RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= 537021.9.peg.754_1 (184 letters) >gnl|CDD|37847 KOG2636, KOG2636, KOG2636, Splicing factor 3a, subunit 3 [RNA processing and modification]. Length = 497 Score = 28.8 bits (64), Expect = 0.82 Identities = 17/57 (29%), Positives = 24/57 (42%), Gaps = 1/57 (1%) Query: 16 KKPDGNHDFLFLEDCYDHAIEMKLQEAEEDPNFLSLQEQQQLEEEKPRLLREKKPYI 72 +G FL L DCY I +K E + +L +Q + K + RE YI Sbjct: 130 SGEEGYGRFLDLHDCYRKYINLKNVERVDYLEYLKNFDQLD-DIPKEKKNREYLNYI 185 >gnl|CDD|35383 KOG0161, KOG0161, KOG0161, Myosin class II heavy chain [Cytoskeleton]. Length = 1930 Score = 27.5 bits (61), Expect = 2.4 Identities = 17/76 (22%), Positives = 33/76 (43%), Gaps = 1/76 (1%) Query: 35 IEMKLQEAEEDPNFLSLQEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDSIRLLWVE 94 IE +LQE +E+ L Q+QLE + L E + + + KL + + + ++ Sbjct: 1563 IERRLQEKDEEIEELRKNLQRQLESLQAELEAETRSKSEALRSKKKLEGDINELE-IQLD 1621 Query: 95 SLEKKSMEMLDSLRVY 110 K + + L+ Sbjct: 1622 HANKANEDAQKQLKKL 1637 >gnl|CDD|177026 CHL00094, dnaK, heat shock protein 70. Length = 621 Score = 26.6 bits (59), Expect = 3.7 Identities = 27/88 (30%), Positives = 44/88 (50%), Gaps = 9/88 (10%) Query: 35 IEMKLQEAEEDPNFLSLQEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRD---SIRLL 91 I++K Q AE L Q ++QL+E K ++ EKK I + ++ + +LQ D SI+ L Sbjct: 528 IDLKNQ-AES----LCYQAEKQLKELKDKISEEKKEKIENLIKKLRQALQNDNYESIKSL 582 Query: 92 WVESLEKKSMEMLDSLRVYLQDRSPLRE 119 +E L+K ME+ + P Sbjct: 583 -LEELQKALMEIGKEVYSSTSTTDPASN 609 >gnl|CDD|37434 KOG2223, KOG2223, KOG2223, Uncharacterized conserved protein, contains TBC domain [Signal transduction mechanisms, General function prediction only]. Length = 586 Score = 26.2 bits (57), Expect = 5.0 Identities = 12/58 (20%), Positives = 27/58 (46%) Query: 52 QEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDSIRLLWVESLEKKSMEMLDSLRV 109 + ++ +++ K R +E K +V + ++L + +W + +ML S RV Sbjct: 237 EYEEIVKQAKKRERKEAKERKKMVEERNRLEERIAYAVNVWENEILPNWEDMLKSRRV 294 >gnl|CDD|48576 cd03027, GRX_DEP, Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions. GRX is a glutathione (GSH) dependent reductase containing a redox active CXXC motif in a TRX fold. It has preference for mixed GSH disulfide substrates, in which it uses a monothiol mechanism where only the N-terminal cysteine is required. By altering the redox state of target proteins, GRX is involved in many cellular functions.. Length = 73 Score = 26.4 bits (58), Expect = 5.4 Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 3/43 (6%) Query: 142 FLRSQGKIEIEITLDHYPISPEIAFDLEHITGITKVVQVIHNE 184 FLR +G +EI +D +P E +LE TG + V Q+ NE Sbjct: 20 FLREKGLPYVEINIDIFP---ERKAELEERTGSSVVPQIFFNE 59 >gnl|CDD|32960 COG3146, COG3146, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 387 Score = 25.6 bits (56), Expect = 8.8 Identities = 12/27 (44%), Positives = 13/27 (48%), Gaps = 4/27 (14%) Query: 21 NHDFLFLEDCY----DHAIEMKLQEAE 43 +H FL E CY D AI LQ E Sbjct: 300 DHPFLHFEVCYYQAIDFAIAEGLQRFE 326 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.318 0.138 0.389 Gapped Lambda K H 0.267 0.0793 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 2,311,298 Number of extensions: 118991 Number of successful extensions: 402 Number of sequences better than 10.0: 1 Number of HSP's gapped: 400 Number of HSP's successfully gapped: 42 Length of query: 184 Length of database: 6,263,737 Length adjustment: 88 Effective length of query: 96 Effective length of database: 4,362,145 Effective search space: 418765920 Effective search space used: 418765920 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 54 (24.5 bits)