALANTARIAEACNVELDFGNHYFPVYQLPEGASM--- 294

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
             E+E R  A  GLE RL         + Q YR RL +EL VI  M F  YFLIV +FI W
Sbjct: 295  -ESEFRRLAEEGLEKRLVNHPDRDQLNPQTYRDRLQYELRVILEMGFPSYFLIVQEFINW 353

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK N+IPVGPGRGS AGS+ A+AL IT++DP+ ++LLFERFLN +R+S+PD D+DFC+ R
Sbjct: 354  AKNNDIPVGPGRGSAAGSLVAWALRITNLDPIPYNLLFERFLNSERVSLPDIDVDFCERR 413

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R +VI+++   YG   VAQI TFG+++AK  +RDVGRAL M +++ DR+ KL+P D    
Sbjct: 414  RGDVIKHMVETYGEGSVAQITTFGTMKAKGVVRDVGRALGMSFAETDRIAKLVPADLKMT 473

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +    +  L D  V  LL+ +++LEGL RHASTHAAG+V+ D+P+ + +P+Y
Sbjct: 474  IK-KALESEPELEKLYLEDQQVKHLLDTARRLEGLARHASTHAAGLVVSDKPMKEYLPLY 532

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFL-AQRGVKVDLSLIPFDD 605
               R +  VTQF+    EKAGL+KFDFLGLKT+TL+Q +LD +  Q     +L  +P  D
Sbjct: 533  LGKRGE-LVTQFDGPMTEKAGLVKFDFLGLKTMTLIQDTLDNISLQGQAPPNLDNLPLTD 591

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVV--YNN 663
             ETY L     T G+FQ+ESSGMRQ L  ++P C ED+IA+++LYRPGP+ + +V  +  
Sbjct: 592  AETYELYARGETDGVFQVESSGMRQYLRMLRPTCFEDVIAMLALYRPGPLGSGMVDEFIK 651

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G+  ++  H  +   L++T GVI+YQEQVMQIAQ+++ Y+L  AD+LRRAMGKK  E
Sbjct: 652  RKHGQVPVIYPHESLTDCLRDTYGVIVYQEQVMQIAQIIASYTLGGADLLRRAMGKKKAE 711

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             M K++  F++GA KN IS+  A  IF+L+ KFA+YGFNKSH+AAYA+ISY TA++K HY
Sbjct: 712  AMAKERVTFVAGAQKNNISEEKANEIFDLMEKFAEYGFNKSHSAAYALISYYTAYLKVHY 771

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
             VEF+AA +T EM N +K+ K+    +  +I ++ PSVN    +F   + ++ + L  IK
Sbjct: 772  KVEFMAALLTSEMGNQDKLLKYVSCCKDMDIDVVQPSVNRSQREFTAHEGKVVFGLGGIK 831

Query: 844  GVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG    R I+EA   ++ F SL D C RV+ +K+ +RVLESL+  GA DCFG +R  +L
Sbjct: 832  NVGDEAIREIVEARQQEEEFASLFDLCCRVNLRKVTKRVLESLIKGGACDCFGVARAAML 891

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKIT-------LEKFSVENSSVRFENE 955
             SLD +   AQ   K++++   ++ A      S                      +   E
Sbjct: 892  ASLDLVVARAQRKAKDKSSNQVSLLAMAPVAESAPQPGIGIDCAEAATPEMADEDKLRAE 951

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTR-KGSR 1014
            +  LGF+ + HPL  Y   +R++G+   E++     G  +R A +V S ++  T+ KG R
Sbjct: 952  KDALGFFLTSHPLQPYVREIRRLGLTTLEDARDMFPGAEVRCAVLVTSVREVITKSKGER 1011

Query: 1015 IGWVTFSEPAKEYEANFFP 1033
            + +    +     E  FFP
Sbjct: 1012 MAFAAVEDLTGHAEVTFFP 1030


>gi|262404579|ref|ZP_06081134.1| DNA polymerase III alpha subunit [Vibrio sp. RC586]
 gi|262349611|gb|EEY98749.1| DNA polymerase III alpha subunit [Vibrio sp. RC586]
          Length = 1159

 Score =  799 bits (2064), Expect = 0.0,   Method: Composition-based stats.
 Identities = 427/1048 (40%), Positives = 619/1048 (59%), Gaps = 38/1048 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P F+HL+VHS +S+++G   +  ++ K+AA   PA+A+TD  NL   ++F   A  
Sbjct: 1    MSD-PKFIHLRVHSDFSMVDGLSKVPPLVKKVAAMGMPAMALTDFTNLCGLVKFYSTAHN 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             G++PIIG    +          Q +     +  + +L     GY+ L  L+S+ YL   
Sbjct: 60   CGVKPIIGADFTL----------QSEEFGDELTKLTVLAKNNIGYKNLTLLISKAYLRGH 109

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
             +    +  +WL E   EGLI+L+GG SG I RA    + Q  EK L  ++  F D  Y+
Sbjct: 110  VQHQPVLDKAWLME-HAEGLIVLSGGKSGEIGRALLKGNQQQVEKCLEFYQTHFADHFYL 168

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             L R    D        ++LA  +ELP+VATN  +F++EE +EAH++ +A+     +   
Sbjct: 169  ELVRTGRADEESYLHFALELAEQYELPVVATNEVVFITEESFEAHEIRVAIHDGYTLEDP 228

Query: 244  DRPR-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             RP+  +P  YL++ +EM  +F+D+PEALEN+VEIA+RC+  +++       +       
Sbjct: 229  RRPKNYSPKQYLRSEAEMCELFADIPEALENSVEIAKRCNVTVRLGE-----YFLPNFPT 283

Query: 303  IQKEEENELRNKAVAGLEVRLA---QGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
                 E+ L  K+  GLE RL         +     +Y +RL  EL+VI +M F GYFLI
Sbjct: 284  EGMAIEDFLVMKSREGLEERLEFLFPNPEVRAQRRPEYDERLQIELDVINQMGFPGYFLI 343

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V +FIQW+K N+IPVGPGRGSGAGS+ AYAL ITD+DPL + LLFERFLNP+R+SMPDFD
Sbjct: 344  VMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLNPERVSMPDFD 403

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            +DFC D+RD+VI +V   YG + V+QIITFG++ AKA +RDVGR L  P+  VDR+ KL+
Sbjct: 404  VDFCMDKRDQVIDHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPFGFVDRISKLV 463

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P DP   +    IA +   +E   AD  V  L++  + LEG  R+A  HA G+VI    +
Sbjct: 464  PPDPGMTLEKAFIA-EPALQELYDADEEVKELIDKCRILEGCTRNAGKHAGGVVISPTAI 522

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-----GV 594
            +   P+Y D   + PVTQF+   +E AGL+KFDFLGL+TLT++  +L  +  R       
Sbjct: 523  TDFAPIYCDAEGNFPVTQFDKNDVETAGLVKFDFLGLRTLTIIDWALGLVNPRLKKAGKP 582

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
             V +  IP DD  ++  L    T  +FQLES GM++ ++ +QPDC EDIIALV+L+RPGP
Sbjct: 583  PVRIEAIPLDDARSFRNLQDAKTTAVFQLESRGMKELIKRLQPDCFEDIIALVALFRPGP 642

Query: 655  IDNIVV--YNNRKNGKEKIVS-----IHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSL 707
            + + +V  + +RK+G+E I        H  +  +L+ T G+I+YQEQVMQIAQ+LSGY+L
Sbjct: 643  LQSGMVDNFIDRKHGREAISYPDEKWQHESLKEILEPTYGIILYQEQVMQIAQVLSGYTL 702

Query: 708  SEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
              AD+LRRAMGKK  EEM KQ+  F  GA  NG+   +A+ IF+L+ KFA YGFNKSH+A
Sbjct: 703  GGADMLRRAMGKKKPEEMAKQRAVFQEGAENNGVDGELAMKIFDLVEKFAGYGFNKSHSA 762

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
            AYA++SYQT W+KTHYP EF+AA MT +MDN EK+     + +   + ++PP +N+    
Sbjct: 763  AYALVSYQTLWLKTHYPAEFMAAVMTADMDNTEKVVGLVDECKNMGLTVLPPDINSGLYR 822

Query: 828  FKVGDN-RIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESL 885
            F V DN  I Y + AIKGVG      I+EA   D  F  L DFC+R+D KK+N+RV+E L
Sbjct: 823  FNVDDNGAIVYGIGAIKGVGEGPIEAILEARNKDGYFKDLFDFCARIDLKKVNKRVIEKL 882

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFS 944
            + AGALD  G  R  ++ S+D+  + A    +       ++F        + +    +  
Sbjct: 883  ILAGALDRLGPHRAAMMASVDDAVRAASQHHQAEAFGQADMFGVLTDAPEEVEQKYTQVP 942

Query: 945  VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSK 1004
                 VR E E+  LG Y +GHP+D Y   L K       E+  T R  ++ +A +V++ 
Sbjct: 943  EWPEKVRLEGERETLGLYLTGHPVDEYLKELTKYTSCRLNEAAPTRRDQSLTVAGLVIAA 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            +   T++G+RIG +T  + +   E   +
Sbjct: 1003 RVMTTKRGTRIGLMTLDDRSGRMEVMLY 1030


>gi|51245515|ref|YP_065399.1| DNA polymerase III, alpha subunit [Desulfotalea psychrophila LSv54]
 gi|50876552|emb|CAG36392.1| related to DNA polymerase III, alpha subunit [Desulfotalea
            psychrophila LSv54]
          Length = 1199

 Score =  799 bits (2064), Expect = 0.0,   Method: Composition-based stats.
 Identities = 418/1041 (40%), Positives = 627/1041 (60%), Gaps = 20/1041 (1%)

Query: 6    EKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAA 65
              S  F HL VH+ YSLL+GA+ L +++DK       ++AITD   ++ ALEF  KA  A
Sbjct: 23   PMSAGFTHLHVHTQYSLLDGAIRLPDLIDKCKEFGMDSVAITDHGAMYGALEFYTKAKKA 82

Query: 66   GIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQG 125
            GI+PI+G +L I   D   M  Q K    T   IVLL     GYQ L+++ S     D  
Sbjct: 83   GIKPIVGSELYIAPGD---MREQKKINGQTAYHIVLLAMNKTGYQNLMKMASIA-QSDGF 138

Query: 126  KQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVN 185
                RI ++ LQE   EG+I LT    G +           A K+      +FGDRLY  
Sbjct: 139  YYKPRIDMAVLQEY-NEGIIALTACLHGQVPYLIMKGDMDGARKKAQELHDIFGDRLYFE 197

Query: 186  LQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKD 244
            LQ +   ++    + +  LA    + LVATN+  +L+ ++  AH+VL+ +     ++  +
Sbjct: 198  LQENSIAEQQPVNAGLKILAKEMGVKLVATNDCHYLNRQEAHAHEVLLCIQMGKTINDTN 257

Query: 245  RPRV-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDI 303
            R R  + + Y K+  EM   F   PEA+ +T EIA RC+  L       P F   E + +
Sbjct: 258  RFRFSSDEFYFKSPKEMERAFHHCPEAIASTQEIADRCNLELTFDDYYFPNFPVPEGESL 317

Query: 304  QKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADF 363
                            E   A G+       + Y+ RL+ E++VI  M F GYFLIVADF
Sbjct: 318  STMFTTACWEGLETRFEEMRALGSYKDN-TEKTYKARLEMEIDVINTMGFPGYFLIVADF 376

Query: 364  IQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFC 423
            I WAK  +IPVGPGRGSGAGS+ AYA+ IT+IDP+ + L+FERFLN +R SMPDFDIDFC
Sbjct: 377  INWAKSKDIPVGPGRGSGAGSIAAYAMKITNIDPMPYGLIFERFLNIERKSMPDFDIDFC 436

Query: 424  QDRRDEVIRYVQNKY-GHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPND 482
            QDRR EVI YV+ KY G E VAQIIT+GS++A+  +RDVGRAL +P+++VDR+ KL+P+ 
Sbjct: 437  QDRRGEVIDYVRRKYGGAEHVAQIITYGSMKARGVIRDVGRALDIPFTEVDRIAKLVPDQ 496

Query: 483  PAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQL 542
                +  +A+A++ + +EA   DP +  L+ +S+ LEGL RH S HAAG+VI   P++  
Sbjct: 497  LKMTLL-KALAEEPKLQEAADNDPQIQELISVSKTLEGLARHTSVHAAGVVISPEPMTHY 555

Query: 543  VPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-QRGVKVDLSLI 601
            +P  R   +D  VTQ++MK  E  GLIKFDFLGLKTLT++ K++  +   + + +++  I
Sbjct: 556  LPTCRGGEADERVTQYDMKHTEMTGLIKFDFLGLKTLTVIDKAVKHVHADKKIPLNIDAI 615

Query: 602  PFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV-- 659
            P DD +T+ LL     LG+FQLES GMR+ L  M P+   D+IALV+LYRPGP+D+ +  
Sbjct: 616  PMDDPKTFDLLCRGDALGVFQLESEGMRELLVKMAPEQFSDLIALVALYRPGPLDSGMVD 675

Query: 660  VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGK 719
             +   K+G+ +     P + P+L+ET GVI+YQEQVM+IA +L+ YSL +AD+LRRAMGK
Sbjct: 676  DFVETKHGRAEANYPLPQLKPVLEETYGVIVYQEQVMKIASILANYSLGDADILRRAMGK 735

Query: 720  KIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWM 779
            KI   MD++K +F+ GA KN +    A  +F+L+AKFA YGFNKSH+AAYA++SYQTA++
Sbjct: 736  KIAAVMDEEKVKFMEGAEKNEVPLDKAEYVFDLMAKFAGYGFNKSHSAAYALVSYQTAYL 795

Query: 780  KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSL 839
            K H+P +F+AA ++ +M+N +K+ ++  + ++ +I+++PP +N    DF V ++RI + +
Sbjct: 796  KAHHPAQFMAALLSCDMNNTDKVVRYINECKEQHIEVLPPDINESFKDFTVINDRIRFGM 855

Query: 840  AAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSR 898
            AA+K VG      I+E   AD P+ S+ DFC+RVDS+K+N RV+ESLV +G+ D  GY R
Sbjct: 856  AAVKNVGGAALDSIIEERQADGPYTSISDFCNRVDSRKVNSRVIESLVKSGSFDSLGYKR 915

Query: 899  MQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDK------ITLEKFSVENSSVRF 952
             Q ++ L+   + A+ V++++ +   ++FA  + +   K      + +      +   + 
Sbjct: 916  SQFIEVLEKAMEQAKAVQRDKQSGQISLFAVAQPSAGQKDQEVNSLHMPDMEEWSDKQKL 975

Query: 953  ENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKG 1012
              E+  +GFY +GHPLD   P L+ +      + V       +R+  +V + ++ +++KG
Sbjct: 976  LFEKETVGFYITGHPLDDVMPELKTIIDAQIHDLVDKDEDQAVRIGGLVRTYKKHRSQKG 1035

Query: 1013 SRIGWVTFSEPAKEYEANFFP 1033
              + ++T  +  +  E   FP
Sbjct: 1036 DAMAFITIEDIFEAVEVVVFP 1056


>gi|182624555|ref|ZP_02952338.1| DNA polymerase III, alpha subunit [Clostridium perfringens D str.
            JGS1721]
 gi|177910363|gb|EDT72744.1| DNA polymerase III, alpha subunit [Clostridium perfringens D str.
            JGS1721]
          Length = 1192

 Score =  799 bits (2064), Expect = 0.0,   Method: Composition-based stats.
 Identities = 384/1078 (35%), Positives = 599/1078 (55%), Gaps = 67/1078 (6%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL +HS YSLL+G+  +  ++ +       +IA+TD   ++  ++  ++A A GI+PI
Sbjct: 6    FCHLHLHSGYSLLDGSGKIKPLIKRAKELGMESIALTDHGVMYGCVDLYKEAKAEGIKPI 65

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +  +     +N           +VLLV   +GY+ L+++VS   + +      R
Sbjct: 66   LGCEVYVVPKSRKIKSNDEDN---KTYHLVLLVKNEKGYENLMKIVSVASI-EGFYYKPR 121

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHR 190
            I   +L+E  +EG+I L+    G + +A    +   A +    ++  F D  Y+ LQ H 
Sbjct: 122  IDREYLKE-HSEGIIALSACLGGEVQKAILNGNIDKAREAATFYRDTFKDGFYLELQNHG 180

Query: 191  GYDRYRESQV-VQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV- 248
              ++ + ++V +QLA    +PLVATN+  ++++ED +AHD+LM +     V   +R R  
Sbjct: 181  IEEQKKVNEVNIQLAKELNIPLVATNDVHYINQEDSKAHDILMCIQTGKTVDDPNRRRYP 240

Query: 249  TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEEE 308
            +   YLK+  EM  +F  +PEALENT++IA  C+F  + H   LP+F   E      E  
Sbjct: 241  SDQFYLKSPEEMWDMFDYVPEALENTLKIAEECNFDYEFHVSKLPKFPLPEGV----EPF 296

Query: 309  NELRNKAVAGLEVRLAQGAI-------------AKGYHAQDYR---QRLDFELNVIARMK 352
              LR     GL  RL +                  G +    +   +RL++EL VI +M 
Sbjct: 297  EYLRKTCFDGLIDRLEELRPLKEKGIYDIDKVYEIGENNDKVKEDIERLEYELGVIKQMG 356

Query: 353  FSGYFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDR 412
            +  YFLIV DFI++A  N IP GPGRGS AG++ AY L IT IDP+++SLLFERFLNP+R
Sbjct: 357  YVDYFLIVWDFIKYANDNGIPTGPGRGSAAGALVAYTLGITKIDPMKYSLLFERFLNPER 416

Query: 413  MSMPDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQV 472
            +SMPD D DFC + R  VI YV  KYGH+ V+QIITFG++ A+A +RDVGRA+   Y++V
Sbjct: 417  VSMPDIDSDFCYEGRQRVIDYVVEKYGHDNVSQIITFGTMAARACIRDVGRAMNYTYAEV 476

Query: 473  DRLCKLIPNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGI 532
            DR+ K IP      +  +A+  +   +     +  V  L+++S++LEGL RH+STHAAG+
Sbjct: 477  DRIAKQIPTVLGVTID-KALDLNPELKTIYDTEERVKELIDVSRRLEGLPRHSSTHAAGV 535

Query: 533  VIGDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLA-Q 591
            VI  +PL + VP+ ++   +  VTQF+M  +E+ GL+K DFLGL+TLT+++ ++D +   
Sbjct: 536  VIASQPLVEYVPLQKN--DESIVTQFDMTTLEELGLLKMDFLGLRTLTVMRDAVDMIKYN 593

Query: 592  RGVKVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYR 651
            RGV++DL  + FDD E Y ++    T+G+FQLES+GM   ++ ++PDC+EDIIA +SLYR
Sbjct: 594  RGVEIDLDNLDFDDKEVYKMIGEGNTVGVFQLESAGMTSFMKELKPDCLEDIIAGISLYR 653

Query: 652  PGPIDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEAD 711
            PGP+  I  Y + K   + +  I P ++ +L  T GV++YQEQVM+I + L+GYS+  +D
Sbjct: 654  PGPMAEIPRYISGKRDPKSVEYIVPELENILNVTYGVMVYQEQVMEIVRKLAGYSMGRSD 713

Query: 712  VLRRAMGKKIKEEMDKQKERFIS------------GASKNGISKTIAVNIFELLAKFADY 759
            ++RRAM KK  + M+++++ FI             G  +NGIS   A  IF+ +  FA Y
Sbjct: 714  LVRRAMSKKKHKVMEEERKNFIYGIEDENGNIEVPGCLRNGISAEAANKIFDSMMDFASY 773

Query: 760  GFNKSHAAAYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPP 819
             FNKSHAAAYAVI +QTA++  +YPVEFLAA +   M N +K+ ++ + A +  IQ++PP
Sbjct: 774  AFNKSHAAAYAVIGFQTAYLMRYYPVEFLAAMLNSVMGNSDKVSEYIRSAEKLGIQVLPP 833

Query: 820  SVNTPCVDFKVGDNRIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLN 878
             +N     F V  + I + + AIK VG     +I ++      F SL DFC+++D   +N
Sbjct: 834  DINESYTKFTVKGDTIRFGMGAIKNVGVNVVENIAKSRDEKGRFTSLMDFCNKIDLSIVN 893

Query: 879  RRVLESLVFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAH--EKGTFSD 936
            +R +ESL+ AG  D     R QLL   + I        K   +   ++F    E+   + 
Sbjct: 894  KRSVESLIKAGTFDSLKVYRSQLLSVFEKIMDGVYSQRKKNIDGQMSLFGALQEESESNL 953

Query: 937  KITLEKFSVENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVA-------- 988
            +I        N       E+ + G Y SGHPLD Y+  L++      E+ +         
Sbjct: 954  EIRYPNIKEFNKKYMLAMEKEMTGLYMSGHPLDDYEKPLKEQTSITIEKIIEAQKNLNEQ 1013

Query: 989  -------------TIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
                            G  + +  ++ +  +K TR  + + +    +     E   FP
Sbjct: 1014 KNVELEDLVLDSSLTDGTRVIIGGILTNVSRKVTRNNTLMAFAKVEDLTGYLECVIFP 1071


>gi|303328214|ref|ZP_07358652.1| DNA polymerase III, alpha subunit [Desulfovibrio sp. 3_1_syn3]
 gi|302861544|gb|EFL84480.1| DNA polymerase III, alpha subunit [Desulfovibrio sp. 3_1_syn3]
          Length = 1159

 Score =  799 bits (2064), Expect = 0.0,   Method: Composition-based stats.
 Identities = 407/1039 (39%), Positives = 600/1039 (57%), Gaps = 26/1039 (2%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL  H+ YSLL+GA+ + ++  +      PA AITD  N+F A  F       GI+
Sbjct: 2    SDFVHLHCHTEYSLLDGAIRIKDLCARAKDYGMPACAITDHGNMFGAAYFYAACKDFGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PI GC++ +      K +   +        ++LL     GY  L++LVS  +L D     
Sbjct: 62   PIFGCEVYVCHDHTDKTSELARRR----HHLILLAQNELGYHNLVKLVSHGFL-DGFYYK 116

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             R+    L+    EGL  L+   +G I RA        A      +  ++  R Y+ LQ 
Sbjct: 117  PRVDKELLRRY-AEGLTCLSACIAGEIPRAILAKDMDKALSLTREYADIYPGRFYLELQS 175

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            +   ++    + ++++A T +LPLVATN+  +L+ +D +AH+VL+ +   T +    R R
Sbjct: 176  NGLAEQEVVNNALLEIAETADLPLVATNDCHYLNADDADAHEVLLCIQTQTTMDDPKRMR 235

Query: 248  VTPDHYLKNR-SEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                        EM   F+ +PEAL NT+ IA  C+  L       P +   E   +   
Sbjct: 236  FETHELYYKSIEEMEKPFAHVPEALANTMRIAETCNVELDFGHHYFPVYQLPEGASM--- 292

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
             E+E R  A  GLE RL +    +      YR+RL +EL VI  M F GYFLIV +FI W
Sbjct: 293  -ESEFRRLAEEGLERRLEKHPDRENIDPARYRERLQYELGVILEMGFPGYFLIVQEFINW 351

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK + IPVGPGRGS AGS+ A++L IT++DPL ++LLFERFLN +R+S+PD D+DFC+ R
Sbjct: 352  AKNHGIPVGPGRGSAAGSLVAWSLRITNLDPLPYNLLFERFLNNERVSLPDIDVDFCERR 411

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R +VIR++ + YG   VAQI TFG+++AK  +RDVGRAL M +++ DR+ KL+P+D    
Sbjct: 412  RGDVIRHMVDTYGEGSVAQITTFGTMKAKGVVRDVGRALGMTFAETDRIAKLVPDDLKMT 471

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +   R+    D  V  LL+ +++LEGL RHASTHAAG+V+ D+P+ + +P+Y
Sbjct: 472  IK-KALDLEPDLRKLYEEDQQVRHLLDTARRLEGLARHASTHAAGLVVSDKPMEEYLPLY 530

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFL-AQRGVKVDLSLIPFDD 605
               R +  VTQF+    EKAGL+KFDFLGLKT+TL+Q +LD +  Q     DL  +P  D
Sbjct: 531  LGKRGE-LVTQFDGPMTEKAGLVKFDFLGLKTMTLIQDTLDNISLQGQTPPDLDNLPLTD 589

