HHsearch alignment for GI: peg_788 and conserved domain: TIGR03434

>TIGR03434 ADOP Acidobacterial duplicated orphan permease. Members of this protein family are found, so far, only in three species of Acidobacteria, namely Acidobacteria bacterium Ellin345, Acidobacterium capsulatum ATCC 51196, and Solibacter usitatus Ellin6076, where they form large paralogous families. Each protein contains two copies of a domain called the efflux ABC transporter permease protein (pfam02687). However, unlike other members of that family (including LolC, FtsX, and MacB), genes for these proteins are essentially never found fused or adjacent to ABC transporter ATP-binding protein (pfam00005) genes. We name this family ADOP, for Acidobacterial Duplicated Orphan Permease, to reflect the restricted lineage, internal duplication, lack of associated ATP-binding cassette proteins, and permease homology. The function is unknown.
Probab=99.27  E-value=8.5e-11  Score=80.45  Aligned_cols=212  Identities=14%  Similarity=0.134  Sum_probs=105.7

Q ss_pred             HHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCC--CEEECCC------CCCC
Q ss_conf             999999875225545468999999999999999999999999876999996311102-453--0000000------0012
Q 537021.9.peg.7    8 EVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGI-NGH--VVIQQKY------YPLV   78 (270)
Q Consensus         8 ~~~iA~R~l~~~k~r~~~~~is~ls~lgI~igv~~li~~lsv~~G~~~~i~~~i~~~-~~~--i~i~~~~------~~~~   78 (270)
T Consensus         4 dlK~A~R~L~k~k~~s~------inI~gLalGi~~~~~if~~v~~~---~~~-~l~y~~~dri~~v~~~~~~~~~~~~~~   73 (803)
T TIGR03434         4 DLRYALRTLRRSPGFTA------VAVLTLALGIGANTAIFSVVNAV---LLR-PLPYPDPDRLVALWERGPGAGSPGGNF   73 (803)
T ss_pred             HHHHHHHHHHHCHHHHH------HHHHHHHHHHHHHHHHHHHHHHH---HCC-CCCCCCCCEEEEEEEECCCCCCCCCCC
T ss_conf             89999999987748899------99999999999999999999999---556-889898451899998778888788888


Q ss_pred             CHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHCCCCCCC----CCCCCCCCCCHH
Q ss_conf             1366655542264103466542001111122233221011124310000012001100277542----111123421013
Q 537021.9.peg.7   79 DYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSN----DFDRGKGVIIGK  154 (270)
Q Consensus        79 ~~~~~~~~l~~~~~V~~~~p~i~~~~~i~~~~~~~~~v~i~Gv~~~~~~~~~~~~~~~~~~~~~----~~~~~~~iiiG~  154 (270)
T Consensus        74 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~vd~~fF~~f~~~--~l~Gr~~~~~~~~~~~~~~vvlS~  150 (803)
T TIGR03434        74 SYPDYEDWRAQNRSFSSLAAYSGASFNLTG-GGEPERVRGALVSANFFPVLGVQ--PALGRLFTPEDDRPGAPPVVVLSY  150 (803)
T ss_pred             CHHHHHHHHHHCHHHHHHHEEECCEEEECC-CCCCEEEEEEEECCCHHHHCCCC--CCCCCCCCCCHHCCCCCCEEEECH
T ss_conf             978999999846167776704132058606-88744877899985369775986--025888895001369999899829


Q ss_pred             HHHHHH-H-CC--CCCEEEECCCCCCCCCCCCCCCCCCCCCCEEEEEECCCC-CCCEEEEEHHHHHHHCCCCC---CEEE
Q ss_conf             454554-2-13--332023113442100012211000012210233102445-55168985488999718998---7107
Q 537021.9.peg.7  155 DLARNL-G-IS--IGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDY-DNGMVYMSLQEAQLYFNLEN---AVSG  226 (270)
Q Consensus       155 ~lA~~L-~-l~--vGD~i~l~~~~~~~~~~~~~~~~~~f~V~GI~~sg~~~~-D~~~v~~~l~~~q~l~~~~~---~~~~  226 (270)
T Consensus       151 ~~a~k~Fg~d~~~iGkti~~--------------~~~~~~V~GV~p~~~~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~  216 (803)
T TIGR03434       151 ALWQRRFGGDPAVVGRTIRL--------------NGRPYTVVGVMPPGFRFPGRDPDVWVPLAMDPALLAGADRGSHWLR  216 (803)
T ss_pred             HHHHHHHCCCCCCCCCEEEE--------------CCEEEEEEEEECCCCCCCCCCCEEEEECCCCCCCCCCCCCCCCEEE
T ss_conf             99999838992004887999--------------9977899999779878889885499987444100245788870289


Q ss_pred             EEEEECCHHHHHHHHHHHHH
Q ss_conf             99995698899999999998
Q 537021.9.peg.7  227 IEVFVKDPDAIEKTHENIVR  246 (270)
Q Consensus       227 i~i~l~d~~~~~~~~~~i~~  246 (270)
T Consensus       217 ~~~~L~~g~~~~~~~~~l~~  236 (803)
T TIGR03434       217 VIGRLKPGVTLAQAQAELDA  236 (803)
T ss_pred             EEEEECCCCCHHHHHHHHHH
T ss_conf             99996899999999999999