BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.759_1
         (58 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done



>gi|302870501|ref|YP_003839138.1| type IV secretory pathway VirB4 components-like [Micromonospora
            aurantiaca ATCC 27029]
 gi|302573360|gb|ADL49562.1| type IV secretory pathway VirB4 components-like [Micromonospora
            aurantiaca ATCC 27029]
          Length = 1625

 Score = 35.4 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 17/40 (42%), Positives = 25/40 (62%), Gaps = 1/40 (2%)

Query: 2    AKDIAALLIRRT-TGEIEWQEVYIEFSPTPTDFKNHYPDE 40
            A+++AAL   RT TG +EW  V + F P   +F  HYP++
Sbjct: 1106 AEELAALEAFRTGTGTLEWAGVGLVFGPKVEEFHRHYPNK 1145


  Database: nr
    Posted date:  May 13, 2011  4:10 AM
  Number of letters in database: 999,999,932
  Number of sequences in database:  2,987,209
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 13, 2011  4:17 AM
  Number of letters in database: 999,998,956
  Number of sequences in database:  2,896,973
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 13, 2011  4:23 AM
  Number of letters in database: 999,999,979
  Number of sequences in database:  2,907,862
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 13, 2011  4:29 AM
  Number of letters in database: 999,999,513
  Number of sequences in database:  2,932,190
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 13, 2011  4:33 AM
  Number of letters in database: 792,586,372
  Number of sequences in database:  2,260,650
  
Lambda     K      H
   0.319    0.137    0.411 

Lambda     K      H
   0.267   0.0424    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 634,480,505
Number of Sequences: 13984884
Number of extensions: 21315659
Number of successful extensions: 35422
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 35422
Number of HSP's gapped (non-prelim): 1
length of query: 58
length of database: 4,792,584,752
effective HSP length: 31
effective length of query: 27
effective length of database: 4,359,053,348
effective search space: 117694440396
effective search space used: 117694440396
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 76 (33.8 bits)