BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.759_1 (58 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.759_1 Length = 58 Score = 122 bits (305), Expect = 1e-30, Method: Compositional matrix adjust. Identities = 58/58 (100%), Positives = 58/58 (100%) Query: 1 MAKDIAALLIRRTTGEIEWQEVYIEFSPTPTDFKNHYPDEKFAIFFLNEEGFKQAKND 58 MAKDIAALLIRRTTGEIEWQEVYIEFSPTPTDFKNHYPDEKFAIFFLNEEGFKQAKND Sbjct: 1 MAKDIAALLIRRTTGEIEWQEVYIEFSPTPTDFKNHYPDEKFAIFFLNEEGFKQAKND 58 >gi|254780536|ref|YP_003064949.1| acyl-carrier-protein S-malonyltransferase [Candidatus Liberibacter asiaticus str. psy62] Length = 314 Score = 23.5 bits (49), Expect = 0.63, Method: Composition-based stats. Identities = 8/24 (33%), Positives = 15/24 (62%) Query: 4 DIAALLIRRTTGEIEWQEVYIEFS 27 +I+ LL+ + TG + W+E F+ Sbjct: 244 EISRLLVEQVTGRVRWRETIQWFA 267 >gi|254780757|ref|YP_003065170.1| glycyl-tRNA synthetase subunit alpha [Candidatus Liberibacter asiaticus str. psy62] Length = 307 Score = 21.6 bits (44), Expect = 3.0, Method: Composition-based stats. Identities = 7/21 (33%), Positives = 11/21 (52%) Query: 12 RTTGEIEWQEVYIEFSPTPTD 32 R G + W+ Y++ S P D Sbjct: 51 RALGPLSWKAAYVQPSRRPLD 71 >gi|254780306|ref|YP_003064719.1| DNA topoisomerase I [Candidatus Liberibacter asiaticus str. psy62] Length = 837 Score = 21.2 bits (43), Expect = 3.6, Method: Compositional matrix adjust. Identities = 7/14 (50%), Positives = 11/14 (78%) Query: 13 TTGEIEWQEVYIEF 26 +TG++ W+EV EF Sbjct: 548 STGKLNWKEVLHEF 561 >gi|254780608|ref|YP_003065021.1| ribosomal large subunit pseudouridine synthase C [Candidatus Liberibacter asiaticus str. psy62] Length = 346 Score = 20.8 bits (42), Expect = 4.1, Method: Composition-based stats. Identities = 7/10 (70%), Positives = 7/10 (70%) Query: 33 FKNHYPDEKF 42 FKNHYP F Sbjct: 25 FKNHYPHINF 34 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.319 0.137 0.411 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 40,188 Number of Sequences: 1233 Number of extensions: 1266 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 58 length of database: 328,796 effective HSP length: 30 effective length of query: 28 effective length of database: 291,806 effective search space: 8170568 effective search space used: 8170568 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)