BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= 537021.9.peg.788_1
         (270 letters)

Database: nr 
           13,984,884 sequences; 4,792,584,752 total letters

Searching..................................................done


Results from round 1


>gi|315122708|ref|YP_004063197.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Candidatus Liberibacter solanacearum CLso-ZC1]
 gi|313496110|gb|ADR52709.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Candidatus Liberibacter solanacearum CLso-ZC1]
          Length = 416

 Score =  407 bits (1046), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/269 (71%), Positives = 233/269 (86%), Gaps = 1/269 (0%)

Query: 1   MSIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKR 60
           M  FSRFEV +AWRYLFS RK +FISIAS +SFIGVMIGVMALIVVMSVMNGFR DMIKR
Sbjct: 1   MIFFSRFEVAIAWRYLFSRRKESFISIASSVSFIGVMIGVMALIVVMSVMNGFRADMIKR 60

Query: 61  VLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           +LGINGH++IQQKYYPLVDYQ ++ +L  IPDV +V PFV+GQAF+S ++S GSGV VRG
Sbjct: 61  ILGINGHIIIQQKYYPLVDYQSLSKKLSSIPDVTQVSPFVTGQAFISSMNSRGSGVSVRG 120

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           IS+ DFS+++ SFSRFYG + NDFD+GKG++IG+DLAR LGISIGDKI ILSPYGD+TP+
Sbjct: 121 ISSKDFSHIKKSFSRFYGGL-NDFDQGKGIVIGEDLARVLGISIGDKIKILSPYGDITPL 179

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G+G RSKSYTV  +F++R PDYD+GM+YM L+EAQLYFN+ENAVSGIE+FVKDPD IEK+
Sbjct: 180 GIGTRSKSYTVSAIFQIRIPDYDSGMIYMPLEEAQLYFNIENAVSGIEIFVKDPDMIEKS 239

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +NI+ I GN V ++DWQQRYQ+FF   +
Sbjct: 240 RKNIIDIFGNDVSIVDWQQRYQMFFYAMQ 268


>gi|150396142|ref|YP_001326609.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Sinorhizobium medicae WSM419]
 gi|150027657|gb|ABR59774.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Sinorhizobium medicae WSM419]
          Length = 436

 Score =  250 bits (638), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/266 (45%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL S RK AFIS+ +  SFIG+M+GV  LI+VM+VMNGFR ++I R+LG
Sbjct: 23  FSAFERMVAWRYLRSRRKEAFISVIAGFSFIGIMLGVGTLIIVMAVMNGFRTELISRILG 82

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL +Y  +A R   +P V   +P V GQ    G     +G LVRGI  
Sbjct: 83  MNGHMIVQPLDGPLTNYADLATRFSAVPGVTMAIPIVEGQVLAQGFGDASTGALVRGIRA 142

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L++   +        F  G GV IG  +A  LGI +G  I + SP GDVTPMGM 
Sbjct: 143 DDLTKLKSVSEKIQAGDLVGFASGSGVAIGSRMAEQLGIRVGGTITLTSPNGDVTPMGMN 202

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K YTV  +F M   +YD  +++M L+EAQLYFN E  V  IE+FV+ PDA++   E 
Sbjct: 203 PRVKGYTVSAIFEMGMSEYDATIIFMPLEEAQLYFNAEGLVQSIELFVEHPDAVDTLREP 262

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           + +  G  + + DW++R + FFS  E
Sbjct: 263 VEKAAGRQIFITDWRERNRTFFSALE 288


>gi|209548883|ref|YP_002280800.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhizobium leguminosarum bv. trifolii WSM2304]
 gi|209534639|gb|ACI54574.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhizobium leguminosarum bv. trifolii WSM2304]
          Length = 434

 Score =  248 bits (632), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 119/270 (44%), Positives = 169/270 (62%), Gaps = 8/270 (2%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL + RK AFIS+ +  SF+G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 21  FSTFERLVAWRYLRARRKEAFISVIAGFSFVGIMLGVATLIIVMAVMNGFRTELVSRILG 80

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    P  DY  +++RL  +P V   LP V GQ   S  + G +G LVRG   
Sbjct: 81  INGHMIVQPSDGPFTDYADLSSRLAAVPGVKMALPLVEGQVLASAQAGGSTGALVRGARA 140

Query: 124 SDFSYLQNSFSRFYGNVSN----DFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
            D + L+       GN+ +     F  G+GV+IG  +A  LG+S+GD I + SP GD+TP
Sbjct: 141 EDLTKLKT----ISGNIKSGDMVGFASGQGVLIGTGMANQLGLSVGDLITLTSPDGDITP 196

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           MG+  R KSY + G+F +   +YD+ +++M L+EAQLYFN E  V  IE+FV  PD I+ 
Sbjct: 197 MGVSPRVKSYKISGLFEIGMSEYDSSIIFMPLEEAQLYFNAEGLVQSIELFVDHPDDIDT 256

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    G  + + DW+QR Q FFS  +
Sbjct: 257 LRPKVEEAAGRQINLTDWRQRNQTFFSALQ 286


>gi|307301112|ref|ZP_07580881.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Sinorhizobium meliloti BL225C]
 gi|307317845|ref|ZP_07597283.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Sinorhizobium meliloti AK83]
 gi|306896607|gb|EFN27355.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Sinorhizobium meliloti AK83]
 gi|306904067|gb|EFN34653.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Sinorhizobium meliloti BL225C]
          Length = 437

 Score =  247 bits (630), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 119/266 (44%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL S RK AFIS+ +  SFIG+M+GV  LI+VM+VMNGFR ++I R+LG
Sbjct: 24  FSAFERMVAWRYLRSRRKEAFISVIAGFSFIGIMLGVGTLIIVMAVMNGFRTELISRILG 83

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL +Y  +A R   +P V   +P V GQ    GL    +G LVRGI  
Sbjct: 84  MNGHMIVQPLDGPLTNYADLATRFSAVPGVTMAIPIVEGQVLAQGLGDASTGALVRGIRA 143

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L++            F  G GV IG  +A  LGI +G  I + SP GDVTPMGM 
Sbjct: 144 DDLTKLKSISEHIQSGDLVGFASGSGVAIGSRMAEQLGIRVGGTITLTSPNGDVTPMGMN 203

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+YTV  +F M   +YD  +++M L+EAQLYFN E  V  IE+F + PDA+++  + 
Sbjct: 204 PRVKAYTVSAIFEMGMSEYDATIIFMPLEEAQLYFNAEGLVQSIEIFAEHPDAVDELRKP 263

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  + + DW++R + FFS  E
Sbjct: 264 VEDAAGRQIFITDWRERNRTFFSALE 289


>gi|222148296|ref|YP_002549253.1| ABC transporter membrane spanning protein [Agrobacterium vitis S4]
 gi|221735284|gb|ACM36247.1| ABC transporter membrane spanning protein [Agrobacterium vitis S4]
          Length = 435

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/266 (44%), Positives = 164/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL + RK A IS+ +  SF+G+M+GV  LI+VM+VMNGFR ++I R+LG
Sbjct: 22  FSAFERMVAWRYLRARRKEAVISVIAGFSFVGIMLGVATLIIVMAVMNGFRTELISRILG 81

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    P  D+  +A +   +P V   LP V GQ   SG    G+G LVRGI  
Sbjct: 82  INGHMIVQPVDSPFTDFADLAKKFSAVPGVTMALPLVEGQTLASGKGGAGTGALVRGIRP 141

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   +         F  G+GV+IG  +A +LG+  GD I ++SP GDVTPMG+ 
Sbjct: 142 DDLLKLKEVAANIKTGDMVGFTSGQGVLIGSRMANDLGLQAGDSITLVSPEGDVTPMGVN 201

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R KSY + G F +   +YD+ ++YM L+E+QLYFN E  V  IE+FV +PD I++    
Sbjct: 202 PRVKSYKISGTFEIGMSEYDSSIIYMPLEESQLYFNAEGVVQSIELFVTNPDDIDELRPK 261

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  V + DW+QR Q FFS  +
Sbjct: 262 VEAAAGRQVFISDWRQRNQTFFSALQ 287


>gi|218682656|ref|ZP_03530257.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhizobium etli CIAT 894]
          Length = 421

 Score =  245 bits (626), Expect = 4e-63,   Method: Compositional matrix adjust.
 Identities = 116/266 (43%), Positives = 166/266 (62%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL + RK AFIS+ +  SF+G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 8   FSTFERLVAWRYLRARRKEAFISVIAGFSFVGIMLGVATLIIVMAVMNGFRTELVSRILG 67

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    P  DY  +A+RL  +P V   LP V GQ   S  + G +G LVRG+  
Sbjct: 68  INGHMIVQPSDGPFTDYADLASRLGAVPGVKMALPLVEGQVLASAQAGGSTGALVRGVRA 127

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L+             F  G+GV+IG  +A  LG+S+GD I + SP GD+TPMG+ 
Sbjct: 128 EDLTKLKAVSENIKPGDMVGFASGQGVLIGTGMATQLGLSVGDLITLTSPDGDITPMGVS 187

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R KSY + G+F +   +YD+ +++M L+E+QL+FN E  V  IE+FV  P  I+     
Sbjct: 188 PRVKSYKISGLFEIGMSEYDSSIIFMPLEESQLFFNAEGLVQSIELFVDHPGDIDTLRPK 247

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +V   G  + + DW+QR Q FFS  +
Sbjct: 248 VVEAAGRQINLTDWRQRNQTFFSALQ 273


>gi|327194828|gb|EGE61662.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhizobium etli CNPAF512]
          Length = 434

 Score =  245 bits (625), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 117/270 (43%), Positives = 168/270 (62%), Gaps = 8/270 (2%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL + RK AFIS+ +  SF+G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 21  FSTFERLVAWRYLRARRKEAFISVIAGFSFVGIMLGVATLIIVMAVMNGFRTELVSRILG 80

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    P  DY  + +RL  +P V   LP V GQ   S  + G +G LVRG   
Sbjct: 81  INGHMIVQPSDGPFTDYADLTSRLAAVPGVKMALPLVEGQVLASAQAGGSTGALVRGARA 140

Query: 124 SDFSYLQNSFSRFYGNVSN----DFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
            D + L+       GN+ +     F  G+GV+IG  +A  LG+S+GD I + SP GD+TP
Sbjct: 141 EDLTKLKT----ISGNIKSGDMVGFASGQGVLIGTGMATQLGLSVGDLITLTSPDGDITP 196

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           MG+  R KSY + G+F +   +YD+ +++M L+E+QL+FN E  V  IE+FV  PD I+ 
Sbjct: 197 MGVSPRVKSYKISGLFEIGMSEYDSSIIFMPLEESQLFFNAEGLVQSIELFVDHPDDIDA 256

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    G  + + DW+QR Q FFS  +
Sbjct: 257 LRSKVEEAAGRQINLTDWRQRNQTFFSALQ 286


>gi|241204107|ref|YP_002975203.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhizobium leguminosarum bv. trifolii WSM1325]
 gi|240857997|gb|ACS55664.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhizobium leguminosarum bv. trifolii WSM1325]
          Length = 434

 Score =  243 bits (621), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 114/266 (42%), Positives = 164/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL + RK AFIS+ +  SF+G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 21  FSTFERLVAWRYLRARRKEAFISVIAGFSFVGIMLGVATLIIVMAVMNGFRTELVSRILG 80

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    P  DY  ++++L  +P V   LP V GQ   S  + G +G LVRG   
Sbjct: 81  INGHMIVQPVDGPFTDYPVLSSKLAAVPGVKMALPLVEGQVLASAQAGGSTGALVRGARA 140

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L+             +  G+GV+IG  +A  LG+ +GD I + SP GD+TPMG+ 
Sbjct: 141 EDLTKLKTISDNIKSGDMVGYASGQGVLIGTRMADQLGLRVGDLITLTSPDGDITPMGVS 200

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R KSY + G+F +   +YD+ +++M L+EAQLYFN E  V  IE+FV  PD I+     
Sbjct: 201 PRIKSYKISGLFEIGMSEYDSSIIFMPLEEAQLYFNAEGLVQSIELFVDHPDDIDNLRPK 260

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  + + DW+QR Q FFS  +
Sbjct: 261 VEEAAGRQIAITDWRQRNQTFFSALQ 286


>gi|116251486|ref|YP_767324.1| transmembrane component of ABC transporter [Rhizobium leguminosarum
           bv. viciae 3841]
 gi|115256134|emb|CAK07215.1| putative transmembrane component of ABC transporter [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 434