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVV--YNN 663
             ETY L     T G+FQ+ESSGMRQ L  ++P C ED+IA+++LYRPGP+ + +V  +  
Sbjct: 590  AETYELYARGDTDGVFQVESSGMRQYLRMLRPTCFEDVIAMLALYRPGPLGSGMVDEFIK 649

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G+  +V  H  +   L++T GVI+YQEQVMQIAQ+++ Y+L  AD+LRRAMGKK  E
Sbjct: 650  RKHGQVPVVYPHDSLTECLRDTYGVIVYQEQVMQIAQIIASYTLGGADLLRRAMGKKKAE 709

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
             M K++  F++GA KNGI+K  A  IF+L+ KFA+YGFNKSH+AAYA+ISY TA++K HY
Sbjct: 710  AMAKERVTFVAGAEKNGIAKEKANEIFDLMEKFAEYGFNKSHSAAYALISYFTAYLKVHY 769

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
             VEF+AA +T EM N +K+ K+    +   I ++ PSVN    +F     ++ + L  IK
Sbjct: 770  KVEFMAALLTSEMGNQDKLLKYVSCCKDMGIDVVQPSVNQSQREFTAHGGQVVFGLGGIK 829

Query: 844  GVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG    R I+E   +   + SL D C RV+ +K+ +RVLESL+  GA DCF  SR  +L
Sbjct: 830  NVGDEAIREIVEGRKEGGDYISLLDLCCRVNLRKVTKRVLESLIKGGACDCFNVSRAGML 889

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-------KITLEKFSVENSSVRFENE 955
             +L+ +   AQ   K++++   ++ A      +                     ++   E
Sbjct: 890  AALEIVVARAQKKAKDKSSNQVSLLAMAPVVEAAPQPGVGLDCPEATLPEMEDDLKLRAE 949

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTR-KGSR 1014
            +  LGF+ + HPL  Y   +R++ +   E++     G  I  A +V S ++  T+ KG R
Sbjct: 950  KEALGFFLTSHPLQPYSREIRRLRLTTLEDARELFPGAEINCAVLVTSIKEVLTKSKGER 1009

Query: 1015 IGWVTFSEPAKEYEANFFP 1033
            + +V   +     E  FFP
Sbjct: 1010 MAFVGVEDLTGHAEVTFFP 1028


>gi|167768149|ref|ZP_02440202.1| hypothetical protein CLOSS21_02705 [Clostridium sp. SS2/1]
 gi|317499630|ref|ZP_07957892.1| DNA polymerase III [Lachnospiraceae bacterium 5_1_63FAA]
 gi|167709673|gb|EDS20252.1| hypothetical protein CLOSS21_02705 [Clostridium sp. SS2/1]
 gi|291560175|emb|CBL38975.1| DNA polymerase III catalytic subunit, DnaE type [butyrate-producing
            bacterium SSC/2]
 gi|316893105|gb|EFV15325.1| DNA polymerase III [Lachnospiraceae bacterium 5_1_63FAA]
          Length = 1151

 Score =  799 bits (2063), Expect = 0.0,   Method: Composition-based stats.
 Identities = 375/1046 (35%), Positives = 572/1046 (54%), Gaps = 39/1046 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL VH+ YSLL+G+  +  ++ +       +IAITD   ++  ++F + A A GI+P
Sbjct: 2    SFTHLHVHTEYSLLDGSSKIKELVHQAKELGMDSIAITDHGAMYGVIDFYRAAKAEGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +          +          +VLL     GY  L+++VSR +  +      
Sbjct: 62   IIGCEIYVTTGSRFDK--EASQGDKRYYHLVLLAQNDTGYHNLMKIVSRGFT-EGFYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L+E   EGLI L+   +G +      N+ + A+   L  + LFG D  ++ LQ 
Sbjct: 119  RVDYEVLEEY-KEGLIALSACLAGEVATYIRENNYEKAKNTALRLQDLFGKDNFFLELQD 177

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   D+    + +++++    + LVATN+  +  +ED EAHD+L+ +     V  +DR R
Sbjct: 178  HGIPDQTKVNTALLKMSKETGIDLVATNDIHYTFKEDAEAHDILLCIQTGKKVQDEDRMR 237

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +YLK+  EM  +F    EA+ENT +IA+RC+  +      +P +   E       
Sbjct: 238  YEGGQYYLKSPEEMQRLFPYAREAIENTGKIAKRCNVEIVFGEQKVPEYDVPEG----YT 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                L +    GL+ R            ++ R+RLD+EL  I  M +  YFLIV DFI +
Sbjct: 294  AVTYLNHLCEEGLKRRYPN-------ITKELRERLDYELKTIENMGYVDYFLIVWDFIHY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK++ I VGPGRGS AGS+ +Y L ITDIDP+R+ LLFERFLNP+R+SMPD D+DFC +R
Sbjct: 347  AKEHGIAVGPGRGSAAGSIVSYCLEITDIDPIRYQLLFERFLNPERVSMPDIDVDFCYER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG ++V QIITFG++ A+A +RDVGR L +PY++VD + K++PN+    
Sbjct: 407  RQEVIDYVVRKYGKDQVVQIITFGTMAARAVIRDVGRVLDIPYAKVDGISKMVPNELNIT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+      R A   D     L+++S++LEGL RHAS HAAG+VIG   + + VP+ 
Sbjct: 467  ID-KALKISKDLRNAYEQDEETHYLIDMSKRLEGLPRHASMHAAGVVIGKTAIDEYVPLA 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
                 +  VTQF M  IE+ GL+K DFLGL+TLT++Q +   + ++    D++ I   D 
Sbjct: 526  TGA-DNAAVTQFTMTTIEELGLLKMDFLGLRTLTVIQDAEKMVRRKVPDFDITKIDPTDK 584

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            E Y ++    T G+FQLESSGM+  ++ ++P  +EDIIA +SLYRPGP+D I  Y   KN
Sbjct: 585  EVYEMIGNGHTEGVFQLESSGMKSFMKELKPQNMEDIIAGISLYRPGPMDFIPRYIEGKN 644

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
             +E I      ++ +L+ T G I+YQEQVMQI   L+GY+L  +D++RRAM KK  + M 
Sbjct: 645  HQESIHYECEQMEEILEPTYGCIVYQEQVMQIVMKLAGYTLGRSDLVRRAMSKKKGDVMI 704

Query: 727  KQKERF--------ISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            K+++ F        I G   NGI +  A  I++ +  FA Y FNKSHAAAYAV++Y+TA+
Sbjct: 705  KERQNFVYGNEEEGIPGCINNGIDEKTANQIWDEMLDFAKYAFNKSHAAAYAVVAYRTAY 764

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            ++ HYPVEF+AA +T  + N  KI ++    ++  I+I+PP +N     F V    I Y 
Sbjct: 765  LRCHYPVEFMAALLTSVLGNTNKISEYSYACKKLGIKILPPDINYGEGAFSVDHGNIRYG 824

Query: 839  LAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            L AIK +G      I+     + P+   +D   R+ SK++N+R +E+L+ +GALDCF  +
Sbjct: 825  LTAIKSLGRPVIEAIIRERNLNGPYRDFKDLVERLSSKEINKRTVENLIKSGALDCFHVT 884

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFENE 955
            R Q +    ++    Q   KN      ++     E+   S +I+           +   E
Sbjct: 885  RKQQMIVYASVIDSIQKERKNEIAGQMSLMDLLGEEDQQSFQISYPDVGEYEKEQKLAME 944

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEES--------VATIRGNNIRLAAMVVSKQQK 1007
            + VLG Y SGHPL+     L +       +                +  +  ++     K
Sbjct: 945  KEVLGIYVSGHPLEDDIERLERSVTAHTSDFVIDEETGKTKIHDRESCIIGGLISEMSVK 1004

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             T+K   + ++T  +     E   FP
Sbjct: 1005 LTKKNQNMAFITLEDLRGTVEVVVFP 1030


>gi|262166322|ref|ZP_06034059.1| DNA polymerase III alpha subunit [Vibrio mimicus VM223]
 gi|262026038|gb|EEY44706.1| DNA polymerase III alpha subunit [Vibrio mimicus VM223]
          Length = 1159

 Score =  799 bits (2063), Expect = 0.0,   Method: Composition-based stats.
 Identities = 430/1044 (41%), Positives = 620/1044 (59%), Gaps = 37/1044 (3%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
            P F+HL+VHS +S+++G   +  ++ K+AA   PA+A+TD  NL   ++F   A   GI+
Sbjct: 4    PKFIHLRVHSDFSMVDGLSKVPPLVKKVAAMGMPAMALTDFTNLCGLVKFYSTAHNCGIK 63

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIG    +          Q +     +  + +L     GY+ L  L+S+ YL    +  
Sbjct: 64   PIIGADFTL----------QSEEFGDELTKLTVLAKNNVGYKNLTLLISKAYLRGHVQHQ 113

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
              I  +WL E   EGLI+L+GG SG I RA    + Q  EK L  ++  F D  Y+ L R
Sbjct: 114  PVIDKAWLME-HAEGLIVLSGGKSGEIGRALLKGNQQQVEKCLEFYQTHFADHFYLELVR 172

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
                D        ++LA  +ELP+VATN  +F++EE +EAH++ +A+     +    RP+
Sbjct: 173  TGRADEESYLHFALELADQYELPVVATNEVVFITEESFEAHEIRVAIHDGYTLEDPRRPK 232

Query: 248  -VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              +P  YL++ +EM  +F+D+PEALEN+VEIA+RC+  +++       +           
Sbjct: 233  NYSPKQYLRSEAEMCELFADIPEALENSVEIAKRCNVTVRLGE-----YFLPNFPTEGMA 287

Query: 307  EENELRNKAVAGLEVRLA---QGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADF 363
             E+ L  K+  GLE RL         +     +Y +RL  EL+VI +M F GYFLIV +F
Sbjct: 288  IEDFLVMKSREGLEERLEFLFPDPEVRAQRRPEYDERLQIELDVINQMGFPGYFLIVMEF 347

Query: 364  IQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFC 423
            IQW+K N+IPVGPGRGSGAGS+ AYAL ITD+DPL + LLFERFLNP+R+SMPDFD+DFC
Sbjct: 348  IQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLNPERVSMPDFDVDFC 407

Query: 424  QDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDP 483
             D+RD+VI +V   YG + V+QIITFG++ AKA +RDVGR L  P+  VDR+ KL+P DP
Sbjct: 408  MDKRDQVIDHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPFGFVDRISKLVPPDP 467

Query: 484  AHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLV 543
               +    IA +   +E   AD  V  L++  + LEG  R+A  HA G+VI    ++   
Sbjct: 468  GMTLEKAFIA-EPALQELYDADEEVKELIDKCRILEGCTRNAGKHAGGVVISPTAITDFA 526

Query: 544  PMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKV-----DL 598
            P+Y D   + PVTQF+   +E AGL+KFDFLGL+TLT++  +L  +  R  K+      +
Sbjct: 527  PIYCDAEGNFPVTQFDKNDVETAGLVKFDFLGLRTLTIIDWALGLVNPRLKKMGQPPVRI 586

Query: 599  SLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNI 658
              IP DD  ++  L    T  +FQLES GM++ ++ +QPDC EDIIALV+L+RPGP+ + 
Sbjct: 587  EAIPLDDARSFRNLQDAKTTAVFQLESRGMKELIKRLQPDCFEDIIALVALFRPGPLQSG 646

Query: 659  VV--YNNRKNGKEKIVS-----IHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEAD 711
            +V  + +RK+G+E I        H  +  +L+ T G+I+YQEQVMQIAQ+LSGY+L  AD
Sbjct: 647  MVDNFIDRKHGREAISYPDEKWQHESLKEILEPTYGIILYQEQVMQIAQVLSGYTLGGAD 706

Query: 712  VLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAV 771
            +LRRAMGKK  EEM KQ+  F  GA KNG+   +A+ IF+L+ KFA YGFNKSH+AAYA+
Sbjct: 707  MLRRAMGKKKPEEMAKQRAVFQEGAEKNGVDGELAMKIFDLVEKFAGYGFNKSHSAAYAL 766

Query: 772  ISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVG 831
            +SYQT W+KTHYP EF+AA MT +MDN EK+     + +   + ++PP +N+    F V 
Sbjct: 767  VSYQTLWLKTHYPAEFMAAVMTADMDNTEKVVGLVDECKNMGLTVLPPDINSGLYRFNVD 826

Query: 832  DN-RIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAG 889
            DN  I Y + AIKGVG      I+EA   D  F  L DFC+R+D KK+N+RV+E L+ AG
Sbjct: 827  DNGAIVYGIGAIKGVGEGPIEAILEARNKDGYFKDLFDFCARIDLKKVNKRVIEKLILAG 886

Query: 890  ALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFSVENS 948
            ALD  G  R  ++ S+D+  + A    +       ++F        + +    +      
Sbjct: 887  ALDRLGPHRAAMMASVDDAVRAASQHHQAEAFGQTDMFGVLTDAPEEVEQKYTQVPEWPE 946

Query: 949  SVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKK 1008
             VR E E+  LG Y +GHP+D Y   L K       E+  T R  ++ +A +V++ +   
Sbjct: 947  KVRLEGERETLGLYLTGHPVDEYLKELVKYTSCRLNEAAPTRRDQSLTVAGLVIAARVMT 1006

Query: 1009 TRKGSRIGWVTFSEPAKEYEANFF 1032
            T++G+RIG +T  + +   E   +
Sbjct: 1007 TKRGTRIGLMTLDDRSGRMEVMLY 1030


>gi|218885238|ref|YP_002434559.1| DNA polymerase III subunit alpha [Desulfovibrio vulgaris str.
            'Miyazaki F']
 gi|218756192|gb|ACL07091.1| DNA polymerase III, alpha subunit [Desulfovibrio vulgaris str.
            'Miyazaki F']
          Length = 1173

 Score =  799 bits (2063), Expect = 0.0,   Method: Composition-based stats.
 Identities = 416/1037 (40%), Positives = 617/1037 (59%), Gaps = 24/1037 (2%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              FVHL  H+ YSLL+GA+ L ++  K      PA AITD  NL+ A+ F       GI+
Sbjct: 2    SDFVHLHCHTEYSLLDGAIRLKDLCAKAVDFGMPAAAITDHGNLYGAVYFYNTCKQFGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIGC++ +      K +   +        +VLL    EGY  L++LVS  +L       
Sbjct: 62   PIIGCEVYVANDHTDKTSELARVR----HHLVLLARDNEGYHNLVKLVSHGFLHG-FHYK 116

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             R+ +  L++  + G+  L+   +G + RA   +    A +    ++ ++    Y+ LQ 
Sbjct: 117  PRVDMDLLRQY-SGGITALSACLAGQVPRALLRSGMDDAIRIAREYEAIYPGNFYLELQS 175

Query: 189  HRGYDR-YRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            +   ++     ++++LA    LPLVATN+  +L   D EAHDVL+ +     V  + R R
Sbjct: 176  NGLKEQDELNEKLIELADHTGLPLVATNDCHYLEASDVEAHDVLLCIQTQAKVDDERRMR 235

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T + Y K+  EM   F+ +P+A+ NT  IA +C+   +    + P +   E       
Sbjct: 236  FETKELYYKSPEEMAKAFAHVPDAVANTGRIAEQCAVKFEFGKYVFPVYALPEGM----T 291

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
             E+E R  +  GL+ RL +           Y +RL+ EL+VI +M F GYFLIV DFI W
Sbjct: 292  LEDEFRRLSREGLKRRLERHPNRDTIDHDLYWKRLELELDVIGQMGFPGYFLIVQDFINW 351

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK N IPVGPGRGS AGS+ A++L IT++DP+ ++LLFERFLN +R+SMPD D+DFC+ R
Sbjct: 352  AKDNGIPVGPGRGSAAGSLVAWSLRITNLDPIPYNLLFERFLNIERVSMPDIDVDFCERR 411

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVIRYV  KYG + VAQI TFG ++AKA +RDVGRAL M +++ DR+ KL+P D    
Sbjct: 412  RTEVIRYVGEKYGEDMVAQITTFGKMKAKAVVRDVGRALGMTFAETDRIAKLVPEDLKMT 471

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            V  +AI  +         DP + +LL++S +LEGL RHASTHAAG+V+ DRP+ + +P+Y
Sbjct: 472  VK-KAIDAEPDLAALYKTDPQIRKLLDVSMRLEGLSRHASTHAAGVVVSDRPMREYLPLY 530

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-GVKVDLSLIPFDD 605
            R  +    VTQF+MK +EK GL+KFDFLGL+T+TL+Q SLD +A++     DL  +  DD
Sbjct: 531  RG-KKGEIVTQFDMKMVEKVGLVKFDFLGLRTMTLVQDSLDEIARQGKTPPDLDTLALDD 589

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVV--YNN 663
             ETY L +   T GIFQ+ESSGMRQ L  ++P C +D+IA+++LYRPGP+ + +V  +  
Sbjct: 590  AETYELYSRGDTDGIFQVESSGMRQYLRMLKPSCFDDVIAMLALYRPGPLGSGMVDEFIK 649

Query: 664  RKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKE 723
            RK+G+  +    P ++  L++T GVI+YQEQVMQIAQ+ +GY+L  AD+LRRAMGKK  E
Sbjct: 650  RKHGEVPVTYPLPSLEDCLRDTYGVIVYQEQVMQIAQIAAGYTLGGADLLRRAMGKKNAE 709

Query: 724  EMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHY 783
            EM +Q+ +F+ GA KNG+ K  A  IF+L+ KFA+YGFNKSH+AAYA+ISY TA++K H+
Sbjct: 710  EMGQQRIKFVEGAQKNGVPKATADEIFDLMEKFAEYGFNKSHSAAYALISYYTAYLKVHF 769

Query: 784  PVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIK 843
            P EF+AA +T EM N +K+ K+    +   I ++ P+V     +F V +  I + L  IK
Sbjct: 770  PTEFMAALLTSEMGNQDKLLKYVAACKDMGIAVLQPNVQASRREFTVHEGAIVFGLGGIK 829

Query: 844  GVGTTTARHIMEASADKP-FDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
             VG    R I++A  +   F SL D C RV+ +K+ +RVLESL+  GA DC G +R  +L
Sbjct: 830  NVGDEAIREIVDAREEGGVFASLLDLCMRVNLRKVTKRVLESLIKGGACDCLGCTRAGML 889

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKI------TLEKFSVENSSVRFENEQ 956
             +LDN+   AQ   K++ +   ++F       +           ++    +   +   E+
Sbjct: 890  AALDNVVSKAQKRLKDKESNQVSLFTMVPEEPAVCPGIGFDCEEQQAQEWDDDQKLRFEK 949

Query: 957  RVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIG 1016
              LGF+ + HPL  Y+  L ++ +   EE+     G +++ A +V   ++  T+KG+R+ 
Sbjct: 950  EALGFFLTSHPLQPYRKELFRLRLTPLEETRDMAPGMSLKTAVLVTGIKEHMTKKGARMA 1009

Query: 1017 WVTFSEPAKEYEANFFP 1033
            ++   +     E  FFP
Sbjct: 1010 FLQVEDLTASGECVFFP 1026


>gi|261253713|ref|ZP_05946286.1| DNA polymerase III alpha subunit [Vibrio orientalis CIP 102891]
 gi|260937104|gb|EEX93093.1| DNA polymerase III alpha subunit [Vibrio orientalis CIP 102891]
          Length = 1159

 Score =  799 bits (2063), Expect = 0.0,   Method: Composition-based stats.
 Identities = 416/1048 (39%), Positives = 609/1048 (58%), Gaps = 38/1048 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P F+HL+VHS +S+++G   +  ++ K+A    PA+A+TD  NL   ++F   A +
Sbjct: 1    MSD-PKFIHLRVHSDFSMVDGLSKVPPLVKKVAEMGMPAVALTDFTNLCGLVKFYGTAHS 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             GI+PIIG               Q       +  + +L +   GY+ L  L+S+ YL   
Sbjct: 60   CGIKPIIGADF----------LMQSAEFGDELTRLTVLAADNTGYKNLTLLISKAYLRGH 109

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
             +    I   WL E+ +EG+I+L+GG SG I +A    + + AE+ L  ++  F DR Y+
Sbjct: 110  VQHQPVIDKEWLTEL-SEGVIILSGGKSGEIGKALLKGNQKAAEECLAFYQTHFPDRFYL 168

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             L R    D        ++LA   ++P+VATN  + L E  ++AH++ +A+     +   
Sbjct: 169  ELTRTGRADEETYLHFALELAEQSDIPVVATNEVVILEESLFDAHEIRVAIHDGYTLEDP 228

Query: 244  DRPR-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             RP+  +P  YL++  EM  +FSD+PEALEN+VEIA+RC+  +++       +       
Sbjct: 229  RRPKNYSPQQYLRSEEEMCELFSDIPEALENSVEIAKRCNVTVRLGE-----YFLPAFPT 283

Query: 303  IQKEEENELRNKAVAGLE---VRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
               EE   L  K+  GLE     L      +     +Y  RL  EL VI  M F GYFLI
Sbjct: 284  EGMEETEFLVKKSEEGLEDRLEFLFPDPAVRAERRPEYDDRLKIELEVINNMGFPGYFLI 343

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V +FIQW+K N IPVGPGRGSGAGS+ AYAL ITD+DPL + LLFERFLNP+R+SMPDFD
Sbjct: 344  VMEFIQWSKDNAIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLNPERVSMPDFD 403

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            +DFC D+RD+VI +V   YG + V+QIITFG++ AKA +RDVGR L   +  VDR+ KL+
Sbjct: 404  VDFCMDKRDQVIDHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHGFGFVDRISKLV 463

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P DP   +  +A   +    E    D  +  L+++ + LEG  R+A  HA G+VI    +
Sbjct: 464  PPDPGMTLE-KAFKAEPALPELYANDEEIKELIDMCRILEGCTRNAGKHAGGVVISPTTI 522

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-----GV 594
            +   P+Y D     PVTQF+   +E AGL+KFDFLGL+TLT++  +L  +  R       
Sbjct: 523  TDFAPIYADAEGHFPVTQFDKNDVETAGLVKFDFLGLRTLTIIDWALGLINPRLEKEGKP 582

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
             V +  IP  D  +++LL    T  +FQLES GM++ ++ +QPDC EDIIALV+L+RPGP
Sbjct: 583  PVAIESIPLVDQASFNLLQNSETTAVFQLESRGMKELIKRLQPDCFEDIIALVALFRPGP 642

Query: 655  IDNIVV--YNNRKNGKEKIVS-----IHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSL 707
            + + +V  + +RK+G+E +        H  +  +L+ T G+I+YQEQVMQIAQ+LSGY+L
Sbjct: 643  LQSGMVDNFIDRKHGREAVSYPDEQWQHESLKEILEPTYGIILYQEQVMQIAQVLSGYTL 702

Query: 708  SEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
              AD+LRRAMGKK  EEM KQ+  F  GA  NG+   +A+ IF+L+ KFA YGFNKSH+A
Sbjct: 703  GGADMLRRAMGKKKPEEMAKQRATFEEGAIANGVDGELAMKIFDLVEKFAGYGFNKSHSA 762

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
            AYA++SYQT W+KTH+P EF+AA MT +MDN EK+     +  +  ++++PP +N     
Sbjct: 763  AYALVSYQTLWLKTHFPAEFMAAVMTADMDNTEKVVGLVDECFRMKLKVLPPDINAGLYR 822

Query: 828  FKV-GDNRIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESL 885
            F V  +  I Y + AIKGVG      I+EA   D  F  L DFC+R+D KK+N+RV+E L
Sbjct: 823  FNVDEEGAIVYGIGAIKGVGEGPIDAILEARNKDGHFKDLFDFCARIDLKKVNKRVIEKL 882

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA-HEKGTFSDKITLEKFS 944
            ++AGALD  G  R  L+ SL++  K A    +       ++F    +     +    K  
Sbjct: 883  IYAGALDRLGPHRAALMASLNDAVKAASQHHQAEAFGQSDLFGVLTEAPEEVEHKYTKVE 942

Query: 945  VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSK 1004
                 V  E E+  LG Y +GHP++ Y   L K      +++  T R  ++ +A +V++ 
Sbjct: 943  PWPEKVWLEGERDTLGLYLTGHPINAYIRELGKYTSCRLKDATPTRRDQSVTVAGLVIAS 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            +   T++G+RIG +T  + +   E   F
Sbjct: 1003 RVMTTKRGTRIGIMTLDDRSGRMEVMLF 1030


