RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= 537021.9.peg.754_1 (184 letters) >d1qwla_ e.5.1.1 (A:) Catalase I {Helicobacter pylori [TaxId: 210]} Length = 491 Score = 29.1 bits (65), Expect = 0.25 Identities = 15/94 (15%), Positives = 29/94 (30%), Gaps = 19/94 (20%) Query: 42 AEEDPNFLSLQEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDSIRLLWVESLEKKSM 101 + DP+ + + K I V+ +ED +K Sbjct: 235 RKHDPDSNQRDLFDAIARGDYP---KWKLSIQVMPEED----------------AKKYRF 275 Query: 102 EMLDSLRVYLQDRSPLREIHKYFENRQTQNYDKQ 135 D +++ PL E+ N+ +NY + Sbjct: 276 HPFDVTKIWYTQDYPLMEVGIVELNKNPENYFAE 309 >d1qd9a_ d.79.1.1 (A:) Purine regulatory protein YabJ {Bacillus subtilis [TaxId: 1423]} Length = 124 Score = 27.0 bits (59), Expect = 0.88 Identities = 9/55 (16%), Positives = 22/55 (40%) Query: 100 SMEMLDSLRVYLQDRSPLREIHKYFENRQTQNYDKQGKIGLIFLRSQGKIEIEIT 154 S E + V++ D E+++ + + + + + L +EIE+ Sbjct: 66 SFETVVKATVFIADMEQFAEVNEVYGQYFDTHKPARSCVEVARLPKDALVEIEVI 120 >d1e93a_ e.5.1.1 (A:) Catalase I {Proteus mirabilis [TaxId: 584]} Length = 476 Score = 27.2 bits (60), Expect = 0.98 Identities = 8/44 (18%), Positives = 15/44 (34%) Query: 94 ESLEKKSMEMLDSLRVYLQDRSPLREIHKYFENRQTQNYDKQGK 137 + D +V+ PL ++ + NR NY + Sbjct: 263 KEASTVPYNPFDLTKVWPHADYPLMDVGYFELNRNPDNYFSDVE 306 >d1p80a2 e.5.1.1 (A:27-597) Catalase II {Escherichia coli, HPII [TaxId: 562]} Length = 571 Score = 26.5 bits (58), Expect = 1.4 Identities = 8/39 (20%), Positives = 19/39 (48%) Query: 97 EKKSMEMLDSLRVYLQDRSPLREIHKYFENRQTQNYDKQ 135 K ++LD ++ ++ P++ + K NR N+ + Sbjct: 321 FKFDFDLLDPTKLIPEELVPVQRVGKMVLNRNPDNFFAE 359 >d1dgfa_ e.5.1.1 (A:) Catalase I {Human (Homo sapiens) [TaxId: 9606]} Length = 497 Score = 26.0 bits (57), Expect = 1.8 Identities = 17/94 (18%), Positives = 28/94 (29%), Gaps = 19/94 (20%) Query: 42 AEEDPNFLSLQEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDSIRLLWVESLEKKSM 101 ++EDP++ + K YI V++ E Sbjct: 250 SQEDPDYGIRDLFNAIATGKYP---SWTFYIQVMTFNQ----------------AETFPF 290 Query: 102 EMLDSLRVYLQDRSPLREIHKYFENRQTQNYDKQ 135 D +V+ PL + K NR NY + Sbjct: 291 NPFDLTKVWPHKDYPLIPVGKLVLNRNPVNYFAE 324 >d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 279 Score = 25.6 bits (56), Expect = 2.5 Identities = 30/112 (26%), Positives = 45/112 (40%), Gaps = 23/112 (20%) Query: 52 QEQQQLEEEKPRLLREKKPYIIVVSQEDKLSLQRDSIRLLWVESLEKKSMEMLDSLRVYL 111 QE+ E K L+ KK +++V D + DS + S + K L +Y Sbjct: 180 QERGVNESYKKNLMALKK-FVMVKFLNDTIVDPVDSEWFGFYRSGQAKETIPLQESTLYT 238 Query: 112 QDRSPLREIHKYFENRQTQNYDKQGKIGLIFLRSQGKIEIEITLDHYPISPE 163 QDR L+ + DK G+ L+FL +G DH +S E Sbjct: 239 QDRLGLKAM------------DKAGQ--LVFLALEG--------DHLQLSEE 268 >d1k7ha_ c.76.1.1 (A:) Alkaline phosphatase {Northern shrimp (Pandalus borealis) [TaxId: 6703]} Length = 476 Score = 25.1 bits (54), Expect = 3.7 Identities = 10/33 (30%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Query: 43 EEDPNFLSLQEQQQLEEEKPRLLREKKP-YIIV 74 EED + + Q L+++ LREK+ +I Sbjct: 1 EEDKAYWNKDAQDALDKQLGIKLREKQAKNVIF 33 >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} Length = 211 Score = 24.0 bits (51), Expect = 9.5 Identities = 5/18 (27%), Positives = 15/18 (83%) Query: 59 EEKPRLLREKKPYIIVVS 76 +++P+++ +K PY+I++ Sbjct: 1 DKEPKVIPDKIPYVIMLV 18 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.318 0.138 0.389 Gapped Lambda K H 0.267 0.0443 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 700,850 Number of extensions: 33179 Number of successful extensions: 86 Number of sequences better than 10.0: 1 Number of HSP's gapped: 84 Number of HSP's successfully gapped: 15 Length of query: 184 Length of database: 2,407,596 Length adjustment: 80 Effective length of query: 104 Effective length of database: 1,309,196 Effective search space: 136156384 Effective search space used: 136156384 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 50 (23.8 bits)