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 114/266 (42%), Positives = 164/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL + RK AFIS+ +  SF+G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 21  FSTFERLVAWRYLRARRKEAFISVIAGFSFVGIMLGVATLIIVMAVMNGFRTELVSRILG 80

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    P  DY  ++++L  +P V   LP V GQ   S  + G +G LVRG   
Sbjct: 81  INGHMIVQPVDGPFTDYPALSSKLAGVPGVKMALPLVEGQVLASAQAGGSTGALVRGARA 140

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L+             +  G GV+IG  +A  LG+ +GD I + SP GD+TPMG+ 
Sbjct: 141 EDLTKLKTVSDNIKSGDMVGYASGDGVLIGTRMADQLGLRVGDLITLTSPDGDITPMGVS 200

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R KSY + G+F +   +YD+ +++M L+EAQLYFN E  V  IE+FV +PD I+     
Sbjct: 201 PRIKSYKISGLFEIGMSEYDSSIIFMPLEEAQLYFNAEGLVQSIELFVDNPDDIDDLRPK 260

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  + + DW+QR Q FFS  +
Sbjct: 261 VEEAAGRQIAITDWRQRNQTFFSALQ 286


>gi|163759521|ref|ZP_02166606.1| ABC transporter, membrane spanning protein [Hoeflea phototrophica
           DFL-43]
 gi|162283118|gb|EDQ33404.1| ABC transporter, membrane spanning protein [Hoeflea phototrophica
           DFL-43]
          Length = 433

 Score =  243 bits (620), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 122/266 (45%), Positives = 166/266 (62%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL S RK AFIS+ +  SF+G+M+GV  LI+VM+VMNGFR ++I R+LG
Sbjct: 20  FSAFERMVAWRYLRSRRKEAFISVIAGFSFVGIMLGVATLIIVMAVMNGFRGELITRILG 79

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+V+Q    PL DY  +A R   +  VI  +P V GQ   SG+   G+G LVRG+  
Sbjct: 80  INGHMVVQPIDRPLDDYAALAARFKGVDGVINAIPLVEGQTLASGVGGAGTGALVRGVRA 139

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            DF  ++             F  G+GV IG  +A++LG++ GD I +++P GDVTP G+ 
Sbjct: 140 EDFQSMELVSENIRSGDLVGFVAGEGVAIGSRMAQSLGLTAGDLITLVAPEGDVTPFGVT 199

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y V  +F +   +YD+ ++YM L+EAQLYFN E  V  IEVFV+DPD I+     
Sbjct: 200 PRVKAYPVSAIFEVGMSEYDSSIIYMPLEEAQLYFNSEGVVQSIEVFVEDPDDIDAMRPL 259

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I       V + DW+QR Q FFS  +
Sbjct: 260 IEAAADRQVFITDWRQRNQTFFSALQ 285


>gi|227821638|ref|YP_002825608.1| ABC transporter, membrane spanning protein [Sinorhizobium fredii
           NGR234]
 gi|227340637|gb|ACP24855.1| ABC transporter, membrane spanning protein [Sinorhizobium fredii
           NGR234]
          Length = 436

 Score =  242 bits (617), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 118/266 (44%), Positives = 161/266 (60%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL S RK AFIS+ +  SFIG+M+GV  LI+VM+VMNGFR ++I R+LG
Sbjct: 23  FSAFERMVAWRYLRSRRKEAFISVIAGFSFIGIMLGVATLIIVMAVMNGFRTELISRILG 82

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGHV++Q    PL +Y  +A +   +P V   +P V GQ    G+    +G LVRG+  
Sbjct: 83  MNGHVIVQPLDGPLTNYAELATKFSAVPGVTMAIPMVEGQVLAQGIGDASTGALVRGLRA 142

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L++            F  G GV IG  +A  LGI +G  I + SP GDVTP+GM 
Sbjct: 143 EDLMKLKSISEHIQSGDLVGFASGAGVAIGSRMAEQLGIRVGGTITLTSPNGDVTPLGMN 202

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+YTV  +F M   +YD  +++M L+EAQLYFN E  V  IE+FV+ PD+++   + 
Sbjct: 203 PRVKAYTVSAIFEMGMSEYDATIIFMPLEEAQLYFNAEGLVQSIELFVEQPDSVDDLRKP 262

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I    G  V + DW+ R + FFS  E
Sbjct: 263 IEDAAGRQVYLTDWRDRNRTFFSALE 288


>gi|218463077|ref|ZP_03503168.1| putative transmembrane component of ABC transporter [Rhizobium etli
           Kim 5]
          Length = 286

 Score =  242 bits (617), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 115/266 (43%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL + RK AFIS+ +  SF+G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 8   FSTFERLVAWRYLRARRKEAFISVIAGFSFVGIMLGVATLIIVMAVMNGFRTELVSRILG 67

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    P  DY  +A+RL  +P +   LP V GQ   S  + G +G LVRG   
Sbjct: 68  INGHMIVQPVDGPFTDYPELASRLAAVPGIKMALPLVEGQVLASAQAGGSTGALVRGARA 127

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L+             +  G+GV+IG  +A  LG+ +GD I + SP GDVTPMG+ 
Sbjct: 128 EDLTKLKTISDNIKSGDMVGYASGEGVLIGTRMADQLGLRVGDLITLTSPEGDVTPMGVN 187

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R KSY + G+F +   +YD+ +++M L+EAQLYFN    V  IE+FV  PD I+     
Sbjct: 188 PRVKSYKISGLFEIGMSEYDSSIIFMPLEEAQLYFNAAGLVQSIELFVDHPDDIDALRPK 247

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  + + DW+QR Q FFS  +
Sbjct: 248 VEEAAGRQINLTDWRQRNQTFFSALQ 273


>gi|15965040|ref|NP_385393.1| hypothetical protein SMc01935 [Sinorhizobium meliloti 1021]
 gi|15074219|emb|CAC45866.1| ABC transport system, permease [Sinorhizobium meliloti 1021]
          Length = 408

 Score =  239 bits (611), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 115/260 (44%), Positives = 159/260 (61%)

Query: 10  IVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVV 69
           +VAWRYL S RK AFIS+ +  SFIG+M+GV  LI+VM+VMNGFR ++I R+LG+NGH++
Sbjct: 1   MVAWRYLRSRRKEAFISVIAGFSFIGIMLGVGTLIIVMAVMNGFRTELISRILGMNGHMI 60

Query: 70  IQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYL 129
           +Q    PL +Y  +A R   +P V   +P V GQ    GL    +G LVRGI   D + L
Sbjct: 61  VQPLDGPLTNYADLATRFSAVPGVTMAIPIVEGQVLAQGLGDASTGALVRGIRADDLTKL 120

Query: 130 QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSY 189
           ++            F  G GV IG  +A  LGI +G  I + SP GDVTPMGM  R K+Y
Sbjct: 121 KSISEHIQSGDLVGFASGSGVAIGSRMAEQLGIRVGGTITLTSPNGDVTPMGMNPRVKAY 180

Query: 190 TVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILG 249
           TV  +F M   +YD  +++M L+EAQLYFN E  V  IE+F + PDA+++  + +    G
Sbjct: 181 TVSAIFEMGMSEYDATIIFMPLEEAQLYFNAEGLVQSIEIFAEHPDAVDELRKPVEDAAG 240

Query: 250 NGVVVIDWQQRYQIFFSCYE 269
             + + DW++R + FFS  E
Sbjct: 241 RQIFITDWRERNRTFFSALE 260


>gi|319783001|ref|YP_004142477.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
 gi|317168889|gb|ADV12427.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Mesorhizobium ciceri biovar biserrulae WSM1271]
          Length = 428

 Score =  239 bits (611), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 114/266 (42%), Positives = 165/266 (62%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL S RK   IS+ + ISF+G+M+GV  LIVVM+VMNGFR +++ R+LG
Sbjct: 15  FSIFERMVAWRYLRSRRKETVISVIASISFLGIMLGVATLIVVMAVMNGFRAELLTRILG 74

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL DY  +A+R++ +  V   +P + GQ    G   GG+G LVRGI  
Sbjct: 75  VNGHLIVQPLDSPLEDYAQVASRINGVAGVKYAIPLIDGQVLAQGNVGGGTGALVRGIRG 134

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D S +    S        DFD G+GV IGK +A NLG+++GD I ++SP GDVTP+G  
Sbjct: 135 EDLSKIAIVASNIKQGSIADFDSGEGVAIGKRMAENLGLTLGDTITLISPDGDVTPIGTT 194

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y +  +F +   +YD  +VYM   EAQLYFN++     IE++V +PD ++     
Sbjct: 195 PRMKGYKIAAIFEVGMSEYDTSIVYMPFSEAQLYFNMDGRAQTIEIYVDNPDDVDALKPK 254

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR + FFS  +
Sbjct: 255 VEAAAQRPIDMVDWRQRNETFFSALQ 280


>gi|110633395|ref|YP_673603.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Mesorhizobium sp. BNC1]
 gi|110284379|gb|ABG62438.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Chelativorans sp. BNC1]
          Length = 427

 Score =  239 bits (609), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 116/266 (43%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL S RK   +S+ + ISF+G+M+GV  LIVVM+VMNGFR +++ R+LG
Sbjct: 14  FSYFERLVAWRYLRSRRKETVVSVIALISFLGIMLGVATLIVVMAVMNGFRGELLTRILG 73

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL DY  +A R+  +P V   +P V GQ   SG S  GSG LVRG+  
Sbjct: 74  VNGHIIVQPVDSPLSDYDAVAGRIAQVPGVRDAMPIVEGQVLASGRSGAGSGALVRGVRA 133

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + +             DF  G+GV IG  +A++LG+++GD I +++P GDVTP G  
Sbjct: 134 EDLTKIDLVAKNIRVGSLVDFAAGQGVAIGSRMAQSLGLAVGDSITLVAPEGDVTPFGTT 193

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R KSY V  +F +   +YD  ++YM L+EAQL+FN+E  V  IEVF   PD +      
Sbjct: 194 PRVKSYPVTAVFEIGMSEYDASIIYMPLEEAQLFFNVEGLVQFIEVFADHPDNVGTLRPL 253

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       V + DW+QR Q+FFS  +
Sbjct: 254 VEEAAMRPVSISDWRQRNQVFFSALQ 279


>gi|254693560|ref|ZP_05155388.1| Bacterial general secretion pathway protein H [Brucella abortus bv.
           3 str. Tulya]
 gi|261213825|ref|ZP_05928106.1| lipoprotein releasing system [Brucella abortus bv. 3 str. Tulya]
 gi|260915432|gb|EEX82293.1| lipoprotein releasing system [Brucella abortus bv. 3 str. Tulya]
          Length = 437

 Score =  239 bits (609), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 164/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 24  FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLTRILG 83

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R+D IP +   +P V GQA V G    G+G LVRG+  
Sbjct: 84  INGHLIMQPIDRPLDDYADLIKRVDAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGLRE 143

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   S         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+ 
Sbjct: 144 EDLDKLKLISSNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVN 203

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++    +
Sbjct: 204 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAS 263

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR Q FFS  E
Sbjct: 264 VEEAAARQLSLVDWRQRNQTFFSALE 289


>gi|294852179|ref|ZP_06792852.1| lipoprotein-releasing system permease [Brucella sp. NVSL 07-0026]
 gi|294820768|gb|EFG37767.1| lipoprotein-releasing system permease [Brucella sp. NVSL 07-0026]
          Length = 437

 Score =  238 bits (607), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 24  FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLTRILG 83

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R+D IP +   +P V GQA V G    G+G LVRG+  
Sbjct: 84  INGHLIMQPIDRPLDDYADLIKRVDAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGVRE 143

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   S         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+ 
Sbjct: 144 EDLDKLKLISSNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVN 203

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 204 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAP 263

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR Q FFS  E
Sbjct: 264 VEEAAARQLSLVDWRQRNQTFFSALE 289


>gi|260462252|ref|ZP_05810496.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Mesorhizobium opportunistum WSM2075]
 gi|259032112|gb|EEW33379.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Mesorhizobium opportunistum WSM2075]
          Length = 428

 Score =  238 bits (606), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE  VAWRYL S RK   IS+ + ISF+G+M+GV  LIVVM+VMNGFR +++ R+LG
Sbjct: 15  FSIFERTVAWRYLRSRRKETVISVIASISFLGIMLGVATLIVVMAVMNGFRAELLTRILG 74