>gi|92117240|ref|YP_576969.1| DNA polymerase III subunit alpha [Nitrobacter hamburgensis X14]
 gi|91800134|gb|ABE62509.1| DNA polymerase III, alpha subunit [Nitrobacter hamburgensis X14]
          Length = 1168

 Score =  799 bits (2063), Expect = 0.0,   Method: Composition-based stats.
 Identities = 530/1040 (50%), Positives = 704/1040 (67%), Gaps = 15/1040 (1%)

Query: 1    LTQYLEKS-PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFS 59
            ++Q L  +   FVHL VHS+YSLL+G++ +  + +   AD QPA+A+TDT+N+F ALEFS
Sbjct: 1    MSQKLAAANAGFVHLHVHSAYSLLKGSIKIQKLAELAKADHQPALALTDTDNMFGALEFS 60

Query: 60   QKACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRM 119
             K    GIQPI+GC+L +D  D     +           IVLL +   GY+ L+ L SR 
Sbjct: 61   DKVAGYGIQPIVGCELAVDFDD----QDPNARSALPFARIVLLATREAGYRNLMRLNSRA 116

Query: 120  YLLDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG 179
            +L     Q+  I   WL++   EGLI LTGG  GP+  AF  + S +A  R      +FG
Sbjct: 117  FLESALHQTPHIKSGWLRDE-NEGLIALTGGPDGPVALAFNADHSALAIARCDQLAGVFG 175

Query: 180  DRLYVNLQRHRGY-DRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHST 238
            DRLYV LQRH    +R  E  ++ LAY   LPLVATN   F + +DYEAHD L+ +A   
Sbjct: 176  DRLYVELQRHGLDKERRVEGALIDLAYAKGLPLVATNEPYFAASDDYEAHDALLCIAGGR 235

Query: 239  VVSQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEK 298
            +V++ DR ++TPDH  K R+EM  +F+D+PEAL +T+EIA RC+F      PILP F   
Sbjct: 236  LVAETDRDQLTPDHRFKTRAEMAVLFADIPEALSSTIEIAERCAFRPLTRKPILPHFAVG 295

Query: 299  ECD---DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSG 355
                  D + +E  ELR +A  GL  RLA   +++G    DY  RL FEL+VI RM ++G
Sbjct: 296  AGANAADAKSDEVAELRRQAEEGLANRLAVHGLSQGMTEDDYSARLSFELDVITRMNYAG 355

Query: 356  YFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSM 415
            YFLIVADFI+ AK   IPVGPGRGSGAGS+ AY LTITD+DP+RF LLFERFLNP+R+SM
Sbjct: 356  YFLIVADFIKHAKSEGIPVGPGRGSGAGSLVAYVLTITDLDPIRFGLLFERFLNPERVSM 415

Query: 416  PDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRL 475
            PDFDIDFCQ+RR EVI YVQ +YG ++VAQIITFG+LQA+  LRDVGR LQMPY QVD+L
Sbjct: 416  PDFDIDFCQERRGEVIDYVQKRYGRDQVAQIITFGTLQARGVLRDVGRVLQMPYGQVDKL 475

Query: 476  CKLIPNDPAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVI 534
             KL+P +PA P++   AIA + + +  R  DP V R  +I+Q+LEGL RHASTHAAGIVI
Sbjct: 476  TKLVPQNPAAPITLAAAIASEPKLQAFRDEDPVVARAFDIAQRLEGLTRHASTHAAGIVI 535

Query: 535  GDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGV 594
            GDRPLS+LVP+YRD +SD+PVTQFNMKW+E AGL+KFDFLGLKTLT+L  ++  L QR V
Sbjct: 536  GDRPLSELVPLYRDPKSDMPVTQFNMKWVEPAGLVKFDFLGLKTLTVLDVAVKLLKQRNV 595

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
             +DL+ +P DD E+Y +LT    +G+FQ+ES GMR+AL  M+PD  EDIIALV+LYRPGP
Sbjct: 596  HIDLATLPLDDAESYQMLTRGDVVGVFQVESQGMRRALVDMRPDRFEDIIALVALYRPGP 655

Query: 655  IDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLR 714
            + NI  Y  RK+G+E+   +HP+++P+LKET GVIIYQEQVMQIAQ+++GYSL +AD+LR
Sbjct: 656  MANIPTYCARKHGEEEPEYLHPMLEPILKETFGVIIYQEQVMQIAQVMAGYSLGDADLLR 715

Query: 715  RAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            RAMGKKI+ EM+KQ   F++G+ KNG+ K  A  IFELLAKFADYGFNKSHAAAYA++SY
Sbjct: 716  RAMGKKIRAEMEKQHAIFVAGSVKNGVPKGQAETIFELLAKFADYGFNKSHAAAYALVSY 775

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
            QTA+MK HYP+EFLAASMTL+M N +K+ +F  +A++  I++  PS+N     F+V    
Sbjct: 776  QTAYMKAHYPIEFLAASMTLDMSNTDKLSEFRSEAQRLEIKVEAPSINRSGATFEVSGGV 835

Query: 835  IYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCF 894
            I Y+LAA+KGVG      I+EA  +  F SL DF +RV  + +N+RV+ESL  AGA D F
Sbjct: 836  ICYALAALKGVGAQAVEQIVEARKNGLFTSLADFAARVPPRAVNKRVIESLAAAGAFDAF 895

Query: 895  GYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFEN 954
              +R ++    + I    Q   +       ++F       +  I L +      S R + 
Sbjct: 896  EPNRARVFAGAEAILAACQRSHEAAMLGQNDMFGGMAD--APAIMLPQAEPWLPSDRLKR 953

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKG 1012
            E   +GF+ SGHPLD Y   L+++ ++ + E   A   G    R+AA VVS+ +++T+ G
Sbjct: 954  EYDAVGFFLSGHPLDDYATALKRLRVQSWAEFSRAVKTGATAGRVAATVVSRMERRTKTG 1013

Query: 1013 SRIGWVTFSEPAKEYEANFF 1032
            +++G +  S+P   +EA  F
Sbjct: 1014 NKMGIIGLSDPTGHFEAVLF 1033


>gi|226323536|ref|ZP_03799054.1| hypothetical protein COPCOM_01311 [Coprococcus comes ATCC 27758]
 gi|225208220|gb|EEG90574.1| hypothetical protein COPCOM_01311 [Coprococcus comes ATCC 27758]
          Length = 1159

 Score =  799 bits (2063), Expect = 0.0,   Method: Composition-based stats.
 Identities = 379/1046 (36%), Positives = 574/1046 (54%), Gaps = 38/1046 (3%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL VH+ YSLL+G+  +   + ++      A AITD   ++  ++F + A AAGI P+
Sbjct: 3    FAHLHVHTEYSLLDGSNKIKEYVARVKELGMTAAAITDHGVMYGVIDFYRAARAAGINPV 62

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +        T  G+        +VLL     GY  L+++VSR +  +      R
Sbjct: 63   LGCEVYVAPGSRFDKTAVGR-DEDRYYHLVLLAENNTGYANLMKIVSRAFT-EGYYYKPR 120

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +    L+    EG+I L+   +G + R       +  +K  L ++++FG    ++ LQ H
Sbjct: 121  VDYELLETYH-EGIIALSACLAGEVQRNLARGMYEEGKKAALHYEQIFGKGNFFLELQDH 179

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++     Q+++L+    + LVATN+  +   ED + HD+L+ +     ++ +DR R 
Sbjct: 180  GIPEQRTVNQQLMRLSQEIGIDLVATNDVHYTYAEDEKPHDILLCLQTGKKLADEDRMRY 239

Query: 249  T-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
                +Y+K++ EM ++F   PEALENT +IA RC   ++     LP+F   E        
Sbjct: 240  EGGQYYVKSKEEMAALFPYAPEALENTQKIADRCHVEIEFGVTKLPKFDVPEGF----TS 295

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L      GL+ R  +             +RL++EL VI  M +  YFLIV DFI +A
Sbjct: 296  WEYLNKLCFDGLKRRYGEDPDPALV------ERLNYELGVIKSMGYVDYFLIVWDFIHFA 349

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K N I VGPGRGS AGS+ AY L IT+IDP+R+ LLFERFLNP+R+SMPD D+DFC +RR
Sbjct: 350  KSNGIMVGPGRGSAAGSIVAYTLAITNIDPIRYQLLFERFLNPERVSMPDIDVDFCFERR 409

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RV QI+TFG+LQA+  LRDVGR + +PY+ VD + K+IP +    +
Sbjct: 410  QEVIDYVVRKYGKDRVVQIVTFGTLQARGVLRDVGRVMDLPYAFVDSIAKMIPKELNITL 469

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
              +++  +   ++    DP V  L+++S++LEGL RH S HAAG+VI  + + + VP+  
Sbjct: 470  D-KSLKMNHELKKLYDEDPQVKELIDMSKRLEGLPRHTSMHAAGVVISQKDVDEYVPLAL 528

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLI-PFDDH 606
                +  VTQF M  +E+ GL+K DFLGL+TLT++Q ++  + +      ++    ++D 
Sbjct: 529  GA-DNNVVTQFTMTTLEELGLLKMDFLGLRTLTVIQDAIRLVEKSTGVKLVTEKLNYNDK 587

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
                 + T  T GIFQ+ES+GM+  ++ ++P  +EDIIA +SLYRPGP+D I  Y   KN
Sbjct: 588  AVLDYIGTGKTDGIFQIESAGMKSFMKELRPQSLEDIIAGISLYRPGPMDFIPQYIKGKN 647

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E I    P + P+L  T G I+YQEQVMQI + L+GYSL  +D++RRAM KK  + M 
Sbjct: 648  HPELITYECPQLKPILAPTYGCIVYQEQVMQIVRDLAGYSLGRSDLVRRAMSKKKGDVMQ 707

Query: 727  KQKERF--------ISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            ++++ F        I G  KNGI + +A  I++ +  FA Y FNKSHAAAYAV+SYQTA+
Sbjct: 708  RERQNFVYGNEEEGIPGCVKNGIDEKVANKIYDEMIDFAKYAFNKSHAAAYAVVSYQTAY 767

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K +YPVE++AA MT  +DN  K+ ++    RQ  I I+PP +N    DF V +  I Y 
Sbjct: 768  LKYYYPVEYMAALMTSVIDNPGKVAEYIYTCRQMGISILPPDINRGVGDFSVDNGNIRYG 827

Query: 839  LAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            LAAIKGVG      I+    +   F  L+DF  R+  K++N+R +E+ + +GA D    +
Sbjct: 828  LAAIKGVGRPVIEQIIRDREEHGTFRDLKDFLERLSGKEVNKRAVENFIKSGAFDSLKGT 887

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFENE 955
            R Q +     I       +KN      ++F    ++     ++TL              E
Sbjct: 888  RKQFMIIYVQIMDQVAQNKKNSLAGQMSLFDIVDDEQKKEFEVTLPDVGEYQKETMLAFE 947

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEESV--------ATIRGNNIRLAAMVVSKQQK 1007
            + VLG Y SGHPL+ Y+   RK       +              G+   +  M+ SK  K
Sbjct: 948  KEVLGVYISGHPLEEYEEKWRKSISATTLDFQLDEETGRTKVRDGSREIIGGMITSKMIK 1007

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             T+K   + ++T  +     E   FP
Sbjct: 1008 YTKKNQTMAFITVEDLLGTVEVVIFP 1033


>gi|327399548|ref|YP_004340417.1| DNA polymerase III subunit alpha [Hippea maritima DSM 10411]
 gi|327182177|gb|AEA34358.1| DNA polymerase III, alpha subunit [Hippea maritima DSM 10411]
          Length = 1133

 Score =  799 bits (2062), Expect = 0.0,   Method: Composition-based stats.
 Identities = 403/1033 (39%), Positives = 612/1033 (59%), Gaps = 32/1033 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            +FVHL  HS YSLL+GA  + ++++K      PA+A+TD  N+F ALEF + A + GI+P
Sbjct: 2    AFVHLHNHSEYSLLDGASRIKHMVEKAKNSGMPAVALTDHGNMFGALEFYKTAKSNGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+G +  I        T            I LL    +GY+ ++ L S  +L        
Sbjct: 62   ILGFEGYISP------TTLDDKQTKGNYHITLLAKNKKGYENIMYLCSMAFLK-GFYYKP 114

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            RI  + L+E  +EG+I  +    G +      N  + A+K +  +K++FG +  ++ + R
Sbjct: 115  RIDKNLLRE-HSEGIIAGSACLHGEVQLRLLDNDFEGAKKVVQEYKEIFGKENFFLEIMR 173

Query: 189  HRGYDRYRESQ-VVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   D+ R  + +++L    + P+VATN+  +L++ED  A D L+ V  +  +  +DR +
Sbjct: 174  HGLEDQQRIDKEIIRLGLETDTPIVATNDCHYLNKEDAIAQDALLCVQTNKHLDDQDRMK 233

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
            + + + Y K   EM+ +F D PE + N+  IA  C+  L++     P +   +  D    
Sbjct: 234  MGSQEFYFKTEEEMLEVFKDNPEFVHNSKVIADMCNVELELGKLAPPHYRTPDGSD---- 289

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
            E+  LR  A  GLE + A          + Y++RL+ EL +I +M FSGYFLIV DF+ +
Sbjct: 290  EKEYLRRLAYKGLEEKTAGF---DNGKKELYKKRLEHELAIIEQMGFSGYFLIVWDFVNY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK+N IPVGPGRGS AGS+ +Y++ ITDIDP++++LLFERFLNP+R++MPD D+DFC +R
Sbjct: 347  AKRNGIPVGPGRGSAAGSLVSYSIGITDIDPIKYNLLFERFLNPERVTMPDIDVDFCAER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            RDEVI YV+ KYG   VAQ+ITFG++ AKA +RDV R +  PY + DR+ K+I   P   
Sbjct: 407  RDEVIHYVREKYGEYNVAQVITFGTMGAKAVVRDVARVMGFPYKEADRIAKMI---PNGE 463

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
                AI  +++ ++    D +V +L EIS+ LEG+ RHAS HAAG+VI   P+ +  P+Y
Sbjct: 464  DLDGAIKSNTQLKQEIEKDDNVKKLFEISKTLEGVKRHASIHAAGVVISTEPIYKSCPLY 523

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
            +    D    QF+  ++E  GLIKFDFLGLK LT++  ++  +       D+S IP DD 
Sbjct: 524  KAPGEDTIAVQFSKDFLEDIGLIKFDFLGLKNLTVIDTTVKLIGN---GFDISKIPLDDK 580

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV--VYNNR 664
            ETY LL    TLG+FQLESSGM++ +  ++P   ED+IALV+LYRPGP+ + +   + +R
Sbjct: 581  ETYKLLQKGDTLGVFQLESSGMQRLIMDLKPTVFEDLIALVALYRPGPLGSGMVQDFIDR 640

Query: 665  KNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEE 724
            K+GK+ I    P ++ +LK+T G+I+YQEQVMQIA  L+GYSL EAD+LRRAMGKK KE 
Sbjct: 641  KHGKKPIEYPLPELEGILKDTYGIILYQEQVMQIASKLAGYSLGEADILRRAMGKKKKEV 700

Query: 725  MDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYP 784
            MD+Q+  F+  A + G+SK  A  IF+L+AKFA+YGFNKSH+AAYA I+YQTA++K HYP
Sbjct: 701  MDQQRGIFVKRAVERGVSKEKAEEIFDLMAKFAEYGFNKSHSAAYAYIAYQTAYLKAHYP 760

Query: 785  VEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR----IYYSLA 840
              F++A +T E +N + I K+ ++  +  I ++PP +N    DF V +      I +  +
Sbjct: 761  AYFMSALLTSEKNNTDNIAKYIEECNRMKITVLPPDINDSFHDFAVAEKDGKKVIRFGFS 820

Query: 841  AIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQ 900
            AIK VG     +I+E   +  F+S+ DF  R D++K+N++VLESL+ +G  D    +R  
Sbjct: 821  AIKNVGDAAIENIIEIRKESKFESIFDFLKRTDTRKVNKKVLESLIKSGCFDSLHQNRAT 880

Query: 901  LLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLG 960
            LL S+D +  +     K    K   +F   K        L            E E+ +LG
Sbjct: 881  LLASVDVLLDWVSTNAKKANKKMVALFGSTKQ-EEAYPELIDVEELTQEKILEYERELLG 939

Query: 961  FYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKGSRIGWVTF 1020
            F+ S +PL  Y+ ++  + I    E+ +T+    + +A + V+ ++ KT++   +  V F
Sbjct: 940  FFVSSNPLSKYENMVNAV-ITADSETASTVFDKEVVMAGIPVAIRKMKTKRKESMAIVKF 998

Query: 1021 SEPAKEYEANFFP 1033
             +    +EA  FP
Sbjct: 999  MDLKGTFEATVFP 1011


>gi|197303992|ref|ZP_03169024.1| hypothetical protein RUMLAC_02729 [Ruminococcus lactaris ATCC 29176]
 gi|197296960|gb|EDY31528.1| hypothetical protein RUMLAC_02729 [Ruminococcus lactaris ATCC 29176]
          Length = 1157

 Score =  799 bits (2062), Expect = 0.0,   Method: Composition-based stats.
 Identities = 376/1047 (35%), Positives = 581/1047 (55%), Gaps = 40/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL VH+ YSLL+G+  +   + ++      + AITD   ++  ++F ++A   GI P
Sbjct: 2    SFAHLHVHTEYSLLDGSNKIKEYVARVKELGMNSAAITDHGVMYGVIDFYREARKQGINP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +           G         +VLL    EGY+ L ++VS+ + ++      
Sbjct: 62   ILGCEVYVAPNSRFDREVTGG--DDRYYHLVLLAENNEGYENLTKIVSKGF-VEGYYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L+    +G+I L+   +G + R       + A+ R L ++++FG    ++ LQ 
Sbjct: 119  RVDKELLRTYH-KGIIALSACLAGEVPRYLTKGMYEEAKDRALEYQEIFGKGNYFLELQD 177

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   D+     Q+++L+    + LVATN+  +   +D +AHD+L+ +     +S ++R R
Sbjct: 178  HGIPDQQLVNQQLMKLSQETGIELVATNDVHYTYADDEKAHDILLCIQTGKKLSDENRMR 237

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +Y+K+  EM ++F    +ALENT +IA RCS  ++     LP++   E       
Sbjct: 238  YEGGQYYVKSEEEMAALFPYARQALENTQKIADRCSVEIEFGVTKLPKYDVPEG----YT 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                L+     GL+             +Q+ + RL +EL+ I  M +  YFLIV DFI++
Sbjct: 294  SWEYLQKLCYEGLDQ-------RYRTPSQELKDRLAYELDTIRHMGYVDYFLIVWDFIKY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK + I VGPGRGS AGS+ +Y L IT IDP+ + LLFERFLNP+R+SMPD D+DFC +R
Sbjct: 347  AKDHGIAVGPGRGSAAGSIVSYCLGITTIDPIHYQLLFERFLNPERVSMPDIDVDFCYER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG + VAQI+TFG+L A+  +RDVGR + +PY+ VD + K+IP +    
Sbjct: 407  RQEVIDYVTRKYGKDCVAQIVTFGTLAARGVIRDVGRVMDLPYAYVDSIAKMIPQELGIT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +   R+   +D +V  L++++++LEGL RH S HAAG+VI  +P+ + VP+ 
Sbjct: 467  ID-KALQMNPELRKLYESDETVTHLIDMAKRLEGLPRHCSMHAAGVVICQKPVEEYVPLS 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
            R        TQF M  +E+ GL+K DFLGL+TLT++Q ++    ++   + +  I ++D 
Sbjct: 526  RAA-DGTITTQFIMTTLEELGLLKMDFLGLRTLTVIQNAVQLARKKQPDLQIDKIDYNDK 584

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
                 + T  T GIFQLES GM+  ++ +QP  +ED+IA +SLYRPGP+D I  Y   KN
Sbjct: 585  AVLDYIGTGKTEGIFQLESGGMKNFMKELQPHSLEDVIAGISLYRPGPMDFIPQYIRGKN 644

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
             +  I    P ++P+L  T G I+YQEQVMQI + L+GY+L  +D+LRRAM KK    M+
Sbjct: 645  DRSSITYDCPQLEPILAPTYGCIVYQEQVMQIVRDLAGYTLGRSDLLRRAMSKKKAAVME 704

Query: 727  KQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            K+++ F+         G  KNGI +  A  I++ +  FA Y FNKSHAAAYAV+SYQTAW
Sbjct: 705  KERKTFVYGDEETGVPGCIKNGIDEQTANKIYDEMIDFAKYAFNKSHAAAYAVVSYQTAW 764

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K +YPVE++AA MT  +DN  K+ ++    RQ  I+I+PP +N    DF V    I Y 
Sbjct: 765  LKYYYPVEYMAALMTSVIDNPTKVAEYIYVCRQMGIKILPPDINKGEADFSVDGGDIRYG 824

Query: 839  LAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSKKL-NRRVLESLVFAGALDCFGY 896
            LAAIK +G    R I+    +   F +LEDF +R+ S++L N+R++E+L+ AGALD  G 
Sbjct: 825  LAAIKSIGRPVIRAIVNDRKELGEFRNLEDFITRISSRELMNKRLVENLIKAGALDVLGG 884

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAH--EKGTFSDKITLEKFSVENSSVRFEN 954
            +R Q +     I  + Q  +KN      ++F    E+     +I +              
Sbjct: 885  TRKQFMSIYIQIVDHMQQEKKNSMVGQMSLFDMVSEEQKEEFQIRMPDVGEYTKENLLGF 944

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV--------ATIRGNNIRLAAMVVSKQQ 1006
            E+ VLG Y SGHPL+ Y+   RK+      +              G    +  ++  K  
Sbjct: 945  EKEVLGVYVSGHPLESYEEEWRKVISATTADFQVDPEVGYTKVRDGAREIIGGIIAEKTV 1004

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K T+    + ++T  +     E   FP
Sbjct: 1005 KHTKTNQMMAFLTVEDLFGTVEVVVFP 1031


>gi|115524557|ref|YP_781468.1| DNA polymerase III subunit alpha [Rhodopseudomonas palustris BisA53]
 gi|115518504|gb|ABJ06488.1| DNA polymerase III, alpha subunit [Rhodopseudomonas palustris BisA53]
          Length = 1165

 Score =  799 bits (2062), Expect = 0.0,   Method: Composition-based stats.
 Identities = 535/1035 (51%), Positives = 695/1035 (67%), Gaps = 13/1035 (1%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +  +  FVHL VHS+YSLL+G++ +  + D   AD QPA+A+TDT+N+F ALEFS K   
Sbjct: 1    MSNA-GFVHLHVHSAYSLLKGSIKIGKLADLAKADHQPALALTDTDNMFGALEFSDKMAG 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            AGIQPI+GC+L ID  D            P+   IVLL S   GY+ L++L SR +L   
Sbjct: 60   AGIQPIVGCELAIDFGDVDPTARNALAAGPS--RIVLLASRERGYRSLMKLNSRAFLETP 117

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
              Q   I L WL +   E LI L+GG  GPI  A   +   +AE R      LFGDRLY+
Sbjct: 118  VNQVPHIKLDWLLDE-AEDLIALSGGPDGPISLAIAADQQALAETRCERLASLFGDRLYI 176

Query: 185  NLQRHRGY-DRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             LQRH    +R  E  ++ LAY   LPLVATN   F S +DYEAHD L+ +A   ++++ 
Sbjct: 177  ELQRHGVDAERRVEPALIDLAYAKGLPLVATNEPYFASTDDYEAHDALLCIASGKLIAET 236

Query: 244  DRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD-- 301
            DR ++TPDH  K R+EM  +F+DLPEAL +TVEIA RC+F  +   PILP F        
Sbjct: 237  DRVQLTPDHRFKTRAEMAVLFADLPEALASTVEIAERCAFRPKTRKPILPFFTVGAGTGD 296

Query: 302  -DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIV 360
             D    E  ELR +A  GL  RL    +A+G   +DYR RL FEL+VI RMK++GYFLIV
Sbjct: 297  TDAASLEAEELRVQAERGLAHRLEVHGLAQGVSEEDYRARLAFELDVITRMKYAGYFLIV 356

Query: 361  ADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDI 420
            +DFI+WAK+  IPVGPGRGSGAGS+ AYALTITD+DP+RF LLFERFLNP+R+SMPDFDI
Sbjct: 357  SDFIKWAKQQGIPVGPGRGSGAGSLVAYALTITDLDPIRFGLLFERFLNPERVSMPDFDI 416

