BLAST/PSIBLAST alignment of GI: peg_788 and GI: 307301112 at iteration 1
>gi|307301112|ref|ZP_07580881.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Sinorhizobium meliloti BL225C] Length = 437
>gi|307317845|ref|ZP_07597283.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Sinorhizobium meliloti AK83] Length = 437
>gi|306896607|gb|EFN27355.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Sinorhizobium meliloti AK83] Length = 437
>gi|306904067|gb|EFN34653.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Sinorhizobium meliloti BL225C] Length = 437
 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/266 (44%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL S RK AFIS+ +  SFIG+M+GV  LI+VM+VMNGFR ++I R+LG
Sbjct: 24  FSAFERMVAWRYLRSRRKEAFISVIAGFSFIGIMLGVGTLIIVMAVMNGFRTELISRILG 83

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL +Y  +A R   +P V   +P V GQ    GL    +G LVRGI  
Sbjct: 84  MNGHMIVQPLDGPLTNYADLATRFSAVPGVTMAIPIVEGQVLAQGLGDASTGALVRGIRA 143

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L++            F  G GV IG  +A  LGI +G  I + SP GDVTPMGM 
Sbjct: 144 DDLTKLKSISEHIQSGDLVGFASGSGVAIGSRMAEQLGIRVGGTITLTSPNGDVTPMGMN 203

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+YTV  +F M   +YD  +++M L+EAQLYFN E  V  IE+F + PDA+++  + 
Sbjct: 204 PRVKAYTVSAIFEMGMSEYDATIIFMPLEEAQLYFNAEGLVQSIEIFAEHPDAVDELRKP 263

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  + + DW++R + FFS  E
Sbjct: 264 VEDAAGRQIFITDWRERNRTFFSALE 289