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL DY  +A R++ +P V   +P + GQ    G   GG+G LVRGI  
Sbjct: 75  VNGHLIVQPIDSPLEDYAQVAGRINGVPGVKYAIPLIDGQVLAQGNVGGGTGALVRGIRA 134

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   +    +        DFD G+GV IGK +A NLG+++GD I ++SP GDVTP+G  
Sbjct: 135 EDLGKIAIVANNIKQGSLADFDSGEGVAIGKRMAENLGLTLGDTITLISPDGDVTPIGTT 194

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y +  +F +   +YD  +VYM   EAQLYFN++     IE++V +PD ++     
Sbjct: 195 PRMKGYKISAIFEVGMSEYDTSIVYMPFSEAQLYFNMDGRAQTIEIYVDNPDDVDALKPK 254

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR + FFS  +
Sbjct: 255 VEEAAQRPIDMVDWRQRNETFFSALQ 280


>gi|189024015|ref|YP_001934783.1| Bacterial general secretion pathway protein H [Brucella abortus
           S19]
 gi|237815258|ref|ZP_04594256.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brucella abortus str. 2308 A]
 gi|254689077|ref|ZP_05152331.1| Bacterial general secretion pathway protein H [Brucella abortus bv.
           6 str. 870]
 gi|254697211|ref|ZP_05159039.1| Bacterial general secretion pathway protein H [Brucella abortus bv.
           2 str. 86/8/59]
 gi|254730108|ref|ZP_05188686.1| Bacterial general secretion pathway protein H [Brucella abortus bv.
           4 str. 292]
 gi|256257326|ref|ZP_05462862.1| Bacterial general secretion pathway protein H [Brucella abortus bv.
           9 str. C68]
 gi|260545480|ref|ZP_05821221.1| bacterial general secretion pathway protein H [Brucella abortus
           NCTC 8038]
 gi|260754575|ref|ZP_05866923.1| lipoprotein releasing system [Brucella abortus bv. 6 str. 870]
 gi|260757798|ref|ZP_05870146.1| lipoprotein releasing system [Brucella abortus bv. 4 str. 292]
 gi|260761621|ref|ZP_05873964.1| lipoprotein releasing system [Brucella abortus bv. 2 str. 86/8/59]
 gi|260883602|ref|ZP_05895216.1| lipoprotein releasing system protein [Brucella abortus bv. 9 str.
           C68]
 gi|189019587|gb|ACD72309.1| Bacterial general secretion pathway protein H [Brucella abortus
           S19]
 gi|237790095|gb|EEP64305.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brucella abortus str. 2308 A]
 gi|260096887|gb|EEW80762.1| bacterial general secretion pathway protein H [Brucella abortus
           NCTC 8038]
 gi|260668116|gb|EEX55056.1| lipoprotein releasing system [Brucella abortus bv. 4 str. 292]
 gi|260672053|gb|EEX58874.1| lipoprotein releasing system [Brucella abortus bv. 2 str. 86/8/59]
 gi|260674683|gb|EEX61504.1| lipoprotein releasing system [Brucella abortus bv. 6 str. 870]
 gi|260873130|gb|EEX80199.1| lipoprotein releasing system protein [Brucella abortus bv. 9 str.
           C68]
          Length = 437

 Score =  238 bits (606), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 24  FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLTRILG 83

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R+D IP +   +P V GQA V G    G+G LVRG+  
Sbjct: 84  INGHLIMQPIDRPLDDYADLIKRVDAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGLRE 143

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   S         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+ 
Sbjct: 144 EDLDKLKLISSNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVN 203

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 204 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAP 263

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR Q FFS  E
Sbjct: 264 VEEAAARQLSLVDWRQRNQTFFSALE 289


>gi|153009732|ref|YP_001370947.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Ochrobactrum anthropi ATCC 49188]
 gi|151561620|gb|ABS15118.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ochrobactrum anthropi ATCC 49188]
          Length = 438

 Score =  238 bits (606), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 114/266 (42%), Positives = 164/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 25  FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLSRILG 84

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R+D I  +   +P V GQA V G    G+G LVRG+  
Sbjct: 85  INGHLIMQPIDRPLDDYADLIKRIDGISGIRFAIPVVEGQALVQGNIGAGTGALVRGLRE 144

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+             FD+G GV IG  +A NLG+SIGD + ++SP GDVTP G+ 
Sbjct: 145 EDLDKLKLVSGNIRQGTLQGFDQGGGVAIGTRMAENLGLSIGDTLRVISPDGDVTPFGVN 204

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 205 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAP 264

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  + ++DW+QR Q FFS  E
Sbjct: 265 VEEAAGRQLSLVDWRQRNQTFFSALE 290


>gi|256060933|ref|ZP_05451091.1| Bacterial general secretion pathway protein H [Brucella neotomae
           5K33]
 gi|261324933|ref|ZP_05964130.1| lipoprotein releasing system protein [Brucella neotomae 5K33]
 gi|261300913|gb|EEY04410.1| lipoprotein releasing system protein [Brucella neotomae 5K33]
          Length = 437

 Score =  238 bits (606), Expect = 8e-61,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 24  FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLTRILG 83

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R+D IP +   +P V GQA V G    G+G LVRG+  
Sbjct: 84  INGHLIMQPIDRPLDDYADLIKRVDAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGLRE 143

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   S         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+ 
Sbjct: 144 EDLDKLKLISSNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVN 203

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 204 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAP 263

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR Q FFS  E
Sbjct: 264 VEEAAARQLSLVDWRQRNQTFFSALE 289


>gi|254701589|ref|ZP_05163417.1| Bacterial general secretion pathway protein H [Brucella suis bv. 5
           str. 513]
 gi|254704136|ref|ZP_05165964.1| Bacterial general secretion pathway protein H [Brucella suis bv. 3
           str. 686]
 gi|254706963|ref|ZP_05168791.1| Bacterial general secretion pathway protein H [Brucella
           pinnipedialis M163/99/10]
 gi|254709929|ref|ZP_05171740.1| Bacterial general secretion pathway protein H [Brucella
           pinnipedialis B2/94]
 gi|254713930|ref|ZP_05175741.1| Bacterial general secretion pathway protein H [Brucella ceti
           M644/93/1]
 gi|254717012|ref|ZP_05178823.1| Bacterial general secretion pathway protein H [Brucella ceti
           M13/05/1]
 gi|256031422|ref|ZP_05445036.1| Bacterial general secretion pathway protein H [Brucella
           pinnipedialis M292/94/1]
 gi|256113356|ref|ZP_05454214.1| Bacterial general secretion pathway protein H [Brucella melitensis
           bv. 3 str. Ether]
 gi|256159543|ref|ZP_05457311.1| Bacterial general secretion pathway protein H [Brucella ceti
           M490/95/1]
 gi|256254830|ref|ZP_05460366.1| Bacterial general secretion pathway protein H [Brucella ceti B1/94]
 gi|256264164|ref|ZP_05466696.1| bacterial general secretion pathway protein H [Brucella melitensis
           bv. 2 str. 63/9]
 gi|260566615|ref|ZP_05837085.1| bacterial general secretion pathway protein H [Brucella suis bv. 4
           str. 40]
 gi|261218819|ref|ZP_05933100.1| lipoprotein releasing system [Brucella ceti M13/05/1]
 gi|261222011|ref|ZP_05936292.1| lipoprotein releasing system protein [Brucella ceti B1/94]
 gi|261314426|ref|ZP_05953623.1| lipoprotein releasing system [Brucella pinnipedialis M163/99/10]
 gi|261317475|ref|ZP_05956672.1| lipoprotein releasing system [Brucella pinnipedialis B2/94]
 gi|261321682|ref|ZP_05960879.1| lipoprotein releasing system [Brucella ceti M644/93/1]
 gi|261752142|ref|ZP_05995851.1| lipoprotein releasing system [Brucella suis bv. 5 str. 513]
 gi|261754802|ref|ZP_05998511.1| lipoprotein releasing system [Brucella suis bv. 3 str. 686]
 gi|265988511|ref|ZP_06101068.1| lipoprotein releasing system protein [Brucella pinnipedialis
           M292/94/1]
 gi|265994762|ref|ZP_06107319.1| lipoprotein releasing system protein [Brucella melitensis bv. 3
           str. Ether]
 gi|265997975|ref|ZP_06110532.1| lipoprotein releasing system [Brucella ceti M490/95/1]
 gi|260156133|gb|EEW91213.1| bacterial general secretion pathway protein H [Brucella suis bv. 4
           str. 40]
 gi|260920595|gb|EEX87248.1| lipoprotein releasing system protein [Brucella ceti B1/94]
 gi|260923908|gb|EEX90476.1| lipoprotein releasing system [Brucella ceti M13/05/1]
 gi|261294372|gb|EEX97868.1| lipoprotein releasing system [Brucella ceti M644/93/1]
 gi|261296698|gb|EEY00195.1| lipoprotein releasing system [Brucella pinnipedialis B2/94]
 gi|261303452|gb|EEY06949.1| lipoprotein releasing system [Brucella pinnipedialis M163/99/10]
 gi|261741895|gb|EEY29821.1| lipoprotein releasing system [Brucella suis bv. 5 str. 513]
 gi|261744555|gb|EEY32481.1| lipoprotein releasing system [Brucella suis bv. 3 str. 686]
 gi|262552443|gb|EEZ08433.1| lipoprotein releasing system [Brucella ceti M490/95/1]
 gi|262765875|gb|EEZ11664.1| lipoprotein releasing system protein [Brucella melitensis bv. 3
           str. Ether]
 gi|263094382|gb|EEZ18227.1| bacterial general secretion pathway protein H [Brucella melitensis
           bv. 2 str. 63/9]
 gi|264660708|gb|EEZ30969.1| lipoprotein releasing system protein [Brucella pinnipedialis
           M292/94/1]
          Length = 437

 Score =  238 bits (606), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 24  FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLTRILG 83

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R+D IP +   +P V GQA V G    G+G LVRG+  
Sbjct: 84  INGHLIMQPIDRPLDDYADLIKRVDAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGLRE 143

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   S         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+ 
Sbjct: 144 EDLDKLKLISSNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVN 203

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 204 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAP 263

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR Q FFS  E
Sbjct: 264 VEEAAARQLSLVDWRQRNQTFFSALE 289


>gi|23501710|ref|NP_697837.1| ABC transporter permease [Brucella suis 1330]
 gi|161618787|ref|YP_001592674.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Brucella canis ATCC 23365]
 gi|163843096|ref|YP_001627500.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Brucella suis ATCC 23445]
 gi|225852337|ref|YP_002732570.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Brucella melitensis ATCC 23457]
 gi|23347634|gb|AAN29752.1| ABC transporter, permease protein [Brucella suis 1330]
 gi|161335598|gb|ABX61903.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brucella canis ATCC 23365]
 gi|163673819|gb|ABY37930.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brucella suis ATCC 23445]
 gi|225640702|gb|ACO00616.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Brucella melitensis ATCC 23457]
 gi|326408845|gb|ADZ65910.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Brucella melitensis M28]
 gi|326538560|gb|ADZ86775.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Brucella melitensis M5-90]
          Length = 422

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 9   FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLTRILG 68

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R+D IP +   +P V GQA V G    G+G LVRG+  
Sbjct: 69  INGHLIMQPIDRPLDDYADLIKRVDAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGLRE 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   S         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+ 
Sbjct: 129 EDLDKLKLISSNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVN 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 189 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAP 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR Q FFS  E
Sbjct: 249 VEEAAARQLSLVDWRQRNQTFFSALE 274


>gi|254500740|ref|ZP_05112891.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Labrenzia alexandrii DFL-11]
 gi|222436811|gb|EEE43490.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Labrenzia alexandrii DFL-11]
          Length = 434

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 116/266 (43%), Positives = 166/266 (62%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++A RYL S R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ ++LG
Sbjct: 22  FAPFEWMIAGRYLRSRRRETFISVIAGFSFAGIMLGVATLIIVMAVMNGFRSELLGKILG 81

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH++IQ    PL DY  +A RL+ +P+VI  +PFV GQA VSG  +G  G LVRG+  
Sbjct: 82  INGHMLIQPIDQPLTDYDPVAKRLEGVPEVISAIPFVEGQALVSG-PAGNLGALVRGLKE 140