Query: 421  DFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIP 480
            DFCQDRR EVI YVQ +YG ++VAQIITFG+LQA+  LRDVGR LQMPY QVD+L KL+P
Sbjct: 417  DFCQDRRGEVITYVQERYGRDQVAQIITFGTLQARGVLRDVGRVLQMPYGQVDKLTKLVP 476

Query: 481  NDPAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
             +PA PVS  QAI  + + +  R  DP V R  +I+Q+LEGL RHASTHAAGIVIGDRPL
Sbjct: 477  QNPAAPVSLKQAIEGEPKLQAFRDEDPVVARAFDIAQRLEGLTRHASTHAAGIVIGDRPL 536

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLS 599
            S+LVP+YRD +SD+PVTQFNMKW+E AGL+KFDFLGLKTLT+L  ++  L QRGV V L 
Sbjct: 537  SELVPLYRDPKSDMPVTQFNMKWVEPAGLVKFDFLGLKTLTVLDVAVKLLKQRGVHVALP 596

Query: 600  LIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV 659
             +P DD +T+ +L     +G+FQLES GMR+AL  M+PD  EDIIALV+LYRPGP+ NI 
Sbjct: 597  TLPLDDPDTFTMLARGDVVGVFQLESQGMRRALIDMRPDRFEDIIALVALYRPGPMANIP 656

Query: 660  VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGK 719
             Y  RK+G E+   +HP+++P+LKET GVIIYQEQVMQIAQ+++GYSL EAD+LRRAMGK
Sbjct: 657  TYCARKHGDEEPEYLHPILEPILKETFGVIIYQEQVMQIAQVMAGYSLGEADLLRRAMGK 716

Query: 720  KIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWM 779
            KI+ EM+KQ+  F+ GA KNG+ K  A  IF+LLAKFADYGFNKSHAAAYA++SY TA+M
Sbjct: 717  KIRAEMEKQRAIFVDGAMKNGVPKGQADTIFDLLAKFADYGFNKSHAAAYALVSYHTAYM 776

Query: 780  KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSL 839
            K HYPVEFLAASMTLE+ N +K+ +F  +A++  I++  PSVN     F+V D  I+Y+L
Sbjct: 777  KAHYPVEFLAASMTLEIHNTDKLSEFRAEAQRLGIKVEAPSVNRSGATFEVADGTIFYAL 836

Query: 840  AAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRM 899
            A +KGVG      I+ A     F SL DF ++V+ + +N+RV+E L  AGA D    +R 
Sbjct: 837  AGLKGVGQQAVEQIVAARQGGAFTSLADFAAKVNPRAINKRVIECLAAAGAFDQINPNRA 896

Query: 900  QLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVL 959
             +    + I    Q   + +     ++F       +  I L        + R   E   +
Sbjct: 897  AVSGGAEAILAACQRHHEAQVVGQNDMFGGSAD--APSIMLPPLEAWLPAERLRREYDAI 954

Query: 960  GFYFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKGSRIGW 1017
            GF+ SGHPLD Y   L+++ ++ + E   A   G    ++AA VVS+ +++T+ G+++G 
Sbjct: 955  GFFLSGHPLDDYAVALKRLRVQSWAEFCRAVKSGATAGKVAATVVSRMERRTKTGNKMGI 1014

Query: 1018 VTFSEPAKEYEANFF 1032
               S+    +EA  F
Sbjct: 1015 FGLSDATGHFEAVLF 1029


>gi|319783852|ref|YP_004143328.1| DNA polymerase III subunit alpha [Mesorhizobium ciceri biovar
            biserrulae WSM1271]
 gi|317169740|gb|ADV13278.1| DNA polymerase III, alpha subunit [Mesorhizobium ciceri biovar
            biserrulae WSM1271]
          Length = 1175

 Score =  799 bits (2062), Expect = 0.0,   Method: Composition-based stats.
 Identities = 581/1029 (56%), Positives = 752/1029 (73%), Gaps = 8/1029 (0%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            FVHL+VHS+YSLLEGAL +  ++     D+ PAIA+TDTNNLF ALEF+QKA   GIQPI
Sbjct: 29   FVHLRVHSAYSLLEGALQIGKVVAHAVKDEAPAIAVTDTNNLFGALEFAQKAVKDGIQPI 88

Query: 71   IGCQLDIDM-QDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IGCQ  +    +N       +   P +  +VLL +T  GY  L+ LVSR+YL     ++V
Sbjct: 89   IGCQTALAFSGENSDGQRDRRRQGPDMRPVVLLAATEAGYSNLVRLVSRVYLETPPGEAV 148

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRH 189
             +    ++    +GLI L+GG  GPI  A   +   +AE RLLT K +FGDRLYV L R 
Sbjct: 149  HLTTEMMEGY-CDGLICLSGGPRGPIGTALKEDRRDLAEARLLTLKDMFGDRLYVELDRV 207

Query: 190  RGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVT 249
             GYDR  E   + LAY HELPLVATN + F S +DY+AHD L+A+A  +VV+  +R R++
Sbjct: 208  SGYDRVIEKSSIDLAYAHELPLVATNEAFFSSRDDYDAHDALIAIAEGSVVAADNRRRLS 267

Query: 250  PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQ---KE 306
            PD++L+++++M  +F+DLPEA++NTVEIA RCS+  +   PILPRF   +  D     + 
Sbjct: 268  PDNFLRSQADMARLFADLPEAIDNTVEIALRCSYYPKNRNPILPRFTGGDVADNDAAVQA 327

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
            E +EL  +A  GL+ RLA      GY  + YR+RL+FEL +I +MKF GYFLIVADFI+W
Sbjct: 328  EADELARQAHEGLDARLAMHGPTAGYTVEQYRERLNFELGIITKMKFPGYFLIVADFIKW 387

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK   IPVGPGRGSGAGS+ AY+ TITDIDPLRFSLLFERFLNPDR+SMPDFDIDFCQDR
Sbjct: 388  AKAQGIPVGPGRGSGAGSLVAYSTTITDIDPLRFSLLFERFLNPDRVSMPDFDIDFCQDR 447

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R+EVIRYVQ KYG ++V QIITFG+LQA+A LRDVGR LQMPY QVD+L K++P +PA+P
Sbjct: 448  REEVIRYVQQKYGRDQVGQIITFGTLQARAVLRDVGRVLQMPYGQVDKLSKMVPQNPANP 507

Query: 487  VS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
            V    AIA++ RF E    +P V  LL+++QKLEGLYRHASTHAAGIVIGDRPLS+LVPM
Sbjct: 508  VKLADAIANEPRFAEEAEREPIVQTLLDMAQKLEGLYRHASTHAAGIVIGDRPLSELVPM 567

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDD 605
            YRD RSD+PVTQFNMK++E+AGL+KFDFLGLKTLT+L+ ++  + +RG+++DL+ IP DD
Sbjct: 568  YRDPRSDMPVTQFNMKYVEQAGLVKFDFLGLKTLTVLETAVKLIRRRGIEIDLATIPLDD 627

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
             ETY +L+    +G+FQ+ES+GMR+AL GM+PDCIEDIIALV+LYRPGP++NI  YN RK
Sbjct: 628  PETYAMLSRGEVVGVFQVESAGMRKALIGMRPDCIEDIIALVALYRPGPMENIPTYNARK 687

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            +G+E++ SIHP ID ++KETQGVI+YQEQVMQIAQ LSGYSL EAD+LRRAMGKKI+ EM
Sbjct: 688  HGEEEMASIHPKIDHLVKETQGVIVYQEQVMQIAQELSGYSLGEADLLRRAMGKKIRAEM 747

Query: 726  DKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTHYPV 785
            DKQ+ERF+SGA + G+ K  A  IF+LLAKFADYGFNKSHAAAYAV+SYQTA++K HYPV
Sbjct: 748  DKQRERFVSGAVERGVGKPQADFIFDLLAKFADYGFNKSHAAAYAVVSYQTAYLKAHYPV 807

Query: 786  EFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAIKGV 845
            EFLAASMTL+M N +K+  F QDA +  I+++ PSV +    F+VG+NRIYYSLAA+KGV
Sbjct: 808  EFLAASMTLDMGNTDKLADFRQDALRLGIEVLAPSVTSSFRPFEVGENRIYYSLAALKGV 867

Query: 846  GTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLLQSL 905
            G     HI+    +KPF +L DFC RVD K + +RV ESL+ AGALDCFG+ R  ++  +
Sbjct: 868  GDAAVEHIVAQRGEKPFKNLADFCERVDPKIVGKRVFESLIMAGALDCFGHDRASMMAGV 927

Query: 906  DNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFYFSG 965
            + +   A   ++N  +   +IF    G  S  + L       ++ R   E +V+GFY S 
Sbjct: 928  ERMMGLASLAQQNAVSGQHDIFGASLGAQSQALNLPATEPWLAADRLHREFQVVGFYLSA 987

Query: 966  HPLDVYKPILRKMGIKGYEESVATIRGNNI--RLAAMVVSKQQKKTRKGSRIGWVTFSEP 1023
            HPLD YK  L+KM ++ + E  A ++      RLA  V SKQ++KTR G+++G + FS+ 
Sbjct: 988  HPLDEYKAALQKMRVQTWAEFSAAVKRGAAAGRLAGTVTSKQERKTRTGNKMGVIAFSDT 1047

Query: 1024 AKEYEANFF 1032
            + +YEA  F
Sbjct: 1048 SGQYEAVLF 1056


>gi|307692527|ref|ZP_07634764.1| DNA polymerase III DnaE [Ruminococcaceae bacterium D16]
          Length = 1155

 Score =  798 bits (2061), Expect = 0.0,   Method: Composition-based stats.
 Identities = 373/1050 (35%), Positives = 574/1050 (54%), Gaps = 43/1050 (4%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SFVHL +H+ +SLL+GA  +  ++ ++    Q A+AITD   ++  ++F +    AGI+P
Sbjct: 2    SFVHLHLHTEFSLLDGACRIQKLVQRVKDLGQEAVAITDHGVMYGVIDFYRACKGAGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            IIGC++ +  +   +   +          +VLL    EGY+ L  +VS+ +L +      
Sbjct: 62   IIGCEVYVAPRGRTRFQ-KVHEYDAAFSHLVLLCRNEEGYRNLSYMVSQGFL-EGFYIKP 119

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDR-LYVNLQR 188
            RI L  L+E    GLI L+    G I +         A++  L  ++LFG+   Y+ LQ 
Sbjct: 120  RIDLDLLRE-HCGGLIALSACLGGEIPKLLMAGDYDKAKEVALEMRELFGEDGYYLELQD 178

Query: 189  HRGY-DRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H     +     +++L     +PLV TN++ +L  ED E  D+LM +     V    R +
Sbjct: 179  HNIPAQKKVNEGILRLHEETGIPLVCTNDAHYLRREDAEMQDILMCIQMGKTVDDPGRMK 238

Query: 248  VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
                 +     E ++      EAL+NT +IA+ C+         LP F   E        
Sbjct: 239  FETQEFYVKSEEEMAAL-FPREALDNTAKIAQLCNVDFTFGKYHLPHFQLPEGWSDGY-- 295

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
                    + G   R             +YR++LD+E+ +I +M F  YFLIV+DFI +A
Sbjct: 296  -AYFEKLCLDGFRWRYPD-------EPAEYRKQLDYEMAMIQKMGFVDYFLIVSDFIAYA 347

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            K + IPVGPGRGS AGS+ +Y L ITD+DP++++L FERFLNP+R++MPD DIDFC  RR
Sbjct: 348  KGHGIPVGPGRGSAAGSMVSYCLNITDLDPMKYNLYFERFLNPERVTMPDIDIDFCIRRR 407

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPA--H 485
             EVI YV  KYG + VAQI+TFG++ A+AA+RDVGR L MPY+ VD + K IP+ P   H
Sbjct: 408  QEVIDYVARKYGADHVAQIVTFGTMAARAAVRDVGRVLNMPYADVDVIAKQIPSGPGALH 467

Query: 486  PVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPM 545
                +A+      +E+  +D  V +L++ +  +EG+ R+ STHAAG+VI  RP+S  VP+
Sbjct: 468  ITLEEALKLSKPLKESYDSDYKVKKLIDTAMAIEGMPRNTSTHAAGVVITSRPVSDYVPL 527

Query: 546  YRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDD 605
                  DL VTQ+ M  +E+ GL+K DFLGL+ LT+L  ++  + ++    D+  IP DD
Sbjct: 528  --AKNDDLVVTQYIMTTLEELGLLKMDFLGLRNLTVLDDAVKLVRRKEPDFDIHNIPEDD 585

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
              T+ +++   T G+FQ+ESSGM     G++P  IED+ A+V+LYRPGP+++I  + + K
Sbjct: 586  EATFRMISEGRTSGVFQMESSGMTGVCVGLKPHSIEDLTAIVALYRPGPMESIPRFISCK 645

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            N  EK+   HP + P+L  T G I+YQEQV+QI Q L GYSL +AD++RRAM KK  +++
Sbjct: 646  NNPEKVTYKHPSLVPILSNTYGCIVYQEQVIQIFQQLGGYSLGQADMVRRAMSKKKVKDI 705

Query: 726  DKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            +K++E F+         G + NGI + +A +I++ +  FA+Y FNK+HA  YA+++YQTA
Sbjct: 706  EKERETFLHGDPERNIAGCAANGIPENVAQSIYDEIYDFANYAFNKAHAVCYALVAYQTA 765

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            W K H+P E++AA +T  +D+ EK+ ++  + ++++IQ++PP VN    +F V    I +
Sbjct: 766  WFKCHHPKEYMAALLTSVLDSSEKVAEYIAECKEWDIQLLPPDVNESETNFTVSPQGIRF 825

Query: 838  SLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGY 896
             LAA+KGVG +    ++E      PF    DFC R+    LNRRVLESL+ AGA D  G 
Sbjct: 826  GLAALKGVGRSVMNAMLEERVKHGPFTDFMDFCDRMFDHDLNRRVLESLIKAGAFDRMGC 885

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENI----FAHEKGTFSDKITLEKFSVENSSVRF 952
             R QL+Q    +        K       ++        +      + L            
Sbjct: 886  RRSQLMQVFGQVLDGIAASRKRNVEGQMDLFGFGGGEGESAPLPTLHLPDIPEYTPQELM 945

Query: 953  ENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVAT----------IRGNNIRLAAMVV 1002
              E+ V G Y +GHP+D Y+ I RK G       +              G  + +A ++ 
Sbjct: 946  TMEKEVTGLYLTGHPMDAYREIARKRGAVTIGSILNDFDGEEGPQRFRDGERVTVAGVIA 1005

Query: 1003 SKQQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            + + + TR  + + +V   +     E   F
Sbjct: 1006 TYKTRTTRNNTLMAYVNLEDDTASMELLCF 1035


>gi|256827913|ref|YP_003156641.1| DNA polymerase III, alpha subunit [Desulfomicrobium baculatum DSM
            4028]
 gi|256577089|gb|ACU88225.1| DNA polymerase III, alpha subunit [Desulfomicrobium baculatum DSM
            4028]
          Length = 1151

 Score =  798 bits (2061), Expect = 0.0,   Method: Composition-based stats.
 Identities = 413/1040 (39%), Positives = 601/1040 (57%), Gaps = 33/1040 (3%)

Query: 9    PSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQ 68
              F HL  HS YSLL+GA+ L ++  +       + AITD  NLF ++ F  +A   GI+
Sbjct: 2    SGFTHLHCHSEYSLLDGAIRLKDLCARAVDFGFSSAAITDHGNLFGSVPFYLEAKKHGIK 61

Query: 69   PIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            PIIG ++ I            +        +VLL     GY  L+++VS  +L +     
Sbjct: 62   PIIGSEVYIADD-------MFERENKKRFHLVLLAQNLIGYHNLVKIVSAGFL-EGFYYK 113

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
             R+   +L+   +EGLI L+    G +  A    +   A  +   + ++F DR Y+ LQ 
Sbjct: 114  PRVDKKYLRA-HSEGLICLSACLQGEVPYALRHGTFDSALLKAREYMEIFPDRFYLELQS 172

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            +   ++     ++++LA    LPLVATN+  +L ++DYEAHD+L+ V    + S+K R +
Sbjct: 173  NGLKEQEVVNDRLMELANETGLPLVATNDCHYLGKDDYEAHDILLCVGTGKIASEKQRLK 232

Query: 248  V-TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
              T + Y K   EM + F+  PEA+EN   IA  C   L++     P +   E       
Sbjct: 233  FDTNEFYYKAPEEMEAAFAHCPEAVENAGRIADMCEVELKLKQHFFPVYDVPEGV----T 288

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
             + E R  +  GL+ R+A  A+        YR+RL+ EL VI    F  YFLIV DFI W
Sbjct: 289  LDQEFRRLSEEGLKERIA--ALPYEVDESVYRERLELELGVIIEKGFPAYFLIVQDFINW 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK  NIPVGPGRGS AGS+ +YAL ITD+DP+R++L FERFLN +R SMPD D+DFC +R
Sbjct: 347  AKSKNIPVGPGRGSAAGSLVSYALRITDLDPIRYALFFERFLNVERASMPDIDVDFCYNR 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            RDEVI+YV  KYG + VAQI+ FG+++AK A+RDV RAL +     DR+ KLIP+D    
Sbjct: 407  RDEVIKYVSEKYGADHVAQIVAFGTMKAKGAIRDVARALDVSLKDADRIAKLIPDDLKMT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            ++ +A+ ++   R    +DP   +L +++++LEGL RH+S HAAGIVI  +P+ + +P++
Sbjct: 467  LT-KALDEEPELRNLIDSDPQYKKLYDVARRLEGLARHSSIHAAGIVISQKPMVEYLPLH 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVK-VDLSLIPFDD 605
            +  ++   VTQ +MK +E  GLIKFDFLGLKTLT++  +L  + +       L  +P DD
Sbjct: 526  KG-KNGEVVTQLDMKKVELIGLIKFDFLGLKTLTVIDDALKLIRKNNKPVPILEKLPLDD 584

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNN-- 663
             +T+ LL    T G+FQLES GMR+ L G++P C EDIIAL++LYRPGP+++ +V +   
Sbjct: 585  PQTFELLCRGETDGVFQLESDGMRRVLRGLKPSCFEDIIALLALYRPGPLESGMVDDFIG 644

Query: 664  RKNGKEKIVSIHPLI----DPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGK 719
            RK+G  K+      +     P+L++T GVI+YQEQVM+IA  L+ YSL E D LRRAMGK
Sbjct: 645  RKHGLRKVEYEFEELAPVVHPILEDTYGVILYQEQVMKIASDLAKYSLGEGDNLRRAMGK 704

Query: 720  KIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWM 779
            K   EM KQ+ RF+ GA +N IS+  A  IF+L+ KFA YGFNKSH+AAYAVISYQTA++
Sbjct: 705  KDPAEMAKQRVRFLDGARENNISQEAAEYIFDLMEKFAGYGFNKSHSAAYAVISYQTAYV 764

Query: 780  KTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSL 839
            K HYP EF+AA +T E+ N +KI       R  +I+++PP VN    +F V    I Y L
Sbjct: 765  KAHYPAEFMAAIITSEVSNTDKILAHVSACRDMDIEVLPPDVNRSFNEFTVEGESIRYGL 824

Query: 840  AAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSR 898
            + IKGVG      I E       F SL DFC RV+ +K+N+RVL+SL+ +GA+D FG SR
Sbjct: 825  SGIKGVGEGAVESIEEEREKGGDFTSLLDFCQRVNLRKVNKRVLDSLIKSGAMDSFGCSR 884

Query: 899  MQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKG------TFSDKITLEKFSVENSSVRF 952
              LL++LD +Q  AQ   K +T+   +     +           +             + 
Sbjct: 885  RALLENLDKVQAMAQKRAKRKTSGQLSFMGMVEENTCNLTGLGIEDDEAALPEFGDDEKC 944

Query: 953  ENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSKQQKKTRKG 1012
              E+   GF+  GHPL  ++  +R++G     +       + +++  +V S +   T+KG
Sbjct: 945  RMEKEAFGFFLIGHPLQPFRQEIRRLGYPSLAQCADLTEKSPVQVPVLVTSMKTINTKKG 1004

Query: 1013 SRIGWVTFSEPAKEYEANFF 1032
             R+ +    + +   EA  F
Sbjct: 1005 DRMAFCGIEDLSGSGEAIVF 1024


>gi|331086727|ref|ZP_08335804.1| hypothetical protein HMPREF0987_02107 [Lachnospiraceae bacterium
            9_1_43BFAA]
 gi|330409893|gb|EGG89328.1| hypothetical protein HMPREF0987_02107 [Lachnospiraceae bacterium
            9_1_43BFAA]
          Length = 1158

 Score =  798 bits (2061), Expect = 0.0,   Method: Composition-based stats.
 Identities = 376/1048 (35%), Positives = 577/1048 (55%), Gaps = 41/1048 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL VH+ YSLL+G+  +   + ++      + AITD   +F  ++F + A AAGI P
Sbjct: 2    SFAHLHVHTEYSLLDGSNKIKEYVARVKELGMNSAAITDHGVMFGVIDFYRAAKAAGINP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +           G         +VLL    +GYQ L+++VS+ + ++      
Sbjct: 62   ILGCEVYVAPGSRFDHEINGGE--DRYYHLVLLAENNQGYQNLMKIVSKGF-VEGYYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            RI +  L+E   EG+I L+   +G + +       + A++  L ++ +FG    ++ LQ 
Sbjct: 119  RIDIELLEEYH-EGIIALSACLAGEVQKNLLRGMFEEAKQAALRYESIFGKGNFFLELQD 177

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++     ++++LA    + LVATN+  +   ED + HD+L+ +     ++ ++R R
Sbjct: 178  HGLTEQADVNQRLIRLAAETGIELVATNDVHYTYAEDEKPHDILLCIQTGKKLTDENRMR 237

Query: 248  VTPDHYLKNRSE-MVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 Y     + M+ +F    +ALENT +IA RC   ++     LP++           
Sbjct: 238  YAGGQYYVKSEQEMIELFPYARQALENTQKIADRCHVEIEFGVTKLPKYDVPGGM----T 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                L      GLE R            ++ ++RL +EL+ I  M +  YFLIV DFI++
Sbjct: 294  SWEYLNQLCFEGLERRYPNPG-------EELKERLFYELSTIKNMGYVDYFLIVWDFIKY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            A+ N+I VGPGRGS AGS+ +Y L IT+IDP+R+ LLFERFLNP+R+SMPD DIDFC +R
Sbjct: 347  ARDNDISVGPGRGSAAGSIVSYCLGITNIDPIRYQLLFERFLNPERVSMPDIDIDFCFER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG +RV QI+TFG++ A+  +RDVGR + +PY+ VD + K+IP +    
Sbjct: 407  RQEVIDYVVRKYGKDRVVQIVTFGTMAARGVIRDVGRVMDLPYAFVDTIAKMIPTELNIT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +  FR+    D  V  L+++S++LEGL RH S HAAG+VI  + + + VP+ 
Sbjct: 467  ID-KALKMNPEFRKMYETDEQVKYLIDMSKRLEGLPRHTSMHAAGVVISQKSVDEYVPLS 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQ-RGVKVDLSLIPFDD 605
            R        TQF M  +E+ GL+K DFLGL+TLT++Q +++ + Q  GVK+D+  I ++D
Sbjct: 526  RAS-DGSITTQFTMTTLEELGLLKMDFLGLRTLTVIQNAVNLVEQATGVKLDMGEIDYND 584

Query: 606  HETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRK 665
                  + T  T G+FQLES+GM+  ++ ++P  +EDIIA +SLYRPGP+D I  Y   K
Sbjct: 585  KLVLDSIGTGKTDGVFQLESAGMKNFMKELKPQSLEDIIAGISLYRPGPMDFIPQYIKGK 644

Query: 666  NGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEM 725
            N K  I    P ++P+L  T G I+YQEQVMQI + L+GY+L  +D+LRRAM KK  + M
Sbjct: 645  NDKGSITYDCPQLEPILAPTYGCIVYQEQVMQIVRDLAGYTLGRSDLLRRAMSKKKADVM 704

Query: 726  DKQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            +++++ F+         G   NGI +  A  I++ +  FA Y FNKSHAAAYAV+SYQTA
Sbjct: 705  ERERQSFVYGNIDEGVPGCLNNGIDEKTANKIYDEMIDFAKYAFNKSHAAAYAVVSYQTA 764

