RPSBLAST alignment of GI: peg_753 and protein with PDBid: 3e38

>3e38_A Two-domain protein containing predicted PHP-like metal-dependent phosphoesterase; YP_001300751.1, structural genomics; 2.20A {Bacteroides vulgatus atcc 8482} Length = 343
 Score = 97.4 bits (241), Expect = 1e-20
 Identities = 35/351 (9%), Positives = 72/351 (20%), Gaps = 56/351 (15%)

Query: 11  FVHLQVHSSYSLLEGALSLNNILDKIAADQQPAIAITDTNNLFSALEFSQKACAAGIQPI 70
                +HS +S  +G +     +D+   D   AI++T+        +             
Sbjct: 20  KCDFHMHSVFS--DGLVWPTVRVDEAYRDGLDAISLTEHIEYRPHKQDVVSDHNRSFDLC 77

Query: 71  IGCQLDIDMQDNLKMTNQGKTPFPTVPSIVLLVSTAEGYQRLIELVSRMYLLDQGKQSVR 130
                 + +                       ++ A        +               
Sbjct: 78  REQAEKLGILLIKG----------------SEITRAMAPGHFNAIFLSDS---------- 111

Query: 131 ICLSWLQEIGTEGLIMLTGGSSGPIDRAFFFNSSQVAEKRLLTFKKLFGDRLYVNLQRHR 190
             L               G         +         K       L+ +     ++   
Sbjct: 112 NPLEQKDYKDAFREAKKQGAFMFWNHPGWDSQQPD-TTKWWPEHTALYQEGCMHGIEVA- 169

Query: 191 GYDRYRESQVVQLAYTHELPLVATNNSLFLSEEDYEAHDVLMAVAHSTVVSQKDRPRVTP 250
                   + +Q      L ++ T++     + DY+           T V  K+R     
Sbjct: 170 -NGHLYMPEAIQWCLDKNLTMIGTSDIHQPIQTDYDFEK--GEHRTMTFVFAKERSLQGI 226

Query: 251 DH-------YLKNRSEMVSIFSDLPEALENTVEIARRCSFILQVHAPILPRFIEKECDDI 303
                           ++     L    E  V+I         V   I            
Sbjct: 227 REALDNRRTAAYFHELLIGREDLLRPFFEKCVKIEEVSRNEQGVTLSITNVT-------- 278

Query: 304 QKEEENELRNKAVAGLEVR------LAQGAIAKGYHAQDYRQRLDFELNVI 348
             +   +L+  A   L V                   +   +  D    V 
Sbjct: 279 --DLVLKLKKTAHDTLLVYFRDMTLKPHTRYTVRIGFKQGIKGGDVNFEVT 327