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           SD   +    +       + FD G+GV IG  +A+ LGI++GD + I+SP G VTPMG+ 
Sbjct: 141 SDLRRIPLVANNLRAGTLDGFDAGQGVAIGSRMAQQLGITLGDNVTIISPRGSVTPMGVT 200

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y V  +F +   +YD   ++M L E+Q YFN++   +GIE++V DPD +      
Sbjct: 201 PRVKAYPVTAIFEIGMSEYDATFLFMPLPESQAYFNMDGITTGIELYVVDPDNVGTMLAA 260

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G    V DW+QR   FFS  E
Sbjct: 261 VEEAAGRPAFVTDWRQRNVTFFSALE 286


>gi|62289772|ref|YP_221565.1| ABC transporter permease [Brucella abortus bv. 1 str. 9-941]
 gi|82699700|ref|YP_414274.1| general secretion pathway protein H [Brucella melitensis biovar
           Abortus 2308]
 gi|297248175|ref|ZP_06931893.1| lipoprotein-releasing system permease [Brucella abortus bv. 5 str.
           B3196]
 gi|62195904|gb|AAX74204.1| ABC transporter, permease protein [Brucella abortus bv. 1 str.
           9-941]
 gi|82615801|emb|CAJ10799.1| Bacterial general secretion pathway protein H:Protein of unknown
           function DUF214 [Brucella melitensis biovar Abortus
           2308]
 gi|297175344|gb|EFH34691.1| lipoprotein-releasing system permease [Brucella abortus bv. 5 str.
           B3196]
          Length = 422

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 9   FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLTRILG 68

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R+D IP +   +P V GQA V G    G+G LVRG+  
Sbjct: 69  INGHLIMQPIDRPLDDYADLIKRVDAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGLRE 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   S         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+ 
Sbjct: 129 EDLDKLKLISSNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVN 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 189 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAP 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR Q FFS  E
Sbjct: 249 VEEAAARQLSLVDWRQRNQTFFSALE 274


>gi|225627318|ref|ZP_03785355.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Brucella ceti str. Cudo]
 gi|260168556|ref|ZP_05755367.1| Bacterial general secretion pathway protein H [Brucella sp. F5/99]
 gi|261758029|ref|ZP_06001738.1| bacterial general secretion pathway protein H [Brucella sp. F5/99]
 gi|225617323|gb|EEH14368.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Brucella ceti str. Cudo]
 gi|261738013|gb|EEY26009.1| bacterial general secretion pathway protein H [Brucella sp. F5/99]
          Length = 437

 Score =  237 bits (605), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 24  FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLMRILG 83

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R+D IP +   +P V GQA V G    G+G LVRG+  
Sbjct: 84  INGHLIMQPIDRPLDDYADLIKRVDAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGLRE 143

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   S         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+ 
Sbjct: 144 EDLDKLKLISSNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVN 203

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 204 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAP 263

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR Q FFS  E
Sbjct: 264 VEEAAARQLSLVDWRQRNQTFFSALE 289


>gi|328543707|ref|YP_004303816.1| ABC transporter, permease protein [Polymorphum gilvum SL003B-26A1]
 gi|326413451|gb|ADZ70514.1| ABC transporter, permease protein [Polymorphum gilvum SL003B-26A1]
          Length = 434

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 114/266 (42%), Positives = 169/266 (63%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++A RYL S R+ AFIS+ +  SF+G+M+GV  LI+VM+VMNGFR +++ ++LG
Sbjct: 22  FAAFEWMIAGRYLRSRRREAFISVIAGFSFVGIMLGVATLIIVMAVMNGFRSELLTKILG 81

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +A RL+ +  V+  +PFV GQA VSG  +G  G LVRG+  
Sbjct: 82  INGHMLVQPIDQPLTDYDAVAARLEGVSGVVAAMPFVEGQAMVSG-PAGNFGALVRGLWE 140

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           +D   L            + FD G GV IG  +A+ LG+++GD + I+SP G VTPMG+ 
Sbjct: 141 ADIRRLPLVAGNVRAGSLDGFDEGGGVAIGTRMAQQLGLAVGDNVTIISPRGAVTPMGVT 200

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R KSY +L +F +   +YD+ +++M L+EAQ+YF +E   +G+EV+V+DPD +     +
Sbjct: 201 PRLKSYPILAVFEIGMSEYDSTILFMPLEEAQVYFRMEGKATGVEVYVEDPDKVGAMRAS 260

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +         V DW+QR   FFS  E
Sbjct: 261 VEDGAARPAFVTDWRQRNVTFFSALE 286


>gi|306843759|ref|ZP_07476358.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brucella sp. BO1]
 gi|306275950|gb|EFM57663.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brucella sp. BO1]
          Length = 437

 Score =  237 bits (604), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 112/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 24  FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLTRILG 83

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R+D IP +   +P V GQA V G    G+G LVRG+  
Sbjct: 84  INGHLIMQPIDRPLDDYADLIKRVDAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGLRE 143

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   +         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+ 
Sbjct: 144 EDLDKLKLISTNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVN 203

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 204 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAP 263

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR Q FFS  E
Sbjct: 264 VEEAAARQLSLVDWRQRNQTFFSALE 289


>gi|256369254|ref|YP_003106762.1| ABC transporter, permease protein [Brucella microti CCM 4915]
 gi|255999414|gb|ACU47813.1| ABC transporter, permease protein [Brucella microti CCM 4915]
          Length = 422

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 9   FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLTRILG 68

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R+D IP +   +P V GQA V G    G+G LVRG+  
Sbjct: 69  INGHLIMQPIDRPLDDYADLIKRVDAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGLRE 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   S         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+ 
Sbjct: 129 EDLDKLKLISSNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVN 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 189 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAL 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR Q FFS  E
Sbjct: 249 VEEAAARQLSLVDWRQRNQTFFSALE 274


>gi|13471386|ref|NP_102952.1| hypothetical protein mll1342 [Mesorhizobium loti MAFF303099]
 gi|14022128|dbj|BAB48738.1| mll1342 [Mesorhizobium loti MAFF303099]
          Length = 428

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE  VAWRYL S RK   IS+ + ISF+G+M+GV  LIVVM+VMNGFR +++ R+LG
Sbjct: 15  FSFFERTVAWRYLRSRRKETVISVIASISFLGIMLGVATLIVVMAVMNGFRAELLTRILG 74

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL DY  +A R++ +P V   +P + GQ    G   GG+G LVRGI  
Sbjct: 75  VNGHLIVQPLDSPLEDYAQVAGRINGVPGVKYAIPLIDGQVLAQGNVGGGTGALVRGIRG 134

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   +    +         FD G+GV IGK +A+NLG+++GD I ++SP GDVTP+G  
Sbjct: 135 EDLGKIAIVANNIKQGSLASFDSGEGVAIGKRMAQNLGLTLGDTITLISPDGDVTPIGTT 194

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y +  +F +   +YD  +VYM   EAQLYFN++     IE++V +PD ++     
Sbjct: 195 PRMKGYKIAAIFEVGMSEYDTSIVYMPFSEAQLYFNMDGRAQTIEIYVDNPDNVDALKPK 254

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR + FFS  +
Sbjct: 255 VEEAAQRPIDMVDWRQRNETFFSALQ 280


>gi|254718930|ref|ZP_05180741.1| Bacterial general secretion pathway protein H [Brucella sp. 83/13]
 gi|265983917|ref|ZP_06096652.1| lipoprotein releasing system [Brucella sp. 83/13]
 gi|306838839|ref|ZP_07471670.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brucella sp. NF 2653]
 gi|264662509|gb|EEZ32770.1| lipoprotein releasing system [Brucella sp. 83/13]
 gi|306406123|gb|EFM62371.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brucella sp. NF 2653]
          Length = 437

 Score =  236 bits (603), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 112/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 24  FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLTRILG 83

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R+D IP +   +P V GQA V G    G+G LVRG+  
Sbjct: 84  INGHLIMQPIDRPLDDYADLIKRVDAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGLRE 143

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   +         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+ 
Sbjct: 144 EDLDKLKLISTNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVN 203

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 204 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAP 263

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR Q FFS  E
Sbjct: 264 VEEAAARQLSLVDWRQRNQTFFSALE 289


>gi|222085596|ref|YP_002544126.1| lipoprotein ABC transporter [Agrobacterium radiobacter K84]
 gi|221723044|gb|ACM26200.1| lipoprotein ABC transporter [Agrobacterium radiobacter K84]
          Length = 436

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 113/266 (42%), Positives = 165/266 (62%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL S RK A IS+ +  S +G+M+GV ALI+VM+VMNGFR ++ K++LG
Sbjct: 23  FSGFERLVAWRYLRSRRKEASISVIAGFSLVGIMLGVAALIIVMAVMNGFRAELFKQILG 82

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
            NGHV++Q    PL DY  +A +   +P V   LP V G+   SG    G+G LVRGI +
Sbjct: 83  FNGHVIVQPIDSPLNDYASLAQKFAAVPGVTMALPLVEGETLASGRGGSGTGALVRGIRS 142

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L+             F  G+GV++G  LAR LG+++GD+I + +P GDVTP G+ 
Sbjct: 143 EDLTKLKTVSDHIVDGDMVGFAAGQGVMVGSRLARQLGLTVGDQITLTAPDGDVTPFGVN 202

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y++ G+F +   +YD+ +V+M L+EAQL+FN E  V  IE+F+ +PD ++     
Sbjct: 203 PRVKAYSISGIFEVGMSEYDSSVVFMPLEEAQLFFNAEGIVEKIELFISNPDDVDLLRPK 262

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I    G  + + DW+Q    FFS  +
Sbjct: 263 IEAAAGRQIFLTDWRQVNATFFSALQ 288


>gi|256044500|ref|ZP_05447404.1| Bacterial general secretion pathway protein H [Brucella melitensis
           bv. 1 str. Rev.1]
 gi|260563854|ref|ZP_05834340.1| bacterial general secretion pathway protein [Brucella melitensis
           bv. 1 str. 16M]
 gi|265990924|ref|ZP_06103481.1| lipoprotein releasing system [Brucella melitensis bv. 1 str. Rev.1]
 gi|260153870|gb|EEW88962.1| bacterial general secretion pathway protein [Brucella melitensis
           bv. 1 str. 16M]
 gi|263001708|gb|EEZ14283.1| lipoprotein releasing system [Brucella melitensis bv. 1 str. Rev.1]
          Length = 437

 Score =  236 bits (601), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 112/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 24  FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLTRILG 83

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R++ IP +   +P V GQA V G    G+G LVRG+  
Sbjct: 84  INGHLIMQPIDRPLDDYADLIKRVNAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGLRE 143

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   S         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+ 
Sbjct: 144 EDLDKLKLISSNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVN 203

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 204 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAP 263

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR Q FFS  E
Sbjct: 264 VEEAAARQLSLVDWRQRNQTFFSALE 289


>gi|17987422|ref|NP_540056.1| lipoprotein releasing system transmembrane protein LOLE [Brucella
           melitensis bv. 1 str. 16M]
 gi|17983113|gb|AAL52320.1| lipoprotein releasing system transmembrane protein lole [Brucella
           melitensis bv. 1 str. 16M]
          Length = 422

 Score =  235 bits (600), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 112/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 9   FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLTRILG 68

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R++ IP +   +P V GQA V G    G+G LVRG+  
Sbjct: 69  INGHLIMQPIDRPLDDYADLIKRVNAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGLRE 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+   S         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+ 
Sbjct: 129 EDLDKLKLISSNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVN 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 189 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAP 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR Q FFS  E
Sbjct: 249 VEEAAARQLSLVDWRQRNQTFFSALE 274


>gi|307942138|ref|ZP_07657489.1| lipoprotein-releasing system transmembrane protein LolC [Roseibium
           sp. TrichSKD4]
 gi|307774424|gb|EFO33634.1| lipoprotein-releasing system transmembrane protein LolC [Roseibium
           sp. TrichSKD4]
          Length = 433

 Score =  235 bits (599), Expect = 5e-60,   Method: Compositional matrix adjust.
 Identities = 117/266 (43%), Positives = 169/266 (63%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++A RYL + R++ FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ ++LG
Sbjct: 21  FAPFEWMIAGRYLRARRRDTFISVIAGFSFAGIMLGVATLIIVMAVMNGFRSELLGKILG 80