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYY 837
            ++K +YP+EF+AA MT  ++N  K+ ++   ARQ  I+I+PP +N     F V +  I Y
Sbjct: 765  YLKYYYPIEFMAALMTSVIENPTKVSEYIYAARQMGIKILPPDINRGVSGFSVDEGNIRY 824

Query: 838  SLAAIKGVGTTTARHIM-EASADKPFDSLEDFCSRVDSKK-LNRRVLESLVFAGALDCFG 895
             LAAIK +G      I+ E   +  +  L+DF  R+  K+ LN+R +E+ + AGALD  G
Sbjct: 825  GLAAIKSIGKPVIEAIVSEREENGLYRGLKDFIERISLKEMLNKRSIENFIKAGALDNLG 884

Query: 896  YSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFE 953
             +R Q +     I       +K   +   ++F    E      +I L             
Sbjct: 885  GTRKQFMMIYIQIVDNVNQEKKFSMSGQMSLFDFVDEDQKKEFEIQLPDVGEYEKETLLA 944

Query: 954  NEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESV--------ATIRGNNIRLAAMVVSKQ 1005
             E+ VLG Y SGHPLD Y+   +K       +              G    +  M+V K 
Sbjct: 945  FEKEVLGVYISGHPLDAYEEQWKKSVSATTLDFQLDEETNRTKVHDGAKEIIGGMIVGKT 1004

Query: 1006 QKKTRKGSRIGWVTFSEPAKEYEANFFP 1033
             K T+    + ++T  +     E   FP
Sbjct: 1005 IKHTKTNQMMAFITVEDLLGTVEVVVFP 1032


>gi|229837766|ref|ZP_04457926.1| DNA polymerase III, alpha chain [Yersinia pestis Pestoides A]
 gi|229840988|ref|ZP_04461147.1| DNA polymerase III, alpha chain [Yersinia pestis biovar Orientalis
            str. PEXU2]
 gi|229843089|ref|ZP_04463239.1| DNA polymerase III, alpha chain [Yersinia pestis biovar Orientalis
            str. India 195]
 gi|229903544|ref|ZP_04518657.1| DNA polymerase III, alpha chain [Yersinia pestis Nepal516]
 gi|229679314|gb|EEO75417.1| DNA polymerase III, alpha chain [Yersinia pestis Nepal516]
 gi|229689965|gb|EEO82024.1| DNA polymerase III, alpha chain [Yersinia pestis biovar Orientalis
            str. India 195]
 gi|229697354|gb|EEO87401.1| DNA polymerase III, alpha chain [Yersinia pestis biovar Orientalis
            str. PEXU2]
 gi|229704143|gb|EEO91155.1| DNA polymerase III, alpha chain [Yersinia pestis Pestoides A]
 gi|320014193|gb|ADV97764.1| DNA polymerase III, alpha chain [Yersinia pestis biovar Medievalis
            str. Harbin 35]
          Length = 1160

 Score =  798 bits (2061), Expect = 0.0,   Method: Composition-based stats.
 Identities = 415/1049 (39%), Positives = 601/1049 (57%), Gaps = 39/1049 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            + + P FVHL+VHS YS+++G   +  ++ + AA   PA+AITD  NL   ++F   A  
Sbjct: 1    MAE-PRFVHLRVHSDYSMIDGLAKIGPLVKRAAALGMPALAITDFTNLCGLVKFYGSAHG 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            AGI+PIIG    +          Q +     +  + +L    EGYQ L  L+S  Y    
Sbjct: 60   AGIKPIIGADFYV----------QSEILGDELAHLTVLARNNEGYQNLTLLISEAYQRGY 109

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
            G     I   WL +   EGLI+L+GG  G + +     +    ++ L  +++ F D  Y+
Sbjct: 110  GAAGPIIDRDWLIK-HKEGLILLSGGRMGDVGKFLLRGNQVQVDQCLAFYQEHFPDCYYL 168

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             L R    D        V LA    LP+VATN+  F+ E D++AH++ +A+     +   
Sbjct: 169  ELIRTGRPDEENYLHAAVALATERGLPVVATNDVRFIDESDFDAHEIRVAIHDGFTLVDP 228

Query: 244  DRPR-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             RP+  +P  ++++  +M  +F+D+PEAL N+VEIA+RC+  +++       +   +   
Sbjct: 229  KRPKNYSPQQFMRDEEQMCELFADIPEALINSVEIAKRCNVTIRLGE-----YFLPQFPT 283

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGY---HAQDYRQRLDFELNVIARMKFSGYFLI 359
             +   E+ L  KA  GLE RL               +Y +RLD EL VI +M F GYFLI
Sbjct: 284  GEMSTEDFLVEKAKQGLEERLEFLFPDPEVRLQKRPEYDERLDIELKVINQMGFPGYFLI 343

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V +FIQW+K N +PVGPGRGSGAGS+ AYAL ITDIDPL F LLFERFLNP+R+SMPDFD
Sbjct: 344  VMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDIDPLEFDLLFERFLNPERVSMPDFD 403

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            +DFC ++RD VI +V   YG + V+QIITFG++ AKA +RDVGR L  PY  VDR+ KLI
Sbjct: 404  VDFCMEKRDLVIEHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLI 463

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P DP   +  +A A + +  E   AD  V  L+++++KLEG+ R+A  HA G+VI    +
Sbjct: 464  PLDPGMTLE-KAFAAEPQLAEIYEADEEVRALIDMARKLEGVTRNAGKHAGGVVIAPTKI 522

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-----V 594
            +   P+Y D   + PVTQF+   +E AGL+KFDFLGL+TLT++  +L+ +  R       
Sbjct: 523  TDFAPLYCDAEGNNPVTQFDKNDVEYAGLVKFDFLGLRTLTIINWALEMINARRAKTGLE 582

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
             +D++ IP +D +++ +L    T  +FQLES GM+  ++ ++PDC ED+IALV+L+RPGP
Sbjct: 583  PIDIASIPLEDKKSFDMLQRSETTAVFQLESRGMKDLIKRLKPDCFEDMIALVALFRPGP 642

Query: 655  IDNIVV-------YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSL 707
            + + +V       +         I   H  + P+L+ T G+I+YQEQVMQIAQ+LSGYSL
Sbjct: 643  LQSGMVDNFIDRKHGREAISYPDIEWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYSL 702

Query: 708  SEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
              AD+LRRAMGKK   EM KQ+  F  GA   GI   +A+ IF+L+ KFA YGFNKSH+A
Sbjct: 703  GGADMLRRAMGKKNPAEMAKQRSVFEDGAKNQGIDGELAIKIFDLVEKFAGYGFNKSHSA 762

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
            AYA++SYQT W+K HYP EF+AA MT +MDN +K+     +  +  ++I+PP +N+    
Sbjct: 763  AYALVSYQTLWLKAHYPAEFMAAVMTADMDNTDKVVGLVDECWRMGLKILPPDINSGLYH 822

Query: 828  FKVG-DNRIYYSLAAIKGVGTTTARHIMEASADKP-FDSLEDFCSRVDSKKLNRRVLESL 885
            F V  D  I Y + AIKGVG      I+EA  +   F  L D C+RVD+KKLN+R+LE L
Sbjct: 823  FHVNDDGEIVYGIGAIKGVGEGPIEAILEARKEGGYFKELFDLCARVDTKKLNKRILEKL 882

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFS 944
            + +GA D  G  R  L+ SL +  K A    K       ++F          + +     
Sbjct: 883  IMSGAFDRLGPHRAALMSSLGDALKAADQHAKAEAIGQVDMFGVLADAPEQVEQSYANVP 942

Query: 945  VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKM-GIKGYEESVATIRGNNIRLAAMVVS 1003
                 V  + E+  LG Y +GHP+  Y   + +  G    ++   T RG       +V++
Sbjct: 943  PWQEQVVLDGERETLGLYLTGHPITQYLKEIERYAGGMRLKDMHPTDRGKMTTAVGLVIA 1002

Query: 1004 KQQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
             +   T++G+RIG  T  + +   E   F
Sbjct: 1003 ARVMVTKRGNRIGICTLDDRSGRLEVMLF 1031


>gi|254469239|ref|ZP_05082644.1| DNA polymerase III, alpha subunit subfamily, putative [Pseudovibrio
            sp. JE062]
 gi|211961074|gb|EEA96269.1| DNA polymerase III, alpha subunit subfamily, putative [Pseudovibrio
            sp. JE062]
          Length = 1144

 Score =  798 bits (2061), Expect = 0.0,   Method: Composition-based stats.
 Identities = 535/1032 (51%), Positives = 730/1032 (70%), Gaps = 14/1032 (1%)

Query: 7    KSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAG 66
             SP FVHL+VHS+YSLLEGAL +  ++D  + D+QPA+AITD+ NLF ALEFS+KA  AG
Sbjct: 2    SSPGFVHLRVHSAYSLLEGALPIGKLIDLASKDEQPALAITDSGNLFGALEFSEKAFGAG 61

Query: 67   IQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGK 126
            +QPIIGCQ+ ++ +D   +     +    V  +VLL +  EGY+ L++LVSR +L  +  
Sbjct: 62   MQPIIGCQVSVNFEDQPDV-----SGDDAVSDLVLLAANEEGYENLMDLVSRAFLDTEPG 116

Query: 127  QSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNL 186
                + +S +    + G+I+LTG S GPI+         +A+ RL   +  FGDRLYV L
Sbjct: 117  FKANVPISRVLNK-SGGVIVLTGASEGPINSQLREGHVDLAKSRLELLQNTFGDRLYVEL 175

Query: 187  QRHRGY-DRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDR 245
            QRH    +   E +++ LAY   +P+VATN + F + +DYEAHD L+A++   V+ + DR
Sbjct: 176  QRHNMKGEEDVEPELLNLAYELNIPIVATNEAFFPNPDDYEAHDALIAISEGRVLVETDR 235

Query: 246  PRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRF--IEKECDDI 303
             ++TP+H  K R +M+ +FSDLPEALEN+V IA+RC +     APILPRF   + + ++ 
Sbjct: 236  RQLTPEHCFKTREQMMELFSDLPEALENSVVIAQRCHYRPLKRAPILPRFAGADADAEEA 295

Query: 304  QKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADF 363
            ++ E  EL  +A  GL+ RL    +A     +DY  RLD+EL +I RMKF GYFLIVADF
Sbjct: 296  ERAEAEELTRQAKEGLQARLDVHGLAPDLEEKDYWDRLDYELGIIIRMKFPGYFLIVADF 355

Query: 364  IQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFC 423
            I+WAK  +IPVGPGRGSGAGS+ A++LTITD+DP+RFSLLFERFLNP+R+SMPDFDIDFC
Sbjct: 356  IKWAKNEDIPVGPGRGSGAGSLVAWSLTITDLDPMRFSLLFERFLNPERVSMPDFDIDFC 415

Query: 424  QDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDP 483
            Q+RR+EVIRYVQ KYG E+VAQIIT+G+LQAKA LRDVGR LQMPY QVDRL KL+P +P
Sbjct: 416  QNRREEVIRYVQRKYGREQVAQIITYGTLQAKAVLRDVGRVLQMPYGQVDRLSKLVPGNP 475

Query: 484  AHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQL 542
            A+P +  +A+  + R REA   +  VDRLL+++ KLEGLYRHASTHAAG+VIGDRPL QL
Sbjct: 476  ANPCTLPEALEQEPRLREAAKQEEVVDRLLKMAMKLEGLYRHASTHAAGVVIGDRPLEQL 535

Query: 543  VPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIP 602
            VP+YRD RSD+PV QFNMKW+E AGL+KFDFLGLKTLT++  ++  + +RG++V +  IP
Sbjct: 536  VPLYRDPRSDMPVAQFNMKWVEAAGLVKFDFLGLKTLTVIDTAVSHIKKRGIEVKIEEIP 595

Query: 603  FDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYN 662
             DD  TY LL    T+G+FQLES GMR+A+ GM+PD  EDI+ALV+LYRPGP+DNI +YN
Sbjct: 596  IDDPLTYKLLAAGETVGVFQLESQGMRRAIAGMRPDRFEDIVALVALYRPGPMDNIPIYN 655

Query: 663  NRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIK 722
              K+G+++   +HPL++P+L ET G+I+YQEQVMQIAQ+LSGYSL EAD+LRRAMGKKI 
Sbjct: 656  AVKHGEQEPDYLHPLLEPILTETNGIIVYQEQVMQIAQVLSGYSLGEADLLRRAMGKKIA 715

Query: 723  EEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAWMKTH 782
             EM+ Q+ RF+ GA +  + K  A  I++L+AKFA+YGFNKSHAAAYA+++YQTAW+K +
Sbjct: 716  SEMEIQRARFVEGAVEQKVDKDQAGMIYDLVAKFANYGFNKSHAAAYALVAYQTAWLKAN 775

Query: 783  YPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYSLAAI 842
            YPVEFLA  MTL++ N +K+  F Q+A +  I+++PP+VN   V F V D +I Y++ AI
Sbjct: 776  YPVEFLAGIMTLDLGNTDKLSDFRQEAMRMGIEVVPPNVNKSGVHFDVQDGKIVYAMGAI 835

Query: 843  KGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSRMQLL 902
            KGVG     HI+E   D+PF  L DF +R+  K LN+R +E+L+ AGA D    +R QLL
Sbjct: 836  KGVGEQAVEHIVEVRGDEPFKDLADFATRISPKVLNKRTIENLISAGAFDELNPNRAQLL 895

Query: 903  QSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRVLGFY 962
              LD I   AQ  E+N+ +   + F  +     + + L        S R + E   +GFY
Sbjct: 896  DGLDRIIGMAQRTEENKNSGQNDFFGGDNAP--EPLILNPTDPWLPSERLQKEHAAVGFY 953

Query: 963  FSGHPLDVYKPILRKMGIKGYEESVATIR-GNNI-RLAAMVVSKQQKKTRKGSRIGWVTF 1020
             S HPLD Y+ +  K+ ++ +++   +++ G++  RLA  V +KQ++KTR G+++G V  
Sbjct: 954  ISAHPLDEYRELFTKLRVQLWKDFERSVKAGSSAGRLAGTVTAKQERKTRTGNQMGIVRI 1013

Query: 1021 SEPAKEYEANFF 1032
            S+P  +YEA  F
Sbjct: 1014 SDPTGQYEAVMF 1025


>gi|225572766|ref|ZP_03781521.1| hypothetical protein RUMHYD_00957 [Blautia hydrogenotrophica DSM
            10507]
 gi|225039823|gb|EEG50069.1| hypothetical protein RUMHYD_00957 [Blautia hydrogenotrophica DSM
            10507]
          Length = 1156

 Score =  798 bits (2060), Expect = 0.0,   Method: Composition-based stats.
 Identities = 377/1046 (36%), Positives = 581/1046 (55%), Gaps = 40/1046 (3%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL VH+ YSLL+G+  +   ++++      + AITD   ++  ++F +   AAGI PI
Sbjct: 3    FTHLHVHTEYSLLDGSNKITEYVERVKELGMDSAAITDHGVMYGCIDFYRACKAAGINPI 62

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +          +          +VLL    +GY  L+++VS+ + ++      R
Sbjct: 63   LGCEVYVAPSSRFDR--ETGAGEDRYYHLVLLAENNQGYSNLMKIVSKSF-VEGFYYKPR 119

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            + L+ L+E   EG+I L+   +G + R       +  +K  L ++++FG    ++ LQ H
Sbjct: 120  VDLALLREYH-EGIIALSACLAGEVARYLTRGMYEEGKKAALRYEEIFGKGNFFLELQDH 178

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
                +     Q++++     + LVATN+  +   ED   HD+L+ +     +S ++R R 
Sbjct: 179  GISQQQTVNQQLLRMHQETGIDLVATNDVHYTYAEDEAPHDILLCIQTGKKLSDENRMRY 238

Query: 249  -TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
                +Y+K+  +M  +F    EALENT +I +RC   ++     LP++   E        
Sbjct: 239  VGGQYYVKSAEQMAELFPYALEALENTYKIGQRCHVDIEFGVTKLPKYDVPEG----YTS 294

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L      GLE R            ++ RQRL +EL+ I  M +  YFLIV DFI++A
Sbjct: 295  WEYLNKLCFEGLEERYQP-------VTEELRQRLSYELDTIKNMGYVDYFLIVWDFIKYA 347

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            + + I VGPGRGS AGS+ +Y L IT +DP+R+ LLFERFLNP+R+SMPD D+DFC +RR
Sbjct: 348  RDHGIMVGPGRGSAAGSLVSYTLGITKLDPMRYDLLFERFLNPERVSMPDIDVDFCFERR 407

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RV QI+TFG+L A+  +RDVGR L MPYSQVD + K+IP +    +
Sbjct: 408  QEVIDYVVKKYGKDRVVQIVTFGTLAARGVIRDVGRVLDMPYSQVDTIAKMIPTELNITI 467

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
               A+  +    +    DP +  L++++++LEGL RH S HAAG+VI  + + + VP+ R
Sbjct: 468  D-LALKKNPELAKVYEEDPEIHHLIDMAKRLEGLPRHTSMHAAGVVISQKDVDEYVPLSR 526

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDF-LAQRGVKVDLSLIPFDDH 606
                    TQF M  +E+ GL+K DFLGL+TLT++Q +++   A +G+ +D+  I ++D 
Sbjct: 527  AA-DGTITTQFTMTTLEELGLLKMDFLGLRTLTVIQNAVELVEADKGIHLDMDAIDYNDP 585

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            +    L T  T G+FQLES GM+  ++ ++P  +ED+IA +SLYRPGP+D I  Y   KN
Sbjct: 586  KVLDSLGTGHTDGVFQLESGGMKSFMKELKPQSLEDVIAGISLYRPGPMDFIPQYIRGKN 645

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
              E I    P ++P+LK T G I+YQEQVMQI + L GY+L  +D+LRRAM KK    M+
Sbjct: 646  HPETITYDCPQLEPILKATYGCIVYQEQVMQIVRNLGGYTLGRSDLLRRAMSKKKASVME 705

Query: 727  KQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            K+++ F+         G   NGI + IA  I++ +  FA Y FNKSHAAAYAV+SYQTA+
Sbjct: 706  KERQSFVYGNEEEGVPGCINNGIDEKIANRIYDNMIDFAKYAFNKSHAAAYAVVSYQTAF 765

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K +YPVEF+AA MT  +DN  K+ ++    R+  IQI+PP +N     F V    I Y+
Sbjct: 766  LKYYYPVEFMAALMTSVIDNPGKVSEYIFTCRKMGIQILPPDINRGETVFSVDHGAIRYA 825

Query: 839  LAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            LAAIK +G +    I++    +  F S++DF +R+++K +N+R LE+ + AGA DC   +
Sbjct: 826  LAAIKSIGKSVIDEIVKERKTNGEFVSMKDFVTRINNKDINKRSLENFIKAGAFDCLEGN 885

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFENE 955
            R Q +     + + A   +KN      ++F    E+     +I L K    +       E
Sbjct: 886  RRQQMMVYPLVMESAIQEKKNMMAGQMSLFDLVGEEDKKDYEIQLPKVEEYDQDTLLNFE 945

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEESVA--------TIRGNNIRLAAMVVSKQQK 1007
            + VLG Y SGHPL+ Y+ ++ K       +              G    +  M+  K+ K
Sbjct: 946  KEVLGIYISGHPLEKYRALMEKNVTAWTSDFQPDEETGFPKVKDGVKAIIGGMITEKKVK 1005

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             TR    + ++T  +     E   FP
Sbjct: 1006 YTRTNKVMAFLTLEDLVGIVEVVVFP 1031


>gi|153947435|ref|YP_001400012.1| DNA polymerase III subunit alpha [Yersinia pseudotuberculosis IP
            31758]
 gi|152958930|gb|ABS46391.1| DNA polymerase III, alpha subunit [Yersinia pseudotuberculosis IP
            31758]
          Length = 1160

 Score =  798 bits (2060), Expect = 0.0,   Method: Composition-based stats.
 Identities = 415/1049 (39%), Positives = 601/1049 (57%), Gaps = 39/1049 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            + + P FVHL+VHS YS+++G   +  ++ + AA   PA+AITD  NL   ++F   A  
Sbjct: 1    MAE-PRFVHLRVHSDYSMIDGLAKIGPLVKRAAALGMPALAITDFTNLCGLVKFYGSAHG 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            AGI+PIIG    +          Q +     +  + +L    EGYQ L  L+S  Y    
Sbjct: 60   AGIKPIIGADFYV----------QSEILGDELAHLTVLARNNEGYQNLTLLISEAYQRGY 109

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
            G     I   WL +   EGLI+L+GG  G + +     +    ++ L  +++ F D  Y+
Sbjct: 110  GAAGPIIDRDWLIK-HKEGLILLSGGRMGDVGKFLLRGNQVQVDQCLAFYQEHFPDCYYL 168

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             L R    D        V LA    LP+VATN+  F+ E D++AH++ +A+     +   
Sbjct: 169  ELIRTGRPDEENYLHAAVALATERGLPVVATNDVRFIDESDFDAHEIRVAIHDGFTLVDP 228

Query: 244  DRPR-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             RP+  +P  ++++  +M  +F+D+PEAL N+VEIA+RC+  +++       +   +   
Sbjct: 229  KRPKNYSPQQFMRDEEQMCELFADIPEALINSVEIAKRCNVTIRLGE-----YFLPQFPT 283

Query: 303  IQKEEENELRNKAVAGLEVRLAQGAIAKGY---HAQDYRQRLDFELNVIARMKFSGYFLI 359
             +   E+ L  KA  GLE RL               +Y +RLD EL VI +M F GYFLI
Sbjct: 284  GEMSTEDFLVEKAKQGLEERLEFLFPDPEVRLQKRPEYDERLDIELKVINQMGFPGYFLI 343

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V +FIQW+K N +PVGPGRGSGAGS+ AYAL ITDIDPL F LLFERFLNP+R+SMPDFD
Sbjct: 344  VMEFIQWSKDNGVPVGPGRGSGAGSLVAYALKITDIDPLEFDLLFERFLNPERVSMPDFD 403

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            +DFC ++RD VI +V   YG + V+QIITFG++ AKA +RDVGR L  PY  VDR+ KLI
Sbjct: 404  VDFCMEKRDLVIEHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPYGFVDRISKLI 463

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P DP   +  +A A + +  E   AD  V  L+++++KLEG+ R+A  HA G+VI    +
Sbjct: 464  PLDPGMTLE-KAFAAEPQLAEIYEADEEVRALIDMARKLEGVTRNAGKHAGGVVIAPTKI 522

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-----V 594
            +   P+Y D   + PVTQF+   +E AGL+KFDFLGL+TLT++  +L+ +  R       
Sbjct: 523  TDFAPLYCDAEGNNPVTQFDKNDVEYAGLVKFDFLGLRTLTIINWALEMINARRAKTGLE 582

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
             +D++ IP +D +++ +L    T  +FQLES GM+  ++ ++PDC ED+IALV+L+RPGP
Sbjct: 583  PIDIASIPLEDKKSFDMLQRSETTAVFQLESRGMKDLIKRLKPDCFEDMIALVALFRPGP 642

Query: 655  IDNIVV-------YNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSL 707
            + + +V       +         I   H  + P+L+ T G+I+YQEQVMQIAQ+LSGYSL
Sbjct: 643  LQSGMVDNFIDRKHGREAISYPDIEWQHESLKPVLEPTYGIILYQEQVMQIAQVLSGYSL 702

Query: 708  SEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
              AD+LRRAMGKK   EM KQ+  F  GA   GI   +A+ IF+L+ KFA YGFNKSH+A
Sbjct: 703  GGADMLRRAMGKKNPAEMAKQRSVFEDGAKNQGIDGELAIKIFDLVEKFAGYGFNKSHSA 762

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
            AYA++SYQT W+K HYP EF+AA MT +MDN +K+     +  +  ++I+PP +N+    
Sbjct: 763  AYALVSYQTLWLKAHYPAEFMAAVMTADMDNTDKVVGLVDECWRMGLKILPPDINSGLYH 822

Query: 828  FKVG-DNRIYYSLAAIKGVGTTTARHIMEASADKP-FDSLEDFCSRVDSKKLNRRVLESL 885
            F V  D  I Y + AIKGVG      I+EA  +   F  L D C+RVD+KKLN+R+LE L
Sbjct: 823  FHVNDDGEIVYGIGAIKGVGEGPIEAILEARKEGGYFKELFDLCARVDTKKLNKRILEKL 882

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFS 944
            + +GA D  G  R  L+ SL +  K A    K       ++F          + +     
Sbjct: 883  IMSGAFDRLGPHRAALMSSLGDALKAADQHAKAEAIGQVDMFGVLADAPEQVEQSYANVP 942

Query: 945  VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKM-GIKGYEESVATIRGNNIRLAAMVVS 1003
                 V  + E+  LG Y +GHP+  Y   + +  G    ++   T RG       +V++
Sbjct: 943  PWQEQVVLDGERETLGLYLTGHPITQYLKEIERYAGGMRLKDMHPTDRGKMTTAVGLVIA 1002

Query: 1004 KQQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
             +   T++G+RIG  T  + +   E   F
Sbjct: 1003 ARVMVTKRGNRIGICTLDDRSGRLEVMLF 1031


>gi|90419565|ref|ZP_01227475.1| DNA polymerase III alpha subunit [Aurantimonas manganoxydans
            SI85-9A1]
 gi|90336502|gb|EAS50243.1| DNA polymerase III alpha subunit [Aurantimonas manganoxydans
            SI85-9A1]
          Length = 1153

 Score =  798 bits (2060), Expect = 0.0,   Method: Composition-based stats.
 Identities = 585/1036 (56%), Positives = 748/1036 (72%), Gaps = 10/1036 (0%)

Query: 5    LEK--SPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKA 62
            +     P FVHL+VHS++SLLEGAL L+ I+     D  PAI I DTNNLF ALEFS+KA
Sbjct: 1    MASDTKPKFVHLRVHSAFSLLEGALKLDQIIKFAKGDDAPAIGICDTNNLFGALEFSEKA 60

Query: 63   CAAGIQPIIGCQLDIDMQD-NLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYL 121
              AGIQPI GCQ+D++  D       + +    ++  +VL+ +T  GY  L+E+VS  YL
Sbjct: 61   SKAGIQPITGCQIDVEFSDCEESRGGRRERSLSSIAPLVLIAATEAGYANLVEIVSLAYL 120

Query: 122  LDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDR 181
                     +   WL E  +EG+I LTGG  GPI  A   + S +A  R+     +FGDR
Sbjct: 121  GHADNPRPHVLFEWL-ETRSEGIIALTGGPLGPIGSAIAADRSDLARSRMERMAPVFGDR 179

Query: 182  LYVNLQRHRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVS 241
            LYV LQRH G  R  E+  +QLAY   LPLVATN   FL  +D+EAHD L+AVA + +VS
Sbjct: 180  LYVELQRHEGRSRKVEADTLQLAYDMALPLVATNEPFFLKADDFEAHDALIAVAGNRLVS 239

Query: 242  QKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
            Q+DR R++ DH LK+++EM  +F+DLPEAL NTVEIA+RCS+  +  APILPRF   + D
Sbjct: 240  QEDRRRLSRDHSLKSQNEMSVLFADLPEALHNTVEIAQRCSYRPRTRAPILPRFAGADAD 299

Query: 302  DIQKEEENE--LRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
              + E      LR +A+ GLE RLA   +A G  A+ YR+RL+FEL++I RMKF GYFLI
Sbjct: 300  AAEAEAAEVAELRRQAIEGLEARLAAHGLAPGETAESYRERLEFELSIIERMKFPGYFLI 359

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            VADFI+WAK   IPVGPGRGSGAGS+ AYALT+TD+DPLRFSLLFERFLNP+R+SMPDFD
Sbjct: 360  VADFIKWAKAQGIPVGPGRGSGAGSLVAYALTVTDLDPLRFSLLFERFLNPERVSMPDFD 419

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            IDFCQDRR+EVIRYVQ KYG E+V QIITFG+LQA+A LRDVGR L+M Y QVD+LCKL+
Sbjct: 420  IDFCQDRREEVIRYVQEKYGREQVGQIITFGTLQARAVLRDVGRVLEMSYGQVDKLCKLV 479

Query: 480  PNDPAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRP 538
            P +PA+PV+  QA+ ++ R +EAR  +  VDRL+ I+ KLEGLYRHASTHAAGIVIGDRP
Sbjct: 480  PQNPANPVTLAQALVEEPRLQEAREKEEIVDRLISIALKLEGLYRHASTHAAGIVIGDRP 539

Query: 539  LSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDL 598
            LSQLVPMYRD RSD+PVTQFNMKW+E AGL+KFDFLGLKTLT+LQK+++ +A+ G  +DL
Sbjct: 540  LSQLVPMYRDPRSDMPVTQFNMKWVEPAGLVKFDFLGLKTLTVLQKAVELIARTGPTIDL 599

Query: 599  SLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNI 658
            S IP DD  TY ++T   T+G+FQ+ES GMR+AL GM+PD  EDIIALV+LYRPGP++NI
Sbjct: 600  SAIPLDDARTYEMMTRGETVGVFQVESVGMRKALIGMRPDRFEDIIALVALYRPGPMENI 659

Query: 659  VVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMG 718
              YN RK+G+E+   IH  I P+LKETQGVIIYQEQVMQIAQ+LSGYSL EAD+LRRAMG
Sbjct: 660  PTYNARKHGEEEPDFIHDKIAPILKETQGVIIYQEQVMQIAQVLSGYSLGEADLLRRAMG 719

Query: 719  KKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            KKI+ EMDKQ+ RF+ GA  NG+ KT +  IF+LLAKFADYGFNKSHAAAYA+++YQTA+
Sbjct: 720  KKIRAEMDKQRVRFVEGAVANGLDKTQSNMIFDLLAKFADYGFNKSHAAAYALVAYQTAY 779

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K ++PVEFLAASMTL+  N EK+  F  DA +  I+I+PPSV T    F+VG+N+I+Y+
Sbjct: 780  LKANHPVEFLAASMTLDAGNTEKLNDFRMDAMRLGIKIVPPSVQTSFRQFEVGENKIFYA 839

Query: 839  LAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYSR 898
            LAAIKGVG     HI+    D  F SLEDFC+R+D K +N+R LE L+ AGALDCFG+ R
Sbjct: 840  LAAIKGVGEQAVDHIVATRGDGSFQSLEDFCARIDPKIVNKRTLEFLIAAGALDCFGHER 899

Query: 899  MQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENEQRV 958
              L  ++D +  YA  V + R +   ++F    G+  + + L    +  SS +   E + 
Sbjct: 900  ALLCANIDLMASYALRVHEGRASGQHDMFGGA-GSEPEPLHLNPAQLWTSSEKLLREFQA 958

Query: 959  LGFYFSGHPLDVYKPILRKMGIKGYEE-SVATIRGNNI-RLAAMVVSKQQKKTRKGSRIG 1016
            +GFY S HPLD YK  L+++ ++ + E   A  RG    +LA  V S+Q++KTR G ++G
Sbjct: 959  IGFYLSAHPLDEYKTTLKRLRVQTHAEVIHAVKRGATAGKLAGTVTSRQERKTRSGGKLG 1018

Query: 1017 WVTFSEPAKEYEANFF 1032
             +  S+P+ +YE   F
Sbjct: 1019 IIQLSDPSGQYEVVLF 1034


>gi|229522191|ref|ZP_04411608.1| DNA polymerase III alpha subunit [Vibrio cholerae TM 11079-80]
 gi|229341116|gb|EEO06121.1| DNA polymerase III alpha subunit [Vibrio cholerae TM 11079-80]
          Length = 1159

 Score =  797 bits (2059), Expect = 0.0,   Method: Composition-based stats.
 Identities = 422/1048 (40%), Positives = 617/1048 (58%), Gaps = 38/1048 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P F+HL++HS +S+++G   +  ++ K+AA   PA+A+TD  NL   ++F   A  
Sbjct: 1    MSD-PKFIHLRIHSDFSMVDGLSKVPPLVKKVAAMGMPAMALTDFTNLCGLVKFYSTAHN 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             G++PIIG    +          Q +     +  + LL     GY+ L  L+S+ YL   
Sbjct: 60   CGVKPIIGADFTL----------QSEEFGDDLTKLTLLAKNNVGYKNLTLLISKAYLRGH 109

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
             +    I  +WL E   EGLI+L+GG SG + RA    + Q  E+ +  ++  F D  Y+
Sbjct: 110  VQHQPVIDKAWLVE-HAEGLIVLSGGKSGEVGRALLKGNQQQVERCIEFYQTHFADHFYL 168

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             L R    D        + +A  ++LP+VATN  +F++EE +EAH++ +A+     +   
Sbjct: 169  ELIRTGRADEESYLHFALDVAEQYDLPVVATNEVVFITEESFEAHEIRVAIHDGYTLEDP 228

Query: 244  DRPR-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             RP+  +P  YL++ +EM  +F+D+PEAL N+VEIA+RC+  +++       +       
Sbjct: 229  RRPKNYSPKQYLRSEAEMCELFADIPEALANSVEIAKRCNVTVRLGE-----YFLPNFPT 283

Query: 303  IQKEEENELRNKAVAGLEVRLA---QGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
                 E+ L  K+  GLE RL         +     +Y +RL  EL+VI +M F GYFLI
Sbjct: 284  GGMAIEDFLVMKSREGLEERLEFLFPDPEVRAKRRPEYDERLQVELDVINQMGFPGYFLI 343

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V +FIQW+K N+IPVGPGRGSGAGS+ AYAL ITD+DPL + LLFERFLNP+R+SMPDFD
Sbjct: 344  VMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLNPERVSMPDFD 403

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            +DFC D+RD+VI +V   YG + V+QIITFG++ AKA +RDVGR L  P+  VDR+ KL+
Sbjct: 404  VDFCMDKRDQVIDHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPFGFVDRISKLV 463

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P DP   +    IA +   +E   AD  V  L++  + LEG  R+A  HA G+VI    +
Sbjct: 464  PPDPGMTLEKAFIA-EPALQELYDADEEVKELIDKCRILEGCTRNAGKHAGGVVISPTAI 522

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-----GV 594
            +   P+Y D   + PVTQF+   +E AGL+KFDFLGL+TLT++  +L  +  R       
Sbjct: 523  TDFAPIYCDAEGNFPVTQFDKNDVETAGLVKFDFLGLRTLTIIDWALGLVNPRLKKAGKP 582

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
             V +  IP DD  ++  L    T  +FQLES GM++ ++ +QPDC EDIIALV+L+RPGP
Sbjct: 583  PVRIEAIPLDDARSFRNLQDAKTTAVFQLESRGMKELIKRLQPDCFEDIIALVALFRPGP 642

Query: 655  IDNIVV--YNNRKNGKEKIVS-----IHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSL 707
            + + +V  + +RK+G+E I        H  +  +L+ T G+I+YQEQVMQIAQ+LSGY+L
Sbjct: 643  LQSGMVDNFIDRKHGREAISYPDEKWQHESLKEILEPTYGIILYQEQVMQIAQVLSGYTL 702

Query: 708  SEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
              AD+LRRAMGKK  EEM KQ+  F  GA KNG+   +A+ IF+L+ KFA YGFNKSH+A
Sbjct: 703  GGADMLRRAMGKKKPEEMAKQRAVFQEGAEKNGVDGELAMKIFDLVEKFAGYGFNKSHSA 762

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
            AYA++SYQT W+KTHYP EF+AA MT +MDN EK+     + +   + ++PP +N+    
Sbjct: 763  AYALVSYQTLWLKTHYPAEFMAAVMTADMDNTEKVVGLVDECKNMGLTVLPPDINSGLYR 822

Query: 828  FKVGDN-RIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESL 885
            F V DN  I Y + AIKGVG      I+EA      F  L DFC+R+D KK+N+RV+E L
Sbjct: 823  FNVDDNGAIVYGIGAIKGVGEGPIEAILEARNKGGYFKDLFDFCARIDLKKVNKRVIEKL 882

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFS 944
            + AGALD  G  R  ++ S+D+  + A    +       ++F        + +    +  
Sbjct: 883  ILAGALDRLGPHRAAMMASVDDAVRAASQHHQAEAFGQADMFGVLTDAPEEVEQKYTQVP 942

Query: 945  VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSK 1004
                 VR E E+  LG Y +GHP+D Y   L K       E+  T R  ++ +A +V++ 
Sbjct: 943  EWPEKVRLEGERETLGLYLTGHPVDEYLKELTKYTSCRLNEAAPTRRDQSLTVAGLVIAA 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            +   T++G+RIG +T  + +   E   +
Sbjct: 1003 RVMTTKRGTRIGLMTLDDRSGRMEVMLY 1030


>gi|229524247|ref|ZP_04413652.1| DNA polymerase III alpha subunit [Vibrio cholerae bv. albensis VL426]
 gi|229337828|gb|EEO02845.1| DNA polymerase III alpha subunit [Vibrio cholerae bv. albensis VL426]
          Length = 1159

 Score =  797 bits (2059), Expect = 0.0,   Method: Composition-based stats.
 Identities = 422/1048 (40%), Positives = 617/1048 (58%), Gaps = 38/1048 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P F+HL++HS +S+++G   +  ++ K+AA   PA+A+TD  NL   ++F   A  
Sbjct: 1    MSD-PKFIHLRIHSDFSMVDGLSKVPPLVKKVAAMGMPAMALTDFTNLCGLVKFYSTAHN 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             G++PIIG    +          Q +     +  + LL     GY+ L  L+S+ YL   
Sbjct: 60   CGVKPIIGADFTL----------QSEEFGDELTKLTLLAKNNVGYKNLTLLISKAYLRGH 109

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
             +    I  +WL E   EGLI+L+GG SG + RA    + Q  E+ +  ++  F D  Y+
Sbjct: 110  VQHQPVIDKAWLVE-HAEGLIVLSGGKSGEVGRALLKGNQQQVERCIEFYQTHFADHFYL 168

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             L R    D        + +A  ++LP+VATN  +F++EE +EAH++ +A+     +   
Sbjct: 169  ELIRTGRADEESYLHFALDVAEQYDLPVVATNEVVFITEESFEAHEIRVAIHDGYTLEDP 228

Query: 244  DRPR-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             RP+  +P  YL++ +EM  +F+D+PEAL N+VEIA+RC+  +++       +       
Sbjct: 229  RRPKNYSPKQYLRSEAEMCELFADIPEALANSVEIAKRCNVTVRLGE-----YFLPNFPT 283

Query: 303  IQKEEENELRNKAVAGLEVRLA---QGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
                 E+ L  K+  GLE RL         +     +Y +RL  EL+VI +M F GYFLI
Sbjct: 284  GGMAIEDFLVMKSREGLEERLEFLFPDPDVRAKRRPEYDERLQVELDVINQMGFPGYFLI 343

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V +FIQW+K N+IPVGPGRGSGAGS+ AYAL ITD+DPL + LLFERFLNP+R+SMPDFD
Sbjct: 344  VMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLNPERVSMPDFD 403

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            +DFC D+RD+VI +V   YG + V+QIITFG++ AKA +RDVGR L  P+  VDR+ KL+
Sbjct: 404  VDFCMDKRDQVIDHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPFGFVDRISKLV 463

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P DP   +    IA +   +E   AD  V  L++  + LEG  R+A  HA G+VI    +
Sbjct: 464  PPDPGMTLEKAFIA-EPALQELYDADEEVKELIDKCRILEGCTRNAGKHAGGVVISPTAI 522

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-----GV 594
            +   P+Y D   + PVTQF+   +E AGL+KFDFLGL+TLT++  +L  +  R       
Sbjct: 523  TDFAPIYCDAEGNFPVTQFDKNDVETAGLVKFDFLGLRTLTIIDWALGLVNPRLKKAGKP 582

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
             V +  IP DD  ++  L    T  +FQLES GM++ ++ +QPDC EDIIALV+L+RPGP
Sbjct: 583  PVRIEAIPLDDARSFRNLQDAKTTAVFQLESRGMKELIKRLQPDCFEDIIALVALFRPGP 642

Query: 655  IDNIVV--YNNRKNGKEKIVS-----IHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSL 707
            + + +V  + +RK+G+E I        H  +  +L+ T G+I+YQEQVMQIAQ+LSGY+L
Sbjct: 643  LQSGMVDNFIDRKHGREAISYPDEKWQHESLKEILEPTYGIILYQEQVMQIAQVLSGYTL 702

Query: 708  SEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
              AD+LRRAMGKK  EEM KQ+  F  GA KNG+   +A+ IF+L+ KFA YGFNKSH+A
Sbjct: 703  GGADMLRRAMGKKKPEEMAKQRAVFQEGAEKNGVDGELAMKIFDLVEKFAGYGFNKSHSA 762

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
            AYA++SYQT W+KTHYP EF+AA MT +MDN EK+     + +   + ++PP +N+    
Sbjct: 763  AYALVSYQTLWLKTHYPAEFMAAVMTADMDNTEKVVGLVDECKNMGLTVLPPDINSGLYR 822

Query: 828  FKVGDN-RIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESL 885
            F V DN  I Y + AIKGVG      I+EA      F  L DFC+R+D KK+N+RV+E L
Sbjct: 823  FNVDDNGAIVYGIGAIKGVGEGPIEAILEARNKGGYFKDLFDFCARIDLKKVNKRVIEKL 882

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFS 944
            + AGALD  G  R  ++ S+D+  + A    +       ++F        + +    +  
Sbjct: 883  ILAGALDRLGPHRAAMMASVDDAVRAASQHHQAEAFGQADMFGVLTDAPEEVEQKYTQVP 942

Query: 945  VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSK 1004
                 VR E E+  LG Y +GHP+D Y   L K       E+  T R  ++ +A +V++ 
Sbjct: 943  EWPEKVRLEGERETLGLYLTGHPVDEYLKELTKYTSCRLNEAAPTRRDQSLTVAGLVIAA 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            +   T++G+RIG +T  + +   E   +
Sbjct: 1003 RVMTTKRGTRIGLMTLDDRSGRMEVMLY 1030


>gi|229507681|ref|ZP_04397186.1| DNA polymerase III alpha subunit [Vibrio cholerae BX 330286]
 gi|229512124|ref|ZP_04401603.1| DNA polymerase III alpha subunit [Vibrio cholerae B33]
 gi|229513887|ref|ZP_04403349.1| DNA polymerase III alpha subunit [Vibrio cholerae TMA 21]
 gi|229519259|ref|ZP_04408702.1| DNA polymerase III alpha subunit [Vibrio cholerae RC9]
 gi|229607185|ref|YP_002877833.1| DNA polymerase III subunit alpha [Vibrio cholerae MJ-1236]
 gi|255747058|ref|ZP_05421003.1| DNA polymerase III alpha subunit [Vibrio cholera CIRS 101]
 gi|262167733|ref|ZP_06035435.1| DNA polymerase III alpha subunit [Vibrio cholerae RC27]
 gi|262189888|ref|ZP_06048212.1| DNA polymerase III alpha subunit [Vibrio cholerae CT 5369-93]
 gi|14195659|sp|P52022|DPO3A_VIBCH RecName: Full=DNA polymerase III subunit alpha
 gi|229343948|gb|EEO08923.1| DNA polymerase III alpha subunit [Vibrio cholerae RC9]
 gi|229349068|gb|EEO14025.1| DNA polymerase III alpha subunit [Vibrio cholerae TMA 21]
 gi|229352089|gb|EEO17030.1| DNA polymerase III alpha subunit [Vibrio cholerae B33]
 gi|229355186|gb|EEO20107.1| DNA polymerase III alpha subunit [Vibrio cholerae BX 330286]
 gi|229369840|gb|ACQ60263.1| DNA polymerase III alpha subunit [Vibrio cholerae MJ-1236]
 gi|255735460|gb|EET90860.1| DNA polymerase III alpha subunit [Vibrio cholera CIRS 101]
 gi|262023798|gb|EEY42497.1| DNA polymerase III alpha subunit [Vibrio cholerae RC27]
 gi|262034232|gb|EEY52648.1| DNA polymerase III alpha subunit [Vibrio cholerae CT 5369-93]
          Length = 1159

 Score =  797 bits (2059), Expect = 0.0,   Method: Composition-based stats.
 Identities = 422/1048 (40%), Positives = 617/1048 (58%), Gaps = 38/1048 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P F+HL++HS +S+++G   +  ++ K+AA   PA+A+TD  NL   ++F   A  
Sbjct: 1    MSD-PKFIHLRIHSDFSMVDGLSKVPPLVKKVAAMGMPAMALTDFTNLCGLVKFYSTAHN 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             G++PIIG    +          Q +     +  + LL     GY+ L  L+S+ YL   
Sbjct: 60   CGVKPIIGADFTL----------QSEEFGDELTKLTLLAKNNVGYKNLTLLISKAYLRGH 109

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
             +    I  +WL E   EGLI+L+GG SG + RA    + Q  E+ +  ++  F D  Y+
Sbjct: 110  VQHQPVIDKAWLVE-HAEGLIVLSGGKSGEVGRALLKGNQQQVERCIEFYQTHFADHFYL 168

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             L R    D        + +A  ++LP+VATN  +F++EE +EAH++ +A+     +   
Sbjct: 169  ELIRTGRADEESYLHFALDVAEQYDLPVVATNEVVFITEESFEAHEIRVAIHDGYTLEDP 228

Query: 244  DRPR-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             RP+  +P  YL++ +EM  +F+D+PEAL N+VEIA+RC+  +++       +       
Sbjct: 229  RRPKNYSPKQYLRSEAEMCELFADIPEALANSVEIAKRCNVTVRLGE-----YFLPNFPT 283

Query: 303  IQKEEENELRNKAVAGLEVRLA---QGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
                 E+ L  K+  GLE RL         +     +Y +RL  EL+VI +M F GYFLI
Sbjct: 284  GGMAIEDFLVMKSREGLEERLEFLFPDPEVRAKRRPEYDERLQVELDVINQMGFPGYFLI 343

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V +FIQW+K N+IPVGPGRGSGAGS+ AYAL ITD+DPL + LLFERFLNP+R+SMPDFD
Sbjct: 344  VMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLNPERVSMPDFD 403

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            +DFC D+RD+VI +V   YG + V+QIITFG++ AKA +RDVGR L  P+  VDR+ KL+
Sbjct: 404  VDFCMDKRDQVIDHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPFGFVDRISKLV 463

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P DP   +    IA +   +E   AD  V  L++  + LEG  R+A  HA G+VI    +
Sbjct: 464  PPDPGMTLEKAFIA-EPALQELYDADEEVKELIDKCRILEGCTRNAGKHAGGVVISPTAI 522

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-----GV 594
            +   P+Y D   + PVTQF+   +E AGL+KFDFLGL+TLT++  +L  +  R       
Sbjct: 523  TDFAPIYCDAEGNFPVTQFDKNDVETAGLVKFDFLGLRTLTIIDWALGLVNPRLKKAGKP 582

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
             V +  IP DD  ++  L    T  +FQLES GM++ ++ +QPDC EDIIALV+L+RPGP
Sbjct: 583  PVRIEAIPLDDARSFRNLQDAKTTAVFQLESRGMKELIKRLQPDCFEDIIALVALFRPGP 642

Query: 655  IDNIVV--YNNRKNGKEKIVS-----IHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSL 707
            + + +V  + +RK+G+E I        H  +  +L+ T G+I+YQEQVMQIAQ+LSGY+L
Sbjct: 643  LQSGMVDNFIDRKHGREAISYPDEKWQHESLKEILEPTYGIILYQEQVMQIAQVLSGYTL 702

Query: 708  SEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
              AD+LRRAMGKK  EEM KQ+  F  GA KNG+   +A+ IF+L+ KFA YGFNKSH+A
Sbjct: 703  GGADMLRRAMGKKKPEEMAKQRAVFQEGAEKNGVDGELAMKIFDLVEKFAGYGFNKSHSA 762

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
            AYA++SYQT W+KTHYP EF+AA MT +MDN EK+     + +   + ++PP +N+    
Sbjct: 763  AYALVSYQTLWLKTHYPAEFMAAVMTADMDNTEKVVGLVDECKNMGLTVLPPDINSGLYR 822

Query: 828  FKVGDN-RIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESL 885
            F V DN  I Y + AIKGVG      I+EA      F  L DFC+R+D KK+N+RV+E L
Sbjct: 823  FNVDDNGAIVYGIGAIKGVGEGPIEAILEARNKGGYFKDLFDFCARIDLKKVNKRVIEKL 882

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFS 944
            + AGALD  G  R  ++ S+D+  + A    +       ++F        + +    +  
Sbjct: 883  ILAGALDRLGPHRAAMMASVDDAVRAASQHHQAEAFGQADMFGVLTDAPEEVEQKYTQVP 942