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q     L DY  +A RL+ +PDVI  +PFV GQA VSG  SG +G LVRG+S 
Sbjct: 81  INGHMLVQPIDMALTDYDPVAKRLEGVPDVISAIPFVEGQALVSG-PSGNTGGLVRGMSE 139

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           ++   +            + FD G+G+ IG  +A+NLG+ +GD I I+SP G+VTPMG+ 
Sbjct: 140 TNLRRVPLVADNIKSGTLDGFDAGEGIAIGSRMAQNLGLLLGDNITIISPNGNVTPMGVT 199

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R KSY +  +F +   +YD   V+M L EAQ YFN++   +GIEV++ DPD + +    
Sbjct: 200 PRVKSYPITAIFEIGMSEYDATFVFMPLTEAQGYFNMDGRATGIEVYIADPDRVGQMVPI 259

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I         V DW+QR Q FFS  E
Sbjct: 260 IEDAADRPAFVTDWRQRNQTFFSALE 285


>gi|239831705|ref|ZP_04680034.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ochrobactrum intermedium LMG 3301]
 gi|239823972|gb|EEQ95540.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ochrobactrum intermedium LMG 3301]
          Length = 438

 Score =  234 bits (597), Expect = 9e-60,   Method: Compositional matrix adjust.
 Identities = 112/266 (42%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 25  FSAFERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLSRILG 84

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  +  R+D I  +   +P V GQA V G    G+G L+RG+  
Sbjct: 85  INGHLIMQPIDRPLDDYADLIKRIDGISGIRFAIPVVEGQALVQGNIGAGNGALIRGLRE 144

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+             FD+  GV IG  +A NLG+SIGD + ++SP GDVTP G+ 
Sbjct: 145 EDLDKLKLVSGNIRQGTLQGFDQAGGVAIGTRMAENLGLSIGDTLRVISPDGDVTPFGVN 204

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+ +V M L EAQL+FN E  V  +E+FV +PD ++     
Sbjct: 205 PRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQLFFNQEGKVQSLEIFVDNPDKVDAMRAP 264

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  + ++DW+QR Q FFS  E
Sbjct: 265 VEEAAGRQLSLVDWRQRNQTFFSALE 290


>gi|118590018|ref|ZP_01547422.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Stappia aggregata IAM 12614]
 gi|118437515|gb|EAV44152.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Stappia aggregata IAM 12614]
          Length = 434

 Score =  233 bits (594), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 115/266 (43%), Positives = 165/266 (62%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++A RYL S R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ ++LG
Sbjct: 22  FSAFEWMIAGRYLRSRRRETFISVIAGFSFAGIMLGVATLIIVMAVMNGFRTELLGKILG 81

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    PL DY  ++ RL  +P+V+  +PFV GQA VSG  +G  G LVRG+  
Sbjct: 82  INGHMLVQPIDQPLTDYDAVSARLQGVPEVVSAIPFVEGQALVSG-PAGNFGALVRGLHE 140

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           SD   +    +       + FD G+GV IG  +A+ LGIS+GD + I+SP G VTPMG+ 
Sbjct: 141 SDLRRVPLIANNVRSGSLDGFDAGEGVAIGSRMAQQLGISLGDNVTIISPRGSVTPMGVT 200

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y V  +F +   +YD   ++M ++E+Q YFN++   +GIEV+V DPD +      
Sbjct: 201 PRLKAYPVTAIFEIGMSEYDATFLFMPMEESQAYFNMDGKATGIEVYVADPDRVGAMKSM 260

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I         V DW+QR   FFS  E
Sbjct: 261 IEEAADRPTFVTDWRQRNVTFFSALE 286


>gi|148560498|ref|YP_001258800.1| ABC transporter permease [Brucella ovis ATCC 25840]
 gi|148371755|gb|ABQ61734.1| ABC transporter, permease protein [Brucella ovis ATCC 25840]
          Length = 413

 Score =  232 bits (591), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 110/263 (41%), Positives = 160/263 (60%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE ++AWRYL + R+  FIS+ +  SF G+M+GV  LI+VM+VMNGFR +++ R+LGING
Sbjct: 3   FERMIAWRYLRARRRETFISVIAGFSFTGIMLGVATLIIVMAVMNGFRAELLTRILGING 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+++Q    PL DY  +  R+D IP +   +P V GQA V G    G+G LVRG+   D 
Sbjct: 63  HLIMQPIDRPLDDYADLIKRVDAIPGIKFAIPVVEGQALVQGNIGAGTGALVRGLREEDL 122

Query: 127 SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRS 186
             L+   S         FD   GV IG  +A NLG+S+GD + ++SP GDVTP G+  R 
Sbjct: 123 DKLKLISSNIRQGTLKGFDHSGGVAIGTRMAENLGLSVGDTLRVISPDGDVTPFGVNPRV 182

Query: 187 KSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVR 246
           K+Y ++ +F +   +YD+ +V M L E QL+FN E  V  +E+FV +PD ++     +  
Sbjct: 183 KAYPIVAIFEIGMSEYDSSIVMMPLSEVQLFFNQEGKVQSLEIFVDNPDKVDAMRAPVEE 242

Query: 247 ILGNGVVVIDWQQRYQIFFSCYE 269
                + ++DW+QR Q FFS  E
Sbjct: 243 AAARQLSLVDWRQRNQTFFSALE 265


>gi|114707389|ref|ZP_01440286.1| hypothetical protein FP2506_04185 [Fulvimarina pelagi HTCC2506]
 gi|114537270|gb|EAU40397.1| hypothetical protein FP2506_04185 [Fulvimarina pelagi HTCC2506]
          Length = 429

 Score =  228 bits (582), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 115/268 (42%), Positives = 158/268 (58%)

Query: 2   SIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRV 61
           S FSRFE ++A RYL S ++ A +S+ +  SF+G+M+GV ALI+VMSVMNGFR +++ R+
Sbjct: 14  SAFSRFEWLLAGRYLRSRKREAGVSVIAGFSFVGIMLGVAALIIVMSVMNGFRTELLSRI 73

Query: 62  LGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
           LG+NGHV++     PL DY  +A R+D +P V   +P V GQ    G+ +  SG LV+G+
Sbjct: 74  LGVNGHVIVMPIDQPLSDYDEVAQRIDQVPGVAYSMPLVQGQILSQGMGTSSSGALVKGV 133

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
           S +    L             +FD G+GV IG  LA  LG+ I D+I ++SP GDVTP+G
Sbjct: 134 SEASLKSLTPVSDNISQGSIENFDGGEGVAIGARLAERLGLRIEDRITLISPEGDVTPLG 193

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R KSY V  +F +   +YD   VYM L EAQL+FN E     +EVFV DPD +    
Sbjct: 194 TTPRVKSYPVDAIFEIGLSEYDAAYVYMPLSEAQLFFNSEGETQSVEVFVDDPDNVADLQ 253

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             I       V  + WQ + Q FFS  +
Sbjct: 254 PAIEAAAQRPVYSVTWQSQNQSFFSALQ 281


>gi|325292652|ref|YP_004278516.1| lipoprotein ABC transporter membrane spanning protein
           [Agrobacterium sp. H13-3]
 gi|325060505|gb|ADY64196.1| lipoprotein ABC transporter membrane spanning protein
           [Agrobacterium sp. H13-3]
          Length = 435

 Score =  228 bits (580), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 118/266 (44%), Positives = 161/266 (60%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL S RK AFIS+ +  SF+G+M+GV  LI+VM+VMNGFR ++I R+LG
Sbjct: 22  FSAFERMVAWRYLRSRRKEAFISVIAGFSFVGIMLGVATLIIVMAVMNGFRTELISRILG 81

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    P  +Y  +A +   IP V   LP V GQ   SG    GSG LVRG+  
Sbjct: 82  INGHMIVQPIDQPFNNYDELAKKFSAIPGVTMALPLVEGQTLASGRGGAGSGALVRGVRQ 141

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   ++   +         F  G GV++G  LA  LG++ GD I ++SP GDVTPMG+ 
Sbjct: 142 DDIDKIKEVATNVKTGDLVGFMAGDGVLVGSRLAAQLGVTAGDDITLISPEGDVTPMGVN 201

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R KSY + G+F +   +YD  M+YM L EAQLYFN E  V  IE++V  PD ++     
Sbjct: 202 PRVKSYKISGVFEIGMSEYDASMIYMPLSEAQLYFNAEGLVQSIELYVSRPDNVDGIRPL 261

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           + +     + + DW+QR Q FFS  +
Sbjct: 262 VEQAAERQIYITDWRQRNQTFFSALQ 287


>gi|15888617|ref|NP_354298.1| ABC transporter, membrane spanning protein [Agrobacterium
           tumefaciens str. C58]
 gi|15156341|gb|AAK87083.1| ABC transporter, membrane spanning protein [Agrobacterium
           tumefaciens str. C58]
          Length = 435

 Score =  225 bits (573), Expect = 6e-57,   Method: Compositional matrix adjust.
 Identities = 116/266 (43%), Positives = 160/266 (60%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL S RK AFIS+ +  SF+G+M+GV  LI+VM+VMNGFR ++I R+LG
Sbjct: 22  FSAFERMVAWRYLRSRRKEAFISVIAGFSFVGIMLGVATLIIVMAVMNGFRTELISRILG 81

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++Q    P  +Y  +A +   +P V   LP V GQ   SG    GSG LVRG+  
Sbjct: 82  INGHMIVQPIDQPFNNYDELAKKFSAVPGVTMALPLVEGQTLASGRGGAGSGALVRGVRQ 141

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   ++   +         F  G GV++G  LA  LG++ GD I ++SP GDVTPMG+ 
Sbjct: 142 EDIDKIKEVATNIKTGDLVGFMAGDGVLVGSRLASQLGVTAGDDITLISPEGDVTPMGIN 201

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R KSY + G+F +   +YD  M+YM L EAQLYFN    V  IE++V  PD ++     
Sbjct: 202 PRVKSYKISGVFEIGMSEYDASMIYMPLSEAQLYFNANGIVQSIELYVSRPDDVDGIRPL 261

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           + +     + + DW+QR Q FFS  +
Sbjct: 262 VEQAAERQIYITDWRQRNQTFFSALQ 287


>gi|319898899|ref|YP_004158992.1| ABC transporter, permease protein [Bartonella clarridgeiae 73]
 gi|319402863|emb|CBI76414.1| ABC transporter, permease protein [Bartonella clarridgeiae 73]
          Length = 422

 Score =  223 bits (568), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 164/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS +E ++A+RY+  N+K+ F SI S IS IG+M+GV AL+V+M+VMNGFR +++ R+LG
Sbjct: 9   FSSYEWMIAFRYMIPNKKHMFTSIVSIISLIGIMLGVFALVVIMAVMNGFRTELLSRILG 68

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+V+Q       DY  + + L+    +  VLP + GQA V G   GG+G LVRG+  
Sbjct: 69  MNGHLVVQTIDSNFTDYNTLISSLESTKGIKFVLPIIEGQALVQGNFEGGTGALVRGVRQ 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+             FD+ +GV IG  LA  LG+++G  + I++P GD TP G+ 
Sbjct: 129 EDLEKLKTVAQNIISGTLAQFDKEEGVAIGSGLAEKLGLTVGSDLRIITPNGDDTPFGVT 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y V+ +F +   +YD+  ++M L EAQ++FNL   +  +E+F+ DPDAI++    
Sbjct: 189 PRVKAYKVVAIFEVGMSEYDSIFIFMPLHEAQIFFNLGEKIQSLELFLNDPDAIDQIKPV 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I + +   + +IDW+ R Q FFS  +
Sbjct: 249 IEKAVNQQINLIDWRMRNQAFFSALQ 274


>gi|90417822|ref|ZP_01225734.1| ABC transporter, permease protein [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90337494|gb|EAS51145.1| ABC transporter, permease protein [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 434

 Score =  222 bits (566), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 110/266 (41%), Positives = 158/266 (59%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+RFE ++A RYL S R++A +S+ +  SF+G+M+GV ALI+VMSVMNGFR +++ R+LG
Sbjct: 21  FARFEWMLAGRYLRSRRRDAGVSVIAGFSFLGIMLGVAALIIVMSVMNGFRGELLTRILG 80

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGHVV+     PL D+  +   ++ +P V   +P V GQ   SGL+S  +G LV+G+  
Sbjct: 81  VNGHVVMYPIDRPLDDFSDVTAAVETVPGVAFAMPLVQGQVLASGLASSSTGALVKGVRG 140

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L+           + F  G G+ IG  LA  LG+ +GD I ++SP GDVTP+G  
Sbjct: 141 EDLADLKPVSENIRQGTLDGFSEGGGLAIGSRLAEALGLRLGDNITLVSPDGDVTPLGTT 200

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y V  +F +   +YD   VYM L EAQL+FN E     +E+FV DPD ++     
Sbjct: 201 PRVKAYPVAAIFEIGLSEYDASYVYMPLAEAQLFFNHEGLAQSVEIFVDDPDRVQDLQRT 260

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I    G     + WQ + Q FFS  E
Sbjct: 261 IETAAGRPNYTVTWQTQNQSFFSALE 286


>gi|254469383|ref|ZP_05082788.1| lipoprotein releasing system transmembrane protein lole
           [Pseudovibrio sp. JE062]
 gi|211961218|gb|EEA96413.1| lipoprotein releasing system transmembrane protein lole
           [Pseudovibrio sp. JE062]
          Length = 407

 Score =  221 bits (563), Expect = 8e-56,   Method: Compositional matrix adjust.
 Identities = 114/260 (43%), Positives = 155/260 (59%), Gaps = 1/260 (0%)

Query: 10  IVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVV 69
           ++A RYL S RK  FISI + +SF+G+ +GV  LI+VM+VMNGFR +++ ++LGINGHV+
Sbjct: 1   MLAGRYLRSRRKETFISIIAGLSFLGITLGVATLIIVMAVMNGFRTELLTKILGINGHVL 60

Query: 70  IQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYL 129
           +Q    PL DYQ  + +L  I  V   +PFV GQA +SG  S   G L RG+  SD   L
Sbjct: 61  VQPIDSPLNDYQETSVKLAGIDGVDFAMPFVEGQAMISG-PSADLGALFRGVHKSDLDKL 119

Query: 130 QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSY 189
                         FD G+G+ IG  LAR LG+++GD + +++P G +TPMGM  R K Y
Sbjct: 120 DLVSGNVLLGTLEGFDEGEGIAIGSRLARQLGVTVGDTVRVITPRGSITPMGMTPRVKGY 179

Query: 190 TVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILG 249
            V  +F++   +YD  + +M   EAQLYFN E   +GIEV+  DPDA+      I    G
Sbjct: 180 PVSAIFQIGMSEYDGTIAFMPFNEAQLYFNKEGLATGIEVYADDPDAVGPLRPMIEEEAG 239

Query: 250 NGVVVIDWQQRYQIFFSCYE 269
             V V DW+QR   FFS  E
Sbjct: 240 RPVFVSDWRQRNMTFFSALE 259


>gi|163868356|ref|YP_001609565.1| ABC transporter, permease protein [Bartonella tribocorum CIP
           105476]
 gi|161018012|emb|CAK01570.1| ABC transporter, permease protein [Bartonella tribocorum CIP
           105476]
          Length = 422

 Score =  217 bits (552), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 164/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS +E ++A+RY+  N+K+   S+ S IS IG+M+GV AL+VVM+VMNGFR +++ R+LG
Sbjct: 9   FSSYEWMIAFRYMIPNKKHVVASVISIISLIGIMLGVFALVVVMAVMNGFRTELLNRILG 68

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q       DY+ + + L+    V   LP + GQA V G   GGSG LVRG+  
Sbjct: 69  MNGHLIVQTVDSGFSDYKTLISSLEATNGVKFALPVIEGQALVQGEVQGGSGALVRGMRK 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+           + FD  +GV IG  LA  LG+++G  + I++P GD TP G+ 
Sbjct: 129 QDLEKLKTVSQNIKLGSISRFDEEEGVAIGSGLAEKLGLTVGRDLRIITPDGDETPFGVT 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y V+ +F +   +YD+  V+M L EAQ++FNL + V  +E+F+ DPDA+++    
Sbjct: 189 PRVKAYKVVAIFEVGMSEYDSIFVFMPLHEAQMFFNLGDKVQSLELFLNDPDAVDQIKPV 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           + + +   V +IDW+ R Q FFS  +
Sbjct: 249 VEKAVDQQVYLIDWRTRNQAFFSALQ 274


>gi|92117719|ref|YP_577448.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Nitrobacter hamburgensis X14]
 gi|91800613|gb|ABE62988.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Nitrobacter hamburgensis X14]
          Length = 426

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 162/266 (60%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + RK  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR +++ ++LG
Sbjct: 14  FAAFEWMLSGRYLRARRKEGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRTELLSKILG 73

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL D++ +A+R+  +P +    P V GQA  S      +GV VRGI  
Sbjct: 74  LNGHLLVQPLESPLTDWKDVADRISQVPGIRLAAPVVDGQALASS-PYNAAGVFVRGIRA 132

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           +D + L +          + FD G+GV IG+ LA  L +  GD I +++P G VTPMG  
Sbjct: 133 ADLNNLTSIAKNIKQGTLDGFDDGQGVAIGRRLADQLSLHAGDSITLVAPRGAVTPMGTT 192

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y V  +F +   +YD+  V+M L EAQ YFN  N V+ IE++  +PD I++  ++
Sbjct: 193 PRIKPYKVAAVFEIGMSEYDSTFVFMPLAEAQAYFNRANDVTAIEIYTDNPDKIDEFRKS 252

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  V ++DW+QR   FF+  +
Sbjct: 253 VTEAAGRPVFLVDWRQRNSTFFNALQ 278


>gi|90423928|ref|YP_532298.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Rhodopseudomonas palustris BisB18]
 gi|90105942|gb|ABD87979.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodopseudomonas palustris BisB18]
          Length = 426

 Score =  216 bits (550), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 161/266 (60%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + RK  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 14  FAPFEWLLSGRYLRARRKEGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRKELLDKILG 73

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL D++ +A R++ +  +    P V GQA  S      SGVLVRG+  
Sbjct: 74  LNGHLLVQPLESPLTDWKDVAERINGVAGIRLAAPVVDGQALASS-PFNASGVLVRGMRA 132

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L +            FD G+GV IG+ LA  L +  GD I +++P G VTPMG  
Sbjct: 133 DDLNNLTSIAKNIKQGTLEGFDEGQGVAIGRRLADQLSLHAGDSITLVAPRGAVTPMGTT 192

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y V  +F +   +YD+G V+M L EAQ YFN  + V+ IEVF  +PD I+   ++
Sbjct: 193 PRIKPYKVTAVFEIGMSEYDSGFVFMPLPEAQAYFNRASDVTAIEVFTNNPDKIDAFRKS 252

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  V ++DW+QR   FF+  +
Sbjct: 253 VTEAAGRPVFLVDWRQRNSTFFNALQ 278


>gi|240850600|ref|YP_002972000.1| lipoprotein releasing system transmembrane protein LolC [Bartonella
           grahamii as4aup]
 gi|240267723|gb|ACS51311.1| lipoprotein releasing system transmembrane protein LolC [Bartonella
           grahamii as4aup]
          Length = 422

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS +E ++A+RY+  N+K+   S+ S IS IG+M+GV AL+VVM+VMNGFR +++ R+LG
Sbjct: 9   FSSYEWMIAFRYMIPNKKHVVASVISIISLIGIMLGVFALVVVMAVMNGFRTELLNRILG 68

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH ++Q       DY+ + + L+    V   LP + GQA V G   GGSG LVRG+  
Sbjct: 69  MNGHFIVQTVDSGFSDYKTLISSLESTNGVKFALPVIEGQALVQGEVQGGSGALVRGMRK 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+           + FD  +GV IG  LA  LG+++G  I I++P GD TP G+ 
Sbjct: 129 QDLEKLKTVSQNIKLGSISRFDEEEGVAIGSGLAEKLGLTVGRDIRIITPDGDETPFGVT 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y V+ +F +   +YD+  ++M L EAQ++FNL + V  +E+F+ DPDA+++    
Sbjct: 189 PRVKAYKVVAIFEVGMSEYDSIFIFMPLHEAQMFFNLGDKVQSLELFLNDPDAVDQIKPV 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           + + +   V +IDW+ R Q FFS  +
Sbjct: 249 VEKTVDQQVYLIDWRTRNQAFFSALQ 274


>gi|170742530|ref|YP_001771185.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Methylobacterium sp. 4-46]
 gi|168196804|gb|ACA18751.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylobacterium sp. 4-46]
          Length = 433

 Score =  216 bits (550), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 109/266 (40%), Positives = 158/266 (59%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++A RYL + RK  F+S  +  SF+G+M+GV  LI+V+SVM+GFR++++ +++G
Sbjct: 25  FAPFEWVIAGRYLRTRRKEGFVSAIALFSFLGIMLGVATLIIVLSVMSGFRKELLSKIVG 84

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGHV +     PL DY  ++ RL  +  V   LP V GQAF S  + GGSGVLVRG+  
Sbjct: 85  INGHVFVAPIDKPLTDYADLSERLSKVAGVTLALPMVEGQAFASS-AYGGSGVLVRGVRA 143

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           SD + ++       G    +FD   GV IG+ LA  LG+ +GD I + +P G  TP G  
Sbjct: 144 SDLAQIRAVSGNLRGGTLENFDAAGGVAIGRRLADALGLQVGDTITLATPKGATTPFGTA 203

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y V  +F +   ++D   VYM L EAQ +FN +  V+ IEVF+ + DA+ +    
Sbjct: 204 PRIKGYAVSAIFEVGMSEFDATFVYMPLTEAQAFFNRDGDVTVIEVFLDNADAVGEVRSA 263

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       VV+ DW+QR + FFS  E
Sbjct: 264 LDLAAERPVVLTDWRQRNRTFFSALE 289


>gi|49474194|ref|YP_032236.1| lipoprotein releasing system transmembrane protein lolC [Bartonella
           quintana str. Toulouse]
 gi|49239698|emb|CAF26073.1| Lipoprotein releasing system transmembrane protein lolC [Bartonella
           quintana str. Toulouse]
          Length = 422

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 164/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS +E ++A+RY+  N+K+   S+ S IS IG+M+GV AL+VVM+VMNGFR +++ R+LG
Sbjct: 9   FSSYEWMIAFRYMIPNKKHVVASVISIISLIGIMLGVFALVVVMAVMNGFRTELLNRILG 68

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q       DY+ +   L+ +  V   LP + GQA V G   GGSG LVRG+  
Sbjct: 69  MNGHLIVQTINSGFSDYKTLIPSLESVDGVKFALPVIEGQALVQGDLQGGSGALVRGMRK 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+             FD+ +GV+IG  LA  L +++G  + I++P GD TP G+ 
Sbjct: 129 QDLEKLKTVSQNIKLGSLAQFDKEEGVVIGSGLAEKLRLTVGSDLRIITPDGDATPFGVT 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y V+ +F +   +YD+  V+M L EAQ++FNL + V  +E+F+ DPDA+++    
Sbjct: 189 PRVKAYKVIAIFEVGMSEYDSIFVFMPLYEAQMFFNLGDKVQSLELFLNDPDAVDQIKPI 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           + + +   V +IDW+ R Q FFS  +
Sbjct: 249 VEKAIDQQVYLIDWRMRNQAFFSALQ 274


>gi|298291827|ref|YP_003693766.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Starkeya novella DSM 506]
 gi|296928338|gb|ADH89147.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Starkeya novella DSM 506]
          Length = 441

 Score =  216 bits (549), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 158/266 (59%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +++ RYL + RK  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR +++ ++LG
Sbjct: 29  FSAFEWMLSLRYLRARRKEGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRTELLSKILG 88

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL DY  +A R+  +P +   +P V GQA  S   + G GVLVRG+S 
Sbjct: 89  LNGHILVQPIDSPLTDYDAVAKRIAGVPGIKLAVPLVEGQALASSAFNAG-GVLVRGLSE 147

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           ++   L    +         FD G G+ IGK LA  L +  GD + +++P G VTPMG  
Sbjct: 148 ANLRALPAIGANIRQGTLEGFDEGSGIAIGKRLADQLSLQAGDNLTLVAPRGAVTPMGTT 207

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y +  +F +   +YD+  V+M L E+Q YFN +  V+ IEV+  +PD +E+    
Sbjct: 208 PRIKVYKIAAVFEIGMSEYDSAFVFMPLAESQAYFNKDGDVTAIEVYTDNPDNVERLRSQ 267

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       V +IDW+QR   FF+  +
Sbjct: 268 VQAAAERPVYIIDWRQRNATFFNALQ 293