Query: 945  VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSK 1004
                 VR E E+  LG Y +GHP+D Y   L K       E+  T R  ++ +A +V++ 
Sbjct: 943  EWPEKVRLEGERETLGLYLTGHPVDEYLKELTKYTSCRLNEAAPTRRDQSLTVAGLVIAA 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            +   T++G+RIG +T  + +   E   +
Sbjct: 1003 RVMTTKRGTRIGLMTLDDRSGRMEVMLY 1030


>gi|90423933|ref|YP_532303.1| DNA polymerase III subunit alpha [Rhodopseudomonas palustris BisB18]
 gi|90105947|gb|ABD87984.1| DNA polymerase III, alpha subunit [Rhodopseudomonas palustris BisB18]
          Length = 1185

 Score =  797 bits (2059), Expect = 0.0,   Method: Composition-based stats.
 Identities = 535/1040 (51%), Positives = 701/1040 (67%), Gaps = 15/1040 (1%)

Query: 2    TQYLEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQK 61
            T  +  +  FVHL VHS+YSLL G++ +  + +   AD QPA+A+TDT+N+F ALEFS+K
Sbjct: 16   TAPMTNA-GFVHLHVHSAYSLLRGSIKVAKLCELAKADHQPALALTDTDNMFGALEFSEK 74

Query: 62   ACAAGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYL 121
                GIQPI+GC+L +D  D         +  P+   IVLL +   GY+ LI+L SR +L
Sbjct: 75   MAGYGIQPIVGCELAVDFGDQDPNARNALSAAPS--RIVLLAARERGYRSLIKLNSRAFL 132

Query: 122  LDQGKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDR 181
                 Q+  I L WL     E LI L+GG  GPI  AF  + + +AE R      LFGDR
Sbjct: 133  ETPVNQTPHIKLDWL-NGEAEDLIALSGGPEGPISLAFTADQAGLAEARCDRLAALFGDR 191

Query: 182  LYVNLQRHRGY-DRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVV 240
            LY+ LQRH    +R  E+ ++ LAY   LPLVATN   F + +DYEAHD L+ +A   +V
Sbjct: 192  LYIELQRHGVDAERRAEAALIDLAYAKGLPLVATNEPYFATNDDYEAHDALLCIAGGRLV 251

Query: 241  SQKDRPRVTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKEC 300
            ++ DRP++TPDH  K R+EM  +F+DLPEAL +TVEIA RC+F  +   PILP F     
Sbjct: 252  AETDRPQLTPDHRFKTRAEMAVLFADLPEALASTVEIAERCAFRPRTRKPILPHFTLGAG 311

Query: 301  DDIQ-----KEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSG 355
                       E +E+R +A  GL  RL    +AKG   ++YR RL+FEL +I RM+++G
Sbjct: 312  TGSHAAAASSNEADEVRAQAEQGLIKRLQVHGVAKGATEEEYRARLEFELGIITRMQYAG 371

Query: 356  YFLIVADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSM 415
            YFLIV DFI+WAK+N IPVGPGRGSGAGS+ AYALTITD+DP+RF LLFERFLNP+R+SM
Sbjct: 372  YFLIVGDFIKWAKENGIPVGPGRGSGAGSLVAYALTITDLDPIRFGLLFERFLNPERVSM 431

Query: 416  PDFDIDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRL 475
            PDFDIDFCQDRR EVI YVQ +YG ++VAQIITFG+LQA+  LRDVGR LQMPY QVD+L
Sbjct: 432  PDFDIDFCQDRRGEVIEYVQRRYGRDQVAQIITFGTLQARGVLRDVGRVLQMPYGQVDKL 491

Query: 476  CKLIPNDPAHPVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVI 534
             KL+P +PA PV+  QAI  + + +  R  DP V R   I+Q+LEGL RHASTHAAGIVI
Sbjct: 492  TKLVPQNPAAPVTLKQAIESEPKLQAFRDEDPVVARAFNIAQRLEGLTRHASTHAAGIVI 551

Query: 535  GDRPLSQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGV 594
            GDRPLS+LVPMYRD +SD+PVTQFNMKW+E AGL+KFDFLGLKTLT L  ++  L QRGV
Sbjct: 552  GDRPLSELVPMYRDPKSDMPVTQFNMKWVEPAGLVKFDFLGLKTLTTLDVAVKLLKQRGV 611

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
             V L  +P DD +T+ +L     +G+FQLES GMR+AL  M+PD  EDIIALV+LYRPGP
Sbjct: 612  VVSLPTVPLDDPDTFAMLGRGDVVGVFQLESQGMRRALIDMRPDRFEDIIALVALYRPGP 671

Query: 655  IDNIVVYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLR 714
            + NI  Y  RK+G E+   +HP+++ +LKET GVIIYQEQVMQIAQ+++GYSL +AD+LR
Sbjct: 672  MANIPTYCARKHGDEEPEYLHPILESILKETFGVIIYQEQVMQIAQVMAGYSLGQADLLR 731

Query: 715  RAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISY 774
            RAMGKKI+ EM+KQ+  FI+G+ ++G+ K  A  IFELLAKFADYGFNKSHAAAYA++SY
Sbjct: 732  RAMGKKIRAEMEKQRAGFIAGSVEHGVPKAQADAIFELLAKFADYGFNKSHAAAYALVSY 791

Query: 775  QTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNR 834
             TA+MK HYPVEFLAASMTLE+ N +K+ +F  +A++  I++  PSVN     F+V D  
Sbjct: 792  HTAYMKAHYPVEFLAASMTLEIHNTDKLSEFRAEAQRLGIKLEAPSVNRSGATFEVADGV 851

Query: 835  IYYSLAAIKGVGTTTARHIMEASADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCF 894
            IYY+LAA+KGVG      I+E      F SL DF ++V  K +N+RV+ESL  AGA D  
Sbjct: 852  IYYALAALKGVGAQAVELIVEGRKGGLFSSLADFAAKVSPKAINKRVIESLAAAGAFDGL 911

Query: 895  GYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFEN 954
              +R  +    D I    Q   +       ++F       +  I L +      + R   
Sbjct: 912  NPNRAAVFGGADAIMAACQRHHEAAAMGQNDMFGGMAD--APTIMLPQLEAWLPAERLRR 969

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEES-VATIRGNNI-RLAAMVVSKQQKKTRKG 1012
            E   +GF+ SGHPLD Y   L+++ ++ + E   A   G    ++AA VVS+ +++T+ G
Sbjct: 970  EYDAIGFFLSGHPLDDYATALKRLRVQSWAEFCRAVKSGATAGKVAATVVSRMERRTKTG 1029

Query: 1013 SRIGWVTFSEPAKEYEANFF 1032
            +++G +  S+P   +EA  F
Sbjct: 1030 NKMGILGLSDPTGHFEAVLF 1049


>gi|327484762|gb|AEA79169.1| DNA polymerase III alpha subunit [Vibrio cholerae LMA3894-4]
          Length = 1157

 Score =  797 bits (2059), Expect = 0.0,   Method: Composition-based stats.
 Identities = 423/1048 (40%), Positives = 618/1048 (58%), Gaps = 38/1048 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P F+HL++HS +S+++G   +  ++ K+AA   PA+A+TD  NL   ++F   A  
Sbjct: 1    MSD-PKFIHLRIHSDFSMVDGLSKVPPLVKKVAAMGMPAMALTDFTNLCGLVKFYSTAHN 59

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             G++PIIG    +          Q +     +  + LL     GY+ L  L+S+ YL   
Sbjct: 60   CGVKPIIGADFTL----------QSEEFGDELTKLTLLAKNNVGYKNLTLLISKAYLRGH 109

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
             +    I  +WL E   EGLI+L+GG SG + RA    + Q  E+ +  ++  F D  Y+
Sbjct: 110  VQHQPVIDKAWLVE-HAEGLIVLSGGKSGEVGRALLKGNQQQVERCIEFYQTHFADHFYL 168

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             L R    D        + +A  ++LP+VATN  +F++EE +EAH++ +A+     +   
Sbjct: 169  ELIRTGRADEESYLHFALDVAEQYDLPVVATNEVVFITEESFEAHEIRVAIHDGYTLEDP 228

Query: 244  DRPR-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             RP+  +P  YL++ +EM  +F+D+PEAL N+VEIA+RC+  +++       +       
Sbjct: 229  RRPKNYSPKQYLRSEAEMCELFADIPEALANSVEIAKRCNVTVRLGE-----YFLPNFPT 283

Query: 303  IQKEEENELRNKAVAGLEVRLA---QGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
                 E+ L  K+  GLE RL         +     +Y +RL  EL+VI +M F GYFLI
Sbjct: 284  GGMAIEDFLVMKSREGLEERLEFLFPDPEVRAKRRPEYDERLQVELDVINQMGFPGYFLI 343

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V +FIQW+K N+IPVGPGRGSGAGS+ AYAL ITD+DPL + LLFERFLNP+R+SMPDFD
Sbjct: 344  VMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLNPERVSMPDFD 403

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            +DFC D+RD+VI +V   YG + V+QIITFG++ AKA +RDVGR L  P+  VDR+ KL+
Sbjct: 404  VDFCMDKRDQVIDHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPFGFVDRISKLV 463

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P DP   +    IA +   +E   AD  V  L++  + LEG  R+A  HA G+VI    +
Sbjct: 464  PPDPGMTLEKAFIA-EPALQELYDADEEVKELIDKCRILEGCTRNAGKHAGGVVISPTAI 522

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-----GV 594
            +   P+Y D   + PVTQF+   +E AGL+KFDFLGL+TLT++  +L  +  R       
Sbjct: 523  TDFAPIYCDAEGNFPVTQFDKNDVETAGLVKFDFLGLRTLTIIDWALGLVNPRLKKAGKP 582

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
             V +  IP DD  ++  L    T  +FQLES GM++ ++ +QPDC EDIIALV+L+RPGP
Sbjct: 583  PVRIEAIPLDDARSFRNLQDAKTTAVFQLESRGMKELIKRLQPDCFEDIIALVALFRPGP 642

Query: 655  IDNIVV--YNNRKNGKEKIVS-----IHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSL 707
            + + +V  + +RK+G+E I        H  +  +L+ T G+I+YQEQVMQIAQ+LSGY+L
Sbjct: 643  LQSGMVDNFIDRKHGREAISYPDEKWQHESLKEILEPTYGIILYQEQVMQIAQVLSGYTL 702

Query: 708  SEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
              AD+LRRAMGKK  EEM KQ+  F  GA KNG+   +A+ IF+L+ KFA YGFNKSH+A
Sbjct: 703  GGADMLRRAMGKKKPEEMAKQRAVFQEGAEKNGVDGELAMKIFDLVEKFAGYGFNKSHSA 762

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
            AYA++SYQT W+KTHYP EF+AA MT +MDN EK+     + +   + ++PP +N+    
Sbjct: 763  AYALVSYQTLWLKTHYPAEFMAAVMTADMDNTEKVVGLVDECKNMGLTVLPPDINSGLYR 822

Query: 828  FKVGDN-RIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESL 885
            F V DN  I Y + AIKGVG      I+EA   D  F  L DFC+R+D KK+N+RV+E L
Sbjct: 823  FNVDDNGAIVYGIGAIKGVGEGPIEAILEARNKDGYFKDLFDFCARIDLKKVNKRVIEKL 882

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFS 944
            + AGALD  G  R  ++ S+D+  + A    +       ++F        + +    +  
Sbjct: 883  ILAGALDRLGPHRAAMMASVDDAVRAASQHHQAEAFGQADMFGVLTDAPEEVEQKYTQVP 942

Query: 945  VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSK 1004
                 VR E E+  LG Y +GHP+D Y   L K       E+  T R  ++ +A +V++ 
Sbjct: 943  EWPEKVRLEGERETLGLYLTGHPVDEYLKELTKYTSCRLNEAAPTRRDQSLTVAGLVIAA 1002

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            +   T++G+RIG +T  + +   E   +
Sbjct: 1003 RVMTTKRGTRIGLMTLDDRSGRMEVMLY 1030


>gi|154503521|ref|ZP_02040581.1| hypothetical protein RUMGNA_01345 [Ruminococcus gnavus ATCC 29149]
 gi|153795621|gb|EDN78041.1| hypothetical protein RUMGNA_01345 [Ruminococcus gnavus ATCC 29149]
          Length = 1157

 Score =  797 bits (2059), Expect = 0.0,   Method: Composition-based stats.
 Identities = 375/1047 (35%), Positives = 575/1047 (54%), Gaps = 40/1047 (3%)

Query: 10   SFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQP 69
            SF HL VH+ YSLL+G+  +   + ++      + AITD   ++  ++F ++A   GI+P
Sbjct: 2    SFAHLHVHTEYSLLDGSNKIKEYVSRVKELGMNSAAITDHGVMYGVIDFYREARKQGIKP 61

Query: 70   IIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSV 129
            I+GC++ +           G         +VLL     GY  L+++VSR +  +      
Sbjct: 62   ILGCEVYVAPNSRFDRETAGGES--RYHHLVLLAENNTGYANLMKIVSRGFT-EGYYYKP 118

Query: 130  RICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQR 188
            R+    L++   EG+I L+   +G + R      ++ A+K  L ++ +FG    ++ +Q 
Sbjct: 119  RVDKDLLRQYH-EGIIALSACLAGEVQRYLSRGLTEEAKKVALEYQDIFGKGNFFLEMQD 177

Query: 189  HRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPR 247
            H   ++     + +QL+    + LV TN+  +   ED + HD+L+ +     +  ++R R
Sbjct: 178  HGIPEQQLVNQRQIQLSKETGIELVVTNDIHYTYAEDAKPHDILLCIQTGKKLDDENRMR 237

Query: 248  VT-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKE 306
                 +Y+K+  EM ++F    +ALENT +IA RC   ++     LP++   +       
Sbjct: 238  YEGGQYYVKSPQEMEALFPYAKQALENTQKIANRCEVEIEFGVTKLPKYDVPDGM----T 293

Query: 307  EENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQW 366
                L      GLE          G  +++ ++RL +EL+ I  M +  YFLIV DFI++
Sbjct: 294  SWEYLNKLCWEGLEKH-------YGEPSRELKERLRYELDTIRNMGYVDYFLIVWDFIKY 346

Query: 367  AKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDR 426
            AK + I VGPGRGS AGS+ +Y L IT+IDP+R+ LLFERFLNP+R++MPD D+DFC +R
Sbjct: 347  AKDHGIAVGPGRGSAAGSIVSYCLEITNIDPIRYQLLFERFLNPERVTMPDIDVDFCFER 406

Query: 427  RDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHP 486
            R EVI YV  KYG +RV QI+TFG+L A+  +RDVGR + +PY+ VD + K+IP +    
Sbjct: 407  RQEVIDYVVRKYGKDRVVQIVTFGTLAARGVIRDVGRVMDLPYAFVDSIAKMIPQELNIT 466

Query: 487  VSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMY 546
            +  +A+  +   R+    DP V  L+++ ++LEGL RH+S HAAG+VIG R +   VP+ 
Sbjct: 467  ID-KALQMNPELRKTYENDPQVKLLIDMCKRLEGLPRHSSMHAAGVVIGQREIDDFVPLS 525

Query: 547  RDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFDDH 606
            R        TQF M  +E+ GL+K DFLGL+TLT++Q ++     +  ++D+  I ++D 
Sbjct: 526  RAS-DGSITTQFTMTTLEELGLLKMDFLGLRTLTVIQNAVQLAKSKNPELDMDQIDYNDK 584

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            +    + T  T GIFQLES GM+  ++ ++P+ +EDIIA +SLYRPGP+D I  Y   KN
Sbjct: 585  QVLSYIGTGKTDGIFQLESGGMKGFMKELKPNSLEDIIAGISLYRPGPMDFIPQYIRGKN 644

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
                I    P ++P+L  T G I+YQEQVMQI + L+GY+L  +D+LRRAM KK  + M 
Sbjct: 645  DAGSITYDCPQLEPILAPTYGCIVYQEQVMQIVRDLAGYTLGRSDLLRRAMSKKKGDVMQ 704

Query: 727  KQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            K+++ F+         G  KNGI +  A  I++ +  FA Y FNKSHAAAYAV+SYQTA+
Sbjct: 705  KERQIFVYGDEENGVPGCIKNGIDEKTANKIYDEMIDFAKYAFNKSHAAAYAVVSYQTAY 764

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K +YPVE++AA MT  ++N  K+ ++    RQ NIQI+ P +N    +F V  N I Y 
Sbjct: 765  LKYYYPVEYMAALMTSVIENPSKVAEYIYACRQMNIQILSPDINRGIGNFSVDGNNIRYG 824

Query: 839  LAAIKGVGTTTARHIMEASAD-KPFDSLEDFCSRVDSK-KLNRRVLESLVFAGALDCFGY 896
            LAAIK +G      I+E   +  PF +LEDF SR+  K  LN+R +E L+ +GALDC G 
Sbjct: 825  LAAIKSIGRPVIAAIIEDRDEFGPFKNLEDFISRMSFKDGLNKRAIEHLIKSGALDCLGG 884

Query: 897  SRMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFEN 954
            +R Q +     I  +    +K        +F    E+     +I L      +       
Sbjct: 885  TRKQFMSIYVQIVDHVNQEKKYAMTGQMTLFDMVGEEEKEQFEIKLPDVGEYSKENLLAF 944

Query: 955  EQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVA--------TIRGNNIRLAAMVVSKQQ 1006
            E+ VLG Y SGHPL  Y+   RK       +              G    +  M+ +K  
Sbjct: 945  EKEVLGAYLSGHPLQEYEDKWRKSISATTLDFQPDEETGRAKVHDGTREIVGGMITAKTI 1004

Query: 1007 KKTRKGSRIGWVTFSEPAKEYEANFFP 1033
            K T+    + +++  +     E   FP
Sbjct: 1005 KHTKTNQMMAFLSLEDLVGTVEVIVFP 1031


>gi|331092255|ref|ZP_08341083.1| hypothetical protein HMPREF9477_01726 [Lachnospiraceae bacterium
            2_1_46FAA]
 gi|330401687|gb|EGG81266.1| hypothetical protein HMPREF9477_01726 [Lachnospiraceae bacterium
            2_1_46FAA]
          Length = 1157

 Score =  797 bits (2059), Expect = 0.0,   Method: Composition-based stats.
 Identities = 367/1046 (35%), Positives = 575/1046 (54%), Gaps = 40/1046 (3%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F HL VH+ YSLL+G+  +   + ++      + AITD   +F  ++F + A A GI+PI
Sbjct: 3    FAHLHVHTEYSLLDGSNKIKEYVARVKELGMDSAAITDHGVMFGVIDFYRAAKAEGIKPI 62

Query: 71   IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
            +GC++ +  Q       +  T       +VLL    +GY+ L ++VS+ + ++      R
Sbjct: 63   LGCEVYVAPQSRFDK--EVGTREDRYYHLVLLAENNKGYENLTKIVSKAF-VEGYYYKPR 119

Query: 131  ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLYVNLQRH 189
            +    L++   EG+I L+   +G + +       + A K    ++K+FG    ++ LQ H
Sbjct: 120  VDYELLEQYH-EGIIALSACLAGEVQKNLLRGMYEEAVKSAKRYEKIFGKGNFFLELQDH 178

Query: 190  RGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
               ++     ++++L+    + LVATN+  +   ED + HD+L+ +     +  ++R R 
Sbjct: 179  GIPEQATVNQRLLRLSQDTGIELVATNDVHYTYAEDEKPHDILLCIQTGKKLQDENRMRY 238

Query: 249  T-PDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDIQKEE 307
                +Y+K+  EM  +F    +ALENT +IA RC   ++     LPR+            
Sbjct: 239  EGGQYYVKSPEEMAELFPYALQALENTQKIADRCDVEIEFGVTKLPRYDVPSG----YTS 294

Query: 308  ENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQWA 367
               L      GL       A       ++  +RL +EL+VI +M +  YFLIV DFI++A
Sbjct: 295  WEYLNKLCFDGL-------ASRYQPVTEELGERLTYELSVIQKMGYVDYFLIVWDFIKYA 347

Query: 368  KKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQDRR 427
            + N+I VGPGRGS AGS+ +Y L ITDIDP+R+ LLFERFLNP+R+SMPD DIDFC +RR
Sbjct: 348  RDNDIMVGPGRGSAAGSIVSYCLGITDIDPIRYQLLFERFLNPERVSMPDIDIDFCFERR 407

Query: 428  DEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAHPV 487
             EVI YV  KYG +RV QI+TFG++ A+  +RDVGR + +PY+ VD + K+IP +    +
Sbjct: 408  QEVIDYVVRKYGADRVVQIVTFGTMAARGVIRDVGRVMDLPYAFVDTIAKMIPTELNMTL 467

Query: 488  SLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVPMYR 547
            + +A++ +   ++    D  V  L+++S +LEGL RH S HAAG+VI  +P+ + VP+  
Sbjct: 468  T-KALSVNPELKKVYEEDAEVKELIDMSLRLEGLPRHTSMHAAGVVISQKPVDEYVPLSL 526

Query: 548  DVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSLIPFDDH 606
                    TQF M  +E+ GL+K DFLGL+TLT++Q +     +    K+D+  I ++D 
Sbjct: 527  GA-DGAVTTQFTMTTLEELGLLKMDFLGLRTLTVIQNAAKLAEKSSGHKIDMHKINYNDK 585

Query: 607  ETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIVVYNNRKN 666
            E    + T  T GIFQLES+GM+  ++ ++P  +EDIIA +SLYRPGP+D I  Y   KN
Sbjct: 586  EVLESIGTGKTDGIFQLESAGMKNFMKELKPQNLEDIIAGISLYRPGPMDFIPQYIKGKN 645

Query: 667  GKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMGKKIKEEMD 726
             +  I    P ++P+L+ T G I+YQEQVMQI + L+GY+L  +D+LRRAM KK  + M+
Sbjct: 646  DRGSITYDCPQLEPILESTYGCIVYQEQVMQIVRDLAGYTLGRSDLLRRAMSKKKADVME 705

Query: 727  KQKERFIS--------GASKNGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTAW 778
            K+++ F+         G   NGI +  A  I++ +  FA Y FNKSHAAAYAV++YQTA+
Sbjct: 706  KERQNFVYGNEEEGVPGCVANGIPEETANKIYDEMIDFAKYAFNKSHAAAYAVVAYQTAY 765

Query: 779  MKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDNRIYYS 838
            +K +YPVEF+AA MT  +DN  K+ ++   +RQ  I I+PP +N    +F V +  I Y 
Sbjct: 766  LKYYYPVEFMAALMTSVIDNPGKVSEYIYASRQMGIHILPPDINEGEGNFSVDNGNIRYG 825

Query: 839  LAAIKGVGTTTARHIMEASA-DKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFGYS 897
            LAAIK +G      I+        + +L++F  R+  K++N+R +E+ + AGA D    +
Sbjct: 826  LAAIKSIGRPVIEAIITEREIGGKYQNLKNFIERLSGKEVNKRTIENFIKAGAFDSLPGT 885

Query: 898  RMQLLQSLDNIQKYAQWVEKNRTNKHENIFA--HEKGTFSDKITLEKFSVENSSVRFENE 955
            R QL+     I        KN  +   ++F    E+      I L              E
Sbjct: 886  RKQLMMIYIQILDQVNKDRKNSMSGQMSLFDLVDEEQKKEFDIPLPDVKEYEKETMLAFE 945

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEESVA--------TIRGNNIRLAAMVVSKQQK 1007
            + VLG Y SGHP++ Y+ + +K       +              G+   +  ++V+K  K
Sbjct: 946  KEVLGVYVSGHPMEEYEELWKKSISATTMDFQPGEETGRSKVRDGSKEIIGGLIVNKTIK 1005

Query: 1008 KTRKGSRIGWVTFSEPAKEYEANFFP 1033
             T+    + ++T  +     E   FP
Sbjct: 1006 YTKNNKVMAFLTIEDLLGTVEVVIFP 1031