>gi|49475641|ref|YP_033682.1| lipoprotein releasing system transmembrane protein lolC [Bartonella
           henselae str. Houston-1]
 gi|49238448|emb|CAF27676.1| Lipoprotein releasing system transmembrane protein lolC [Bartonella
           henselae str. Houston-1]
          Length = 422

 Score =  215 bits (547), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 163/266 (61%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS +E ++A+RY+  N+K+   S+ S IS +G+M+GV AL+VVM+VMNGFR +++ R+LG
Sbjct: 9   FSSYEWMIAFRYMIPNKKHVVASVISIISLVGIMLGVFALVVVMAVMNGFRTELLNRILG 68

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH++IQ       DY  +   ++ +  V   LP + GQA V G   GGSG LVRG+  
Sbjct: 69  MNGHLIIQTINSGFSDYNNLIPSIESVNGVKFALPVIEGQALVQGELQGGSGALVRGMRK 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+             FD+ +GV IG  LA  LG++IG  + I++P GD TP G+ 
Sbjct: 129 QDLEKLKTVSENIKLGSLAQFDQEEGVAIGISLAEKLGLTIGSDLRIITPDGDETPFGVT 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y V+ +F +   +YD+  V+M L EAQ +FNL N +  +E+F+ DPD++++    
Sbjct: 189 PRVKAYKVVAIFEVGMSEYDSIFVFMPLHEAQAFFNLGNKIQSLELFLNDPDSVDRIKPI 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           + +++   V +IDW+ R Q FFS  +
Sbjct: 249 LEKLIDQQVYLIDWRTRNQAFFSALQ 274


>gi|86749716|ref|YP_486212.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Rhodopseudomonas palustris HaA2]
 gi|86572744|gb|ABD07301.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodopseudomonas palustris HaA2]
          Length = 426

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 163/266 (61%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + R+  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 14  FAPFEWLLSGRYLRARRREGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRKELLDKILG 73

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL D++ +A+R+  +  +    P + GQA  S      SGVLVRGI  
Sbjct: 74  LNGHLLVQPLESPLTDWKEVADRISGVAGIKLAAPVIDGQALASS-PFNASGVLVRGIRA 132

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L +  +       + FD G+GV IG+ LA  L +  GD + +++P G VTPMG  
Sbjct: 133 DDLNNLSSIANHIKQGTLDGFDEGQGVAIGRRLADQLSLHAGDSVTLVAPRGAVTPMGTT 192

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y +  +F +   +YD+  V+M L+EAQ YFN  N V+ IEV+  +PD I+   ++
Sbjct: 193 PRIKPYKIAAVFEIGMSEYDSTFVFMPLKEAQAYFNRNNDVTAIEVYTTNPDRIDAFRKS 252

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  V ++DW+QR   FF+  +
Sbjct: 253 VTEAAGRPVFLVDWRQRNSTFFNALQ 278


>gi|319408596|emb|CBI82251.1| ABC transporter, permease protein [Bartonella schoenbuchensis R1]
          Length = 426

 Score =  214 bits (545), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 162/266 (60%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS +E ++++RY+  N+K+ F S+ S IS IG+M+GV AL+VVM+VMNGFR +++ R+LG
Sbjct: 13  FSSYEWMISFRYMIPNKKHMFTSVVSIISLIGIMLGVFALVVVMAVMNGFRTELLNRILG 72

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q       DY    + L+ I  V   LP V GQA V G   GG+G L+RG+  
Sbjct: 73  MNGHLIVQTTDSGFSDYNTFISYLESIDGVNSALPVVEGQALVQGDIGGGTGALIRGMRQ 132

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+             F+  +G+ IG  LA  LG++IG  + I++P GDVTP G+ 
Sbjct: 133 EDLEKLKIVSQNIKSGTLAHFEEEEGIAIGSGLAEKLGLTIGSDLRIITPDGDVTPFGVM 192

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y ++ +F +   +YD+  V+M L EAQ +FNL   +  IE+F+ DPD +++  + 
Sbjct: 193 PRIKAYKIIAIFEVGMSEYDSIFVFMPLFEAQAFFNLGQKIQSIELFLNDPDTVDQIKQV 252

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I + +   V +IDW+ R Q FFS  +
Sbjct: 253 IEKEIDQQVYLIDWRMRNQAFFSALQ 278


>gi|316933916|ref|YP_004108898.1| lipoprotein releasing system transmembrane protein
           [Rhodopseudomonas palustris DX-1]
 gi|315601630|gb|ADU44165.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodopseudomonas palustris DX-1]
          Length = 422

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 161/266 (60%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + R+  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 10  FAPFEWLLSGRYLRARRREGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRKELLDKILG 69

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL D++ +A+RL  +  +    P V GQA  S      SGV VRGI  
Sbjct: 70  LNGHLLVQPLESPLTDWKDVADRLSGLQGIKLAAPVVDGQALASS-PFNASGVFVRGIRA 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L +  +       + FD G+GV IG+ LA  L +  GD + +++P G VTPMG  
Sbjct: 129 EDLNRLSSIANHLKQGTLDGFDEGQGVAIGRRLADQLSLHAGDSVTLVAPRGAVTPMGTT 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y V  +F +   +YD+  V+M L+EAQ YFN  N V+ IEV+  +PD I+   + 
Sbjct: 189 PRIKPYKVAAVFEIGMSEYDSTFVFMPLKEAQAYFNRANDVTAIEVYTDNPDRIDVYRKA 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  V ++DW+QR   FF+  +
Sbjct: 249 VTEAAGRPVFLVDWRQRNSTFFNALQ 274


>gi|319405681|emb|CBI79304.1| ABC transporter, permease protein [Bartonella sp. AR 15-3]
          Length = 427

 Score =  213 bits (542), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 109/266 (40%), Positives = 167/266 (62%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS ++ ++A+RY+  N+K+ F SI S IS IG+M+GV AL+VVM+VMNGFR +++ R+LG
Sbjct: 14  FSSYQWMIAFRYMIPNKKHMFTSIISIISLIGIMLGVFALVVVMAVMNGFRTELLSRILG 73

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+V+Q       DY  + + L+ I D+  VLP + GQA V G   GG+G LVRG+  
Sbjct: 74  MNGHLVVQTIDSNFTDYNILISSLESIKDIKFVLPIIEGQALVQGNIEGGTGALVRGVRQ 133

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+             FD+ +GV IG  LA  LG+++G  + I++P GD TP G+ 
Sbjct: 134 EDLRKLKTVAQNIISGTLAQFDKEEGVAIGSALAEKLGLTVGSNLRIITPNGDDTPFGVT 193

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y V+ +F +   +YD+  V+M L EAQ++FNL+  +  +E+F+ DPDAI++    
Sbjct: 194 PRVKAYKVIAIFEVGMSEYDSIFVFMPLHEAQIFFNLDEKIQSLELFLNDPDAIDQIKPI 253

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I + +   + +IDW+ R Q FFS  +
Sbjct: 254 IEKTVIQPINIIDWRMRNQAFFSALQ 279


>gi|91977334|ref|YP_569993.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Rhodopseudomonas palustris BisB5]
 gi|91683790|gb|ABE40092.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodopseudomonas palustris BisB5]
          Length = 422

 Score =  213 bits (541), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 162/266 (60%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + R+  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 10  FAPFEWLLSGRYLRARRREGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRKELLDKILG 69

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL D++ +A+R+  +  +    P + GQA  S      SGVLVRGI  
Sbjct: 70  LNGHLLVQPLESPLTDWKDVADRISGVQGIKLAAPVIDGQALASS-PFNASGVLVRGIRA 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L +  +         FD G+GV IG+ LA  L +  GD + +++P G VTPMG  
Sbjct: 129 DDLNNLSSIANHIKQGTLEGFDDGQGVAIGRRLADQLSLHAGDSVTLVAPRGAVTPMGTT 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y +  +F +   +YD+  V+M L+EAQ YFN  N V+ IEV+  +PD I+   ++
Sbjct: 189 PRIKPYKITAVFEIGMSEYDSTFVFMPLKEAQAYFNRNNDVTAIEVYTTNPDRIDAFRKS 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  V ++DW+QR   FF+  +
Sbjct: 249 VTEAAGRPVFLVDWRQRNSTFFNALQ 274


>gi|27379987|ref|NP_771516.1| ABC transporter permease [Bradyrhizobium japonicum USDA 110]
 gi|27353141|dbj|BAC50141.1| bll4876 [Bradyrhizobium japonicum USDA 110]
          Length = 426

 Score =  212 bits (540), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 160/266 (60%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + RK  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 14  FAPFEWMLSARYLRARRKEGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRKELLDKILG 73

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL D++ +A+R+  +  +    P V GQA  S      SGVLVRGI +
Sbjct: 74  LNGHILVQPLESPLTDWKDVADRISQVQGIRLAAPVVDGQALASS-PWNASGVLVRGIRS 132

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L +            FD G+GV IG+ LA  L +  GD I +++P G VTPMG  
Sbjct: 133 DDLNNLTSIAKNIKQGSLEGFDDGQGVAIGRRLADQLSLHAGDSITLVAPKGAVTPMGTT 192

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y ++ +F +   +YD G V+M L EAQ YFN  N V+ IEVF  +PD I   ++ 
Sbjct: 193 PRIKPYKIVAVFEIGMSEYDLGFVFMPLAEAQAYFNRSNDVTSIEVFTTNPDRIVAFNKA 252

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       V ++DW+QR   FF+  +
Sbjct: 253 VTEAAARPVFLVDWRQRNSTFFNALQ 278


>gi|304391640|ref|ZP_07373582.1| lipoprotein releasing system transmembrane protein [Ahrensia sp.
           R2A130]
 gi|303295869|gb|EFL90227.1| lipoprotein releasing system transmembrane protein [Ahrensia sp.
           R2A130]
          Length = 440

 Score =  211 bits (538), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 118/266 (44%), Positives = 158/266 (59%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSRFE ++A RYL S RK  FIS+ S ISF+G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 28  FSRFEWMLARRYLGSRRKETFISVISIISFVGIMLGVATLIIVMAVMNGFRTELLDRILG 87

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+++    Y L DY  +A+RL+ +  VI   P + G+   S    GGSG  VRG+  
Sbjct: 88  INGHLIVAPTEYALTDYDAVASRLEAVDGVIYAFPLIEGEVLAS-GGKGGSGARVRGMRE 146

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L +  S       + FD G GV IG  +ARNL + +GD I +++P G+ T  G+ 
Sbjct: 147 GDLKRLPSVGSNIVEGTLDGFDAGDGVAIGAVMARNLNLYLGDSITLVTPDGNKTAFGVT 206

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R KSY V  +F M   +YDN  V+M L EAQLYFN E  V  IE F+ D D +EK    
Sbjct: 207 PRVKSYPVTAIFEMGMSEYDNIFVFMPLLEAQLYFNKEQVVDVIETFITDADDVEKMRGP 266

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + V DW+QR   FFS  E
Sbjct: 267 MEAGAERPISVSDWRQRNASFFSALE 292


>gi|209885077|ref|YP_002288934.1| lipoprotein releasing system transmembrane protein LolC
           [Oligotropha carboxidovorans OM5]
 gi|209873273|gb|ACI93069.1| lipoprotein releasing system transmembrane protein LolC
           [Oligotropha carboxidovorans OM5]
          Length = 422

 Score =  211 bits (538), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 161/266 (60%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + RK  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 10  FAAFEWLISARYLRARRKEGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRKELLDKILG 69

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL D++ +A+R++ +  V    P V GQA  S      SGVLVRGI +
Sbjct: 70  LNGHLLVQPLESPLTDWKDVADRINGVTGVRLAAPIVEGQALASS-PFNASGVLVRGIRS 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           +D   L +            FD G+GV IG+ LA  L +  GD + +++P G VTPMG  
Sbjct: 129 ADLDKLTSIAKNIKQGTLEGFDEGQGVAIGRRLADQLSLRAGDTVTLVAPRGAVTPMGTT 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y V  +F +   +YD+  V+M L EAQ YFN  + V+ IE++  +PD ++   ++
Sbjct: 189 PRIKPYKVAAVFEIGMSEYDSSFVFMPLVEAQAYFNRPSDVTAIEIYTDNPDKVDAYRKS 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR   FF+  +
Sbjct: 249 VAEAAERPIFMVDWRQRNSTFFNALQ 274