>gi|15642243|ref|NP_231876.1| DNA polymerase III subunit alpha [Vibrio cholerae O1 biovar El Tor
            str. N16961]
 gi|121586281|ref|ZP_01676071.1| DNA polymerase III, alpha subunit [Vibrio cholerae 2740-80]
 gi|121726522|ref|ZP_01679771.1| DNA polymerase III, alpha subunit [Vibrio cholerae V52]
 gi|147675187|ref|YP_001217760.1| DNA polymerase III subunit alpha [Vibrio cholerae O395]
 gi|153817071|ref|ZP_01969738.1| DNA polymerase III, alpha subunit [Vibrio cholerae NCTC 8457]
 gi|153820865|ref|ZP_01973532.1| DNA polymerase III, alpha subunit [Vibrio cholerae B33]
 gi|153825312|ref|ZP_01977979.1| DNA polymerase III, alpha subunit [Vibrio cholerae MZO-2]
 gi|227082369|ref|YP_002810920.1| DNA polymerase III, alpha subunit [Vibrio cholerae M66-2]
 gi|254286447|ref|ZP_04961404.1| DNA polymerase III, alpha subunit [Vibrio cholerae AM-19226]
 gi|254849375|ref|ZP_05238725.1| DNA polymerase III subunit alpha [Vibrio cholerae MO10]
 gi|9656805|gb|AAF95389.1| DNA polymerase III, alpha subunit [Vibrio cholerae O1 biovar El Tor
            str. N16961]
 gi|121549547|gb|EAX59573.1| DNA polymerase III, alpha subunit [Vibrio cholerae 2740-80]
 gi|121630975|gb|EAX63354.1| DNA polymerase III, alpha subunit [Vibrio cholerae V52]
 gi|126512339|gb|EAZ74933.1| DNA polymerase III, alpha subunit [Vibrio cholerae NCTC 8457]
 gi|126521657|gb|EAZ78880.1| DNA polymerase III, alpha subunit [Vibrio cholerae B33]
 gi|146317070|gb|ABQ21609.1| DNA polymerase III, alpha subunit [Vibrio cholerae O395]
 gi|149740996|gb|EDM55065.1| DNA polymerase III, alpha subunit [Vibrio cholerae MZO-2]
 gi|150423396|gb|EDN15340.1| DNA polymerase III, alpha subunit [Vibrio cholerae AM-19226]
 gi|227010257|gb|ACP06469.1| DNA polymerase III, alpha subunit [Vibrio cholerae M66-2]
 gi|227014141|gb|ACP10351.1| DNA polymerase III, alpha subunit [Vibrio cholerae O395]
 gi|254845080|gb|EET23494.1| DNA polymerase III subunit alpha [Vibrio cholerae MO10]
          Length = 1164

 Score =  797 bits (2058), Expect = 0.0,   Method: Composition-based stats.
 Identities = 422/1048 (40%), Positives = 617/1048 (58%), Gaps = 38/1048 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P F+HL++HS +S+++G   +  ++ K+AA   PA+A+TD  NL   ++F   A  
Sbjct: 6    MSD-PKFIHLRIHSDFSMVDGLSKVPPLVKKVAAMGMPAMALTDFTNLCGLVKFYSTAHN 64

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             G++PIIG    +          Q +     +  + LL     GY+ L  L+S+ YL   
Sbjct: 65   CGVKPIIGADFTL----------QSEEFGDELTKLTLLAKNNVGYKNLTLLISKAYLRGH 114

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
             +    I  +WL E   EGLI+L+GG SG + RA    + Q  E+ +  ++  F D  Y+
Sbjct: 115  VQHQPVIDKAWLVE-HAEGLIVLSGGKSGEVGRALLKGNQQQVERCIEFYQTHFADHFYL 173

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             L R    D        + +A  ++LP+VATN  +F++EE +EAH++ +A+     +   
Sbjct: 174  ELIRTGRADEESYLHFALDVAEQYDLPVVATNEVVFITEESFEAHEIRVAIHDGYTLEDP 233

Query: 244  DRPR-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             RP+  +P  YL++ +EM  +F+D+PEAL N+VEIA+RC+  +++       +       
Sbjct: 234  RRPKNYSPKQYLRSEAEMCELFADIPEALANSVEIAKRCNVTVRLGE-----YFLPNFPT 288

Query: 303  IQKEEENELRNKAVAGLEVRLA---QGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
                 E+ L  K+  GLE RL         +     +Y +RL  EL+VI +M F GYFLI
Sbjct: 289  GGMAIEDFLVMKSREGLEERLEFLFPDPEVRAKRRPEYDERLQVELDVINQMGFPGYFLI 348

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V +FIQW+K N+IPVGPGRGSGAGS+ AYAL ITD+DPL + LLFERFLNP+R+SMPDFD
Sbjct: 349  VMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLNPERVSMPDFD 408

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            +DFC D+RD+VI +V   YG + V+QIITFG++ AKA +RDVGR L  P+  VDR+ KL+
Sbjct: 409  VDFCMDKRDQVIDHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPFGFVDRISKLV 468

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P DP   +    IA +   +E   AD  V  L++  + LEG  R+A  HA G+VI    +
Sbjct: 469  PPDPGMTLEKAFIA-EPALQELYDADEEVKELIDKCRILEGCTRNAGKHAGGVVISPTAI 527

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-----GV 594
            +   P+Y D   + PVTQF+   +E AGL+KFDFLGL+TLT++  +L  +  R       
Sbjct: 528  TDFAPIYCDAEGNFPVTQFDKNDVETAGLVKFDFLGLRTLTIIDWALGLVNPRLKKAGKP 587

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
             V +  IP DD  ++  L    T  +FQLES GM++ ++ +QPDC EDIIALV+L+RPGP
Sbjct: 588  PVRIEAIPLDDARSFRNLQDAKTTAVFQLESRGMKELIKRLQPDCFEDIIALVALFRPGP 647

Query: 655  IDNIVV--YNNRKNGKEKIVS-----IHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSL 707
            + + +V  + +RK+G+E I        H  +  +L+ T G+I+YQEQVMQIAQ+LSGY+L
Sbjct: 648  LQSGMVDNFIDRKHGREAISYPDEKWQHESLKEILEPTYGIILYQEQVMQIAQVLSGYTL 707

Query: 708  SEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
              AD+LRRAMGKK  EEM KQ+  F  GA KNG+   +A+ IF+L+ KFA YGFNKSH+A
Sbjct: 708  GGADMLRRAMGKKKPEEMAKQRAVFQEGAEKNGVDGELAMKIFDLVEKFAGYGFNKSHSA 767

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
            AYA++SYQT W+KTHYP EF+AA MT +MDN EK+     + +   + ++PP +N+    
Sbjct: 768  AYALVSYQTLWLKTHYPAEFMAAVMTADMDNTEKVVGLVDECKNMGLTVLPPDINSGLYR 827

Query: 828  FKVGDN-RIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESL 885
            F V DN  I Y + AIKGVG      I+EA      F  L DFC+R+D KK+N+RV+E L
Sbjct: 828  FNVDDNGAIVYGIGAIKGVGEGPIEAILEARNKGGYFKDLFDFCARIDLKKVNKRVIEKL 887

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFS 944
            + AGALD  G  R  ++ S+D+  + A    +       ++F        + +    +  
Sbjct: 888  ILAGALDRLGPHRAAMMASVDDAVRAASQHHQAEAFGQADMFGVLTDAPEEVEQKYTQVP 947

Query: 945  VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSK 1004
                 VR E E+  LG Y +GHP+D Y   L K       E+  T R  ++ +A +V++ 
Sbjct: 948  EWPEKVRLEGERETLGLYLTGHPVDEYLKELTKYTSCRLNEAAPTRRDQSLTVAGLVIAA 1007

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            +   T++G+RIG +T  + +   E   +
Sbjct: 1008 RVMTTKRGTRIGLMTLDDRSGRMEVMLY 1035


>gi|183179456|ref|ZP_02957667.1| DNA polymerase III, alpha subunit [Vibrio cholerae MZO-3]
 gi|183012867|gb|EDT88167.1| DNA polymerase III, alpha subunit [Vibrio cholerae MZO-3]
          Length = 1164

 Score =  797 bits (2058), Expect = 0.0,   Method: Composition-based stats.
 Identities = 422/1048 (40%), Positives = 617/1048 (58%), Gaps = 38/1048 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            +   P F+HL++HS +S+++G   +  ++ K+AA   PA+A+TD  NL   ++F   A  
Sbjct: 6    MSD-PKFIHLRIHSDFSMVDGLSKVPPLVKKVAAMGMPAMALTDFTNLCGLVKFYSTAHN 64

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
             G++PIIG    +          Q +     +  + LL     GY+ L  L+S+ YL   
Sbjct: 65   CGVKPIIGADFTL----------QSEEFGDELTKLTLLAKNNVGYKNLTLLISKAYLRGH 114

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYV 184
             +    I  +WL E   EGLI+L+GG SG + RA    + Q  E+ +  ++  F D  Y+
Sbjct: 115  VQHQPVIDKAWLVE-HAEGLIVLSGGKSGEVGRALLKGNQQQVERCIEFYQTHFADHFYL 173

Query: 185  NLQRHRGYDRY-RESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQK 243
             L R    D        + +A  ++LP+VATN  +F++EE +EAH++ +A+     +   
Sbjct: 174  ELIRTGRADEESYLHFALDVAEQYDLPVVATNEVVFITEESFEAHEIRVAIHDGYTLEDP 233

Query: 244  DRPR-VTPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD 302
             RP+  +P  YL++ +EM  +F+D+PEAL N+VEIA+RC+  +++       +       
Sbjct: 234  RRPKNYSPKQYLRSEAEMCELFADIPEALANSVEIAKRCNVTVRLGE-----YFLPNFPT 288

Query: 303  IQKEEENELRNKAVAGLEVRLA---QGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLI 359
                 E+ L  K+  GLE RL         +     +Y +RL  EL+VI +M F GYFLI
Sbjct: 289  GGMAIEDFLVMKSREGLEERLEFLFPDPEVRAKRRPEYDERLQVELDVINQMGFPGYFLI 348

Query: 360  VADFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFD 419
            V +FIQW+K N+IPVGPGRGSGAGS+ AYAL ITD+DPL + LLFERFLNP+R+SMPDFD
Sbjct: 349  VMEFIQWSKDNDIPVGPGRGSGAGSLVAYALKITDLDPLEYDLLFERFLNPERVSMPDFD 408

Query: 420  IDFCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLI 479
            +DFC D+RD+VI +V   YG + V+QIITFG++ AKA +RDVGR L  P+  VDR+ KL+
Sbjct: 409  VDFCMDKRDQVIDHVAEMYGRDAVSQIITFGTMAAKAVIRDVGRVLGHPFGFVDRISKLV 468

Query: 480  PNDPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPL 539
            P DP   +    IA +   +E   AD  V  L++  + LEG  R+A  HA G+VI    +
Sbjct: 469  PPDPGMTLEKAFIA-EPALQELYDADEEVKELIDKCRILEGCTRNAGKHAGGVVISPTAI 527

Query: 540  SQLVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQR-----GV 594
            +   P+Y D   + PVTQF+   +E AGL+KFDFLGL+TLT++  +L  +  R       
Sbjct: 528  TDFAPIYCDAEGNFPVTQFDKNDVETAGLVKFDFLGLRTLTIIDWALGLVNPRLKKAGKP 587

Query: 595  KVDLSLIPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGP 654
             V +  IP DD  ++  L    T  +FQLES GM++ ++ +QPDC EDIIALV+L+RPGP
Sbjct: 588  PVRIEAIPLDDARSFRNLQDAKTTAVFQLESRGMKELIKRLQPDCFEDIIALVALFRPGP 647

Query: 655  IDNIVV--YNNRKNGKEKIVS-----IHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSL 707
            + + +V  + +RK+G+E I        H  +  +L+ T G+I+YQEQVMQIAQ+LSGY+L
Sbjct: 648  LQSGMVDNFIDRKHGREAISYPDEKWQHESLKEILEPTYGIILYQEQVMQIAQVLSGYTL 707

Query: 708  SEADVLRRAMGKKIKEEMDKQKERFISGASKNGISKTIAVNIFELLAKFADYGFNKSHAA 767
              AD+LRRAMGKK  EEM KQ+  F  GA KNG+   +A+ IF+L+ KFA YGFNKSH+A
Sbjct: 708  GGADMLRRAMGKKKPEEMAKQRAVFQEGAEKNGVDGELAMKIFDLVEKFAGYGFNKSHSA 767

Query: 768  AYAVISYQTAWMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVD 827
            AYA++SYQT W+KTHYP EF+AA MT +MDN EK+     + +   + ++PP +N+    
Sbjct: 768  AYALVSYQTLWLKTHYPAEFMAAVMTADMDNTEKVVGLVDECKNMGLTVLPPDINSGLYR 827

Query: 828  FKVGDN-RIYYSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESL 885
            F V DN  I Y + AIKGVG      I+EA      F  L DFC+R+D KK+N+RV+E L
Sbjct: 828  FNVDDNGAIVYGIGAIKGVGEGPIEAILEARNKGGYFKDLFDFCARIDLKKVNKRVIEKL 887

Query: 886  VFAGALDCFGYSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSD-KITLEKFS 944
            + AGALD  G  R  ++ S+D+  + A    +       ++F        + +    +  
Sbjct: 888  ILAGALDRLGPHRAAMMASVDDAVRAASQHHQAEAFGQADMFGVLTDAPEEVEQKYTQVP 947

Query: 945  VENSSVRFENEQRVLGFYFSGHPLDVYKPILRKMGIKGYEESVATIRGNNIRLAAMVVSK 1004
                 VR E E+  LG Y +GHP+D Y   L K       E+  T R  ++ +A +V++ 
Sbjct: 948  EWPEKVRLEGERETLGLYLTGHPVDEYLKELTKYTSCRLNEAAPTRRDQSLTVAGLVIAA 1007

Query: 1005 QQKKTRKGSRIGWVTFSEPAKEYEANFF 1032
            +   T++G+RIG +T  + +   E   +
Sbjct: 1008 RVMTTKRGTRIGLMTLDDRSGRMEVMLY 1035


>gi|323142354|ref|ZP_08077186.1| DNA polymerase III, alpha subunit [Phascolarctobacterium sp. YIT
            12067]
 gi|322413238|gb|EFY04125.1| DNA polymerase III, alpha subunit [Phascolarctobacterium sp. YIT
            12067]
          Length = 1135

 Score =  797 bits (2058), Expect = 0.0,   Method: Composition-based stats.
 Identities = 374/1041 (35%), Positives = 603/1041 (57%), Gaps = 38/1041 (3%)

Query: 5    LEKSPSFVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACA 64
            + K   F HL VH+ YSLL+GA  ++ ++         ++AITD   ++ A+EF Q+   
Sbjct: 1    MTK--RFTHLHVHTEYSLLDGASKIHELVAYAKELGMDSLAITDHGAMYGAVEFYQECTK 58

Query: 65   AGIQPIIGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQ 124
            AGI+PIIGC++ +    +L+  N+G      +  ++LL     GY  L+++VS   L + 
Sbjct: 59   AGIKPIIGCEVYLSKGSHLEKNNRG------MYHLILLAENDTGYHNLMKIVSIGQL-EG 111

Query: 125  GKQSVRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFG-DRLY 183
                 R+    L+    EG+I L+   +G + +    ++ + A + +  +  +FG +  +
Sbjct: 112  FYYKPRVDKDVLRTYH-EGVICLSACVAGEVPQMILQDNLEGARRCIQEYIDIFGKENYF 170

Query: 184  VNLQRHRGYDRYRE-SQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQ 242
            + +Q H   + ++  +++ QLA    L LVATN+  ++ ++D  A D+L+ +  ++ V +
Sbjct: 171  LEIQDHDLDEEHKVSAELKQLAQEFGLGLVATNDLHYVQQKDAAAQDILLCIQTTSTVDE 230

Query: 243  KDRPRVTPD-HYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECD 301
             DR R   D +YLK+  EM ++F D PEAL NT +IA RC+  ++    +LP F   E  
Sbjct: 231  PDRMRFNNDSYYLKSYDEMEALFGDCPEALSNTNKIADRCNVKMEFGHLLLPEFPVPEGF 290

Query: 302  DIQKEEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVA 361
            D      + LR+                     +  R+RLDFEL++I  M ++ YFLIV 
Sbjct: 291  D----AVSYLRHLCEE-------ALPKRYEVVDEKVRKRLDFELDIINTMGYACYFLIVW 339

Query: 362  DFIQWAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDID 421
            DFI + + ++IPVGPGRGS AGS+ AY L IT+I+PLR+ LLFERFLNP+R+SMPD D D
Sbjct: 340  DFINYCRSHDIPVGPGRGSAAGSIVAYLLRITNIEPLRYHLLFERFLNPERVSMPDIDTD 399

Query: 422  FCQDRRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPN 481
            FC  +R++V+ YV  +YG ERVAQIITFG+LQA+AA+RDVG+AL M Y +VD + KLIP 
Sbjct: 400  FCYVKRNQVLDYVVRRYGQERVAQIITFGTLQARAAVRDVGKALGMSYGEVDEIAKLIPR 459

Query: 482  DPAHPVSLQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQ 541
            +    +  +A+     FR+A  + P V +L++++Q +EGL R+A THAAG++I    +  
Sbjct: 460  ELGITLE-KALNGSKDFRQAYDSRPEVKKLIDLAQSVEGLPRNAGTHAAGVIIAPHNMKN 518

Query: 542  LVPMYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRG-VKVDLSL 600
             VP+ +       +TQ++   +E+ GL+K DFLGL+TLT++   + F+ +    +VD+  
Sbjct: 519  YVPLQQGSEGG-VITQYDKNKVEELGLLKMDFLGLRTLTVIGDCIRFIRETTGEEVDIDN 577

Query: 601  IPFDDHETYHLLTTKGTLGIFQLESSGMRQALEGMQPDCIEDIIALVSLYRPGPIDNIV- 659
            IP  D  T  +L    T  +FQLES+G+ + +  + P+  ED+I LV+LYRPGP+   + 
Sbjct: 578  IPLADEATCAMLRRGETACVFQLESAGITKLVMDLAPESFEDLIPLVALYRPGPLGTGMA 637

Query: 660  -VYNNRKNGKEKIVSIHPLIDPMLKETQGVIIYQEQVMQIAQLLSGYSLSEADVLRRAMG 718
              +   ++G+     +HPL++P+LK+T GVI+YQEQVMQI   L+G++L +AD+LRRAMG
Sbjct: 638  EDFIAGRHGQRTAKVLHPLMEPILKDTYGVILYQEQVMQITSALAGFTLGQADILRRAMG 697

Query: 719  KKIKEEMDKQKERFISGASK-NGISKTIAVNIFELLAKFADYGFNKSHAAAYAVISYQTA 777
            KK  +E+D  ++ FI GA K + I + ++  IF LL  FA YGFNKSH+ AYA+++Y+TA
Sbjct: 698  KKKAKELDSMRQSFIDGAKKLHDIPEELSDQIFSLLQHFAGYGFNKSHSVAYALVAYETA 757

Query: 778  WMKTHYPVEFLAASMTLEMDNVEKIKKFCQDARQFNIQIMPPSVNTPCVDFKVGDN-RIY 836
            ++K H+  +F AA +   + + +K+  +    R  N++I+PP VN    +F V  N  I 
Sbjct: 758  YLKAHWRPQFYAAFLNSIIGDADKVSWYINVCRNDNVKILPPDVNESGHNFTVHKNSSIR 817

Query: 837  YSLAAIKGVGTTTARHIMEAS-ADKPFDSLEDFCSRVDSKKLNRRVLESLVFAGALDCFG 895
            + LA IK  G      I+ A     PF SL DFC RV+ + +N+RV+E+++  GA+D FG
Sbjct: 818  FGLAGIKNTGDAAVDAIISARNEGGPFKSLTDFCCRVNMRVVNKRVIENMIKCGAMDSFG 877

Query: 896  YSRMQLLQSLDNIQKYAQWVEKNRTNKHENIFAHEKGTFSDKITLEKFSVENSSVRFENE 955
              R Q+L  ++         ++++ N    +F  +    + +I L         +  +NE
Sbjct: 878  ARRSQMLSIIEQAVDLGAACQRDKANGQLGLFGDDSFGVT-EIKLPPLPEIPKQLILQNE 936

Query: 956  QRVLGFYFSGHPLDVYKPILRKMGIKGYEES---VATIRGNNIRLAAMVVSKQQKKTRKG 1012
            + ++GFY + HPL  YK +L++       +         G  +R+A ++     K T++G
Sbjct: 937  KEIIGFYVTDHPLSDYKQMLQRF--MPLHQFGGETQVQDGQFVRVAGIITDCTIKNTKRG 994

Query: 1013 SRIGWVTFSEPAKEYEANFFP 1033
              +  +T  + +  +    FP
Sbjct: 995  DTMAVLTLEDFSGRFPVIVFP 1015


>gi|110633608|ref|YP_673816.1| DNA polymerase III subunit alpha [Mesorhizobium sp. BNC1]
 gi|110284592|gb|ABG62651.1| DNA polymerase III, alpha subunit [Chelativorans sp. BNC1]
          Length = 1172

 Score =  797 bits (2057), Expect = 0.0,   Method: Composition-based stats.
 Identities = 587/1030 (56%), Positives = 760/1030 (73%), Gaps = 10/1030 (0%)

Query: 11   FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
            F+HL+VHS+YSLLEGAL L  I+     D+ PAIA  DTNNLF ALEF+QKA   GIQPI
Sbjct: 26   FIHLRVHSAYSLLEGALPLGKIIGHALKDEAPAIATADTNNLFGALEFAQKAVKDGIQPI 85

Query: 71   IGCQLDIDMQDNLKMTNQG--KTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQS 128
            IGCQLD+   D      +   +  F     +VL+ +T  GY  L+ L+SR YL ++  + 
Sbjct: 86   IGCQLDVAFDDAFAEARRAASRKSFADYDPLVLIAATEAGYANLVRLMSRAYLDNEAGEP 145

Query: 129  VRICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQR 188
              +   WLQE  +EG+I LTGG  GPI      + +++AE RLL  ++ +GDRLYV L+R
Sbjct: 146  PHVAADWLQE-HSEGIICLTGGPRGPIGAPLKADRAELAEARLLLLRETYGDRLYVELER 204

Query: 189  HRGYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRV 248
             +GYDR  E+  V LAY H+LPLVATN + F + +D++AHD L+A+A  +V++  DR R+
Sbjct: 205  LQGYDRNLEAAAVNLAYRHDLPLVATNEAFFPTRDDFDAHDALIAIAEGSVIASDDRRRL 264

Query: 249  TPDHYLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDD---IQK 305
            TPD+YLK ++EM ++F+DLPEAL+NT+E+ARRCS+  +   PILPRF   E  D     +
Sbjct: 265  TPDNYLKTQAEMAALFADLPEALDNTLEVARRCSYYPKTRKPILPRFTGDEAGDEAAALQ 324

Query: 306  EEENELRNKAVAGLEVRLAQGAIAKGYHAQDYRQRLDFELNVIARMKFSGYFLIVADFIQ 365
             E +ELR +A  GL+ RLA   IA+G+  ++Y  RL++EL VI RMKF GYFLIVADFI+
Sbjct: 325  AEADELRRQAREGLDKRLAIQGIAEGHSEEEYAARLEYELGVIERMKFPGYFLIVADFIK 384

Query: 366  WAKKNNIPVGPGRGSGAGSVTAYALTITDIDPLRFSLLFERFLNPDRMSMPDFDIDFCQD 425
            WAK ++IPVGPGRGSGAGS+ AYALTITDIDPLRFSLLFERFLNPDR+SMPDFDIDFCQD
Sbjct: 385  WAKAHDIPVGPGRGSGAGSLVAYALTITDIDPLRFSLLFERFLNPDRVSMPDFDIDFCQD 444

Query: 426  RRDEVIRYVQNKYGHERVAQIITFGSLQAKAALRDVGRALQMPYSQVDRLCKLIPNDPAH 485
            RR+EVIRYVQ KYG ++V QIITFG+LQA+A LRDVGR LQMPY QVDRLCK++P++PA+
Sbjct: 445  RREEVIRYVQQKYGRDQVGQIITFGTLQARAVLRDVGRVLQMPYGQVDRLCKMVPSNPAN 504

Query: 486  PVS-LQAIADDSRFREARLADPSVDRLLEISQKLEGLYRHASTHAAGIVIGDRPLSQLVP 544
            P    +AI D+ RF E    +P V  LLEI+QKLEGLYRHASTHAAGIVIGDRPLS+LVP
Sbjct: 505  PTPLGKAIEDEPRFAEEVEKEPIVGTLLEIAQKLEGLYRHASTHAAGIVIGDRPLSELVP 564

Query: 545  MYRDVRSDLPVTQFNMKWIEKAGLIKFDFLGLKTLTLLQKSLDFLAQRGVKVDLSLIPFD 604
            MYRD RSD+PVTQFNMKW+E+AGL+KFDFLGLKTLT+L+K++  + +RG+++DLS IP D
Sbjct: 565  MYRDPRSDMPVTQFNMKWVEQAGLVKFDFLGLKTLTVLEK