>gi|299135008|ref|ZP_07028199.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Afipia sp. 1NLS2]
 gi|298589985|gb|EFI50189.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Afipia sp. 1NLS2]
          Length = 422

 Score =  211 bits (537), Expect = 8e-53,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 161/266 (60%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + RK  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 10  FAPFEWLISARYLRARRKEGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRKELLDKILG 69

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL D++ +A+R++ +  +    P V GQA  S      SGVLVRGI  
Sbjct: 70  LNGHLLVQPLESPLTDWKEVADRINGVQGIRLAAPIVEGQALASS-PFNASGVLVRGIRA 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           +D   L +            FD G+GV IG+ LA  L +  GD + +++P G VTPMG  
Sbjct: 129 ADLEKLTSISKNIKQGTLEGFDDGQGVAIGRRLADLLSLHAGDTVTLVAPRGAVTPMGTT 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y V  +F +   +YD+  V+M L+EAQ YFN  N V+ IE++  +PD +++  + 
Sbjct: 189 PRIKPYKVAAVFEIGMSEYDSSFVFMPLKEAQAYFNRPNDVTAIEIYTDNPDKVDEYRKA 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       + ++DW+QR   FF+  +
Sbjct: 249 VAEAAQRPIFMVDWRQRNSTFFNALQ 274


>gi|39935992|ref|NP_948268.1| lipoprotein releasing system transmembrane protein LolC/E family
           [Rhodopseudomonas palustris CGA009]
 gi|39649846|emb|CAE28368.1| possible ABC type permease; lipoprotein releasing factor
           [Rhodopseudomonas palustris CGA009]
          Length = 426

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 159/266 (59%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + R+  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 14  FAPFEWLISGRYLRARRREGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRKELLDKILG 73

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL D++ +A+RL  +  +    P V GQA  S      SGV VRGI  
Sbjct: 74  LNGHLLVQPLESPLTDWKDVADRLSGVQGIKLAAPVVDGQALASS-PFNASGVFVRGIRA 132

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L +  +         FD  +GV IG+ LA  L +  GD I +++P G VTPMG  
Sbjct: 133 DDLNRLSSIANHLKQGTLEGFDDSQGVAIGRRLADQLSLHAGDSITLVAPRGAVTPMGTT 192

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y V  +F +   +YD+  V+M L+EAQ YFN  N V+ IEV+  +PD I+   + 
Sbjct: 193 PRIKPYKVAAVFEIGMSEYDSTFVFMPLKEAQAYFNRANDVTAIEVYTDNPDRIDVFRKA 252

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  V ++DW+QR   FF+  +
Sbjct: 253 VTEAAGRPVFLVDWRQRNSTFFNALQ 278


>gi|319404242|emb|CBI77835.1| ABC transporter, permease protein [Bartonella rochalimae ATCC
           BAA-1498]
          Length = 426

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 166/266 (62%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS +E ++A+RY+  N+K+ F SI S IS IG+M+GV AL+VVM+VMNGFR +++ R+LG
Sbjct: 13  FSSYEWMIAFRYMIPNKKHMFTSIISIISLIGIMLGVFALVVVMAVMNGFRTELLNRILG 72

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q       DY  + + L+ I D+  VLP + GQA V G    G+G LVRG+  
Sbjct: 73  MNGHLIVQTIDSNFTDYNTLISSLESIKDIKLVLPIIEGQALVQGNVERGTGALVRGVRQ 132

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+             FD+ +G+ IG  LA  LG+++G  + I++P GD TP G+ 
Sbjct: 133 KDLMKLKTVAQNIISGTLAQFDKEEGIAIGSGLAEKLGLTVGSHLRIITPDGDDTPFGVT 192

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y V+ +F +   +YD+  V+M L EAQ++FNLE  +  +E+F+ DPDAI++    
Sbjct: 193 PRVKAYKVVAIFEVGMSEYDSIFVFMPLHEAQIFFNLEEKIQSLELFLNDPDAIDQVKPV 252

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I + +   + +IDW+ + Q FFS  +
Sbjct: 253 IEKTVNQQIHLIDWRTQNQSFFSALQ 278


>gi|192291647|ref|YP_001992252.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodopseudomonas palustris TIE-1]
 gi|192285396|gb|ACF01777.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodopseudomonas palustris TIE-1]
          Length = 422

 Score =  210 bits (535), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 159/266 (59%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + R+  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 10  FAPFEWLISGRYLRARRREGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRKELLDKILG 69

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL D++ +A+RL  +  +    P V GQA  S      SGV VRGI  
Sbjct: 70  LNGHLLVQPLESPLTDWKDVADRLSGVQGIKLAAPVVDGQALASS-PFNASGVFVRGIRA 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L +  +         FD  +GV IG+ LA  L +  GD I +++P G VTPMG  
Sbjct: 129 DDLNRLSSIANHLKQGTLEGFDDSQGVAIGRRLADQLSLHAGDSITLVAPRGAVTPMGTT 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y V  +F +   +YD+  V+M L+EAQ YFN  N V+ IEV+  +PD I+   + 
Sbjct: 189 PRIKPYKVAAVFEIGMSEYDSTFVFMPLKEAQAYFNRANDVTAIEVYTDNPDRIDVFRKA 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  V ++DW+QR   FF+  +
Sbjct: 249 VTEAAGRPVFLVDWRQRNSTFFNALQ 274


>gi|319407250|emb|CBI80889.1| ABC transporter, permease protein [Bartonella sp. 1-1C]
          Length = 426

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 107/266 (40%), Positives = 166/266 (62%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS +E ++A+RY+  N+K+ F SI S IS IG+M+GV AL+VVM+VMNGFR +++ R+LG
Sbjct: 13  FSSYEWMIAFRYMIPNKKHMFTSIISIISLIGIMLGVFALVVVMAVMNGFRTELLNRILG 72

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q       DY  + + L+ I D+  VLP + GQA V G    G+G LVRG+  
Sbjct: 73  MNGHLIVQTIDSNFTDYNTLISSLESIKDIKLVLPIIEGQALVQGNLERGTGALVRGVRQ 132

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+             FD+ +G+ IG  LA  LG+++G  + I++P GD TP G+ 
Sbjct: 133 KDLMKLKTVAQNISSGTLAQFDKEEGIAIGSGLAEKLGLTVGSHLRIITPDGDDTPFGVT 192

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y V+ +F +   +YD+  V+M L EAQ++FNLE  +  +E+F+ DPDAI++    
Sbjct: 193 PRVKAYKVVAIFEVGMSEYDSIFVFMPLHEAQIFFNLEEKIQSLELFLNDPDAIDQIKPV 252

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I + +   + +IDW+ + Q FFS  +
Sbjct: 253 IEKTVNQQIHLIDWRTQNQSFFSALQ 278


>gi|154248382|ref|YP_001419340.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Xanthobacter autotrophicus Py2]
 gi|154162467|gb|ABS69683.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Xanthobacter autotrophicus Py2]
          Length = 447

 Score =  210 bits (534), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 105/266 (39%), Positives = 159/266 (59%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +++ RYL + RK  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 35  FSAFEWMLSLRYLRARRKEGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRQELLGKILG 94

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGHV++Q    PL DY  +A+R+  +  +   +P V GQA  S    G SGVLVRG++ 
Sbjct: 95  LNGHVLVQPLESPLTDYAAVADRIAKLNGIRLAVPLVEGQALASS-PFGASGVLVRGLAE 153

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L +           +FD+G+G+ IGK LA  L +  GD + +++P G VTPMG  
Sbjct: 154 KDLRELPSVAHNIRQGTLENFDQGQGIAIGKRLADQLSLHAGDNLTLVAPRGAVTPMGTS 213

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y V  +F +   +YD+  V+M L EAQ YFN    V+ IEV++ +PD + +    
Sbjct: 214 PRIKVYKVAAVFEVGMSEYDSAFVFMPLAEAQAYFNRNADVNAIEVYLNNPDDVGELRGA 273

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I       V ++DW+ R   FF+  +
Sbjct: 274 IQSAAERPVYLVDWRVRNATFFNALQ 299


>gi|220924024|ref|YP_002499326.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylobacterium nodulans ORS 2060]
 gi|219948631|gb|ACL59023.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylobacterium nodulans ORS 2060]
          Length = 428

 Score =  209 bits (532), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 108/266 (40%), Positives = 153/266 (57%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++A RYL + RK  F+S  +  SF+G+M+GV  LI+V+SVM+GFR++++ +++G
Sbjct: 20  FAPFEWVIAGRYLRTRRKEGFVSAIALFSFLGIMLGVATLIIVLSVMSGFRKELLSKIVG 79

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGHV +     PL DY  ++ RL  +  V   LP V GQAF S    GGSGVLVRG+  
Sbjct: 80  INGHVFVAPIDKPLTDYADLSERLSKVAGVSLALPMVEGQAFASS-PYGGSGVLVRGVRA 138

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   +Q       G     FD   GV IG+ LA  LG+  GD I + +P G  TP G  
Sbjct: 139 EDLKKIQAVSGNIRGGTLEGFDTAGGVAIGRRLAEALGLQAGDTITLATPKGATTPFGTA 198

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y V  +F +   ++D   VYM L EAQ +FN +  V+ IEVF+ + D++ +    
Sbjct: 199 PRIKGYNVAAIFEVGMSEFDATFVYMPLSEAQGFFNRDGDVTVIEVFLDNADSVGELRSA 258

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       VV+ DW+QR + FFS  E
Sbjct: 259 LELAAERPVVLTDWRQRNRTFFSALE 284


>gi|146341082|ref|YP_001206130.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Bradyrhizobium sp. ORS278]
 gi|146193888|emb|CAL77905.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Bradyrhizobium sp. ORS278]
          Length = 426

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 160/269 (59%), Gaps = 7/269 (2%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + R+  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 14  FAPFEWMLSGRYLRARRREGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRKELLDKILG 73

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSG---GSGVLVRG 120
           +NGH+++Q    PL D++ ++ R+  +  +    P V GQ    GL S     SGV +RG
Sbjct: 74  LNGHLLVQPLESPLTDWKDVSERISQVQGIRLAAPVVDGQ----GLGSSPFNASGVFIRG 129

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           I + D + L +            FD G+GV IG+ LA  L +  GD I +++P G VTPM
Sbjct: 130 IRSQDLTNLTSIAKNIKQGTLEGFDEGQGVAIGRRLADLLSLHAGDSITLVAPKGAVTPM 189

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G   R K Y V  +F +   +YD+  V+M L EAQ YFN  N V+ IE+F  +PD +E+ 
Sbjct: 190 GTTPRIKPYKVAAVFEIGMSEYDSSFVFMPLAEAQAYFNRNNDVTAIEIFTSNPDKVEQF 249

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + +    G  V ++DW+QR   FF+  +
Sbjct: 250 RKTVTEAAGRPVFLVDWRQRNSTFFNALQ 278


>gi|85717004|ref|ZP_01047967.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Nitrobacter sp. Nb-311A]
 gi|85696206|gb|EAQ34101.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Nitrobacter sp. Nb-311A]
          Length = 426

 Score =  209 bits (531), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 159/266 (59%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + RK  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR +++ ++LG
Sbjct: 14  FAAFEWMLSGRYLRARRKEGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRTELLSKILG 73

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL D++ +A+R+  +  +    P V GQA  S      +GV VRGI  
Sbjct: 74  LNGHLLVQPLESPLTDWKDVADRVSQVQGIRLAAPVVDGQALASS-PYNAAGVFVRGIRA 132

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           +D + L +            FD G+GV IG+ LA  L +  GD + +++P G VTPMG  
Sbjct: 133 NDLNNLTSIAKNIKQGTLEGFDDGQGVAIGRRLADQLSLHAGDSVTLVAPRGAVTPMGTT 192

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y +  +F +   +YD+  V+M L EAQ YFN  N V+ IEV+  +PD I+   ++
Sbjct: 193 PRIKPYKIAAVFEIGMSEYDSTFVFMPLAEAQAYFNRANDVTAIEVYTDNPDKIDDFRKS 252

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  V ++DW+QR   FF+  +
Sbjct: 253 VTESAGRPVFLVDWRQRNSTFFNALQ 278


>gi|115524552|ref|YP_781463.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Rhodopseudomonas palustris BisA53]
 gi|115518499|gb|ABJ06483.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodopseudomonas palustris BisA53]
          Length = 426

 Score =  209 bits (531), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 103/266 (38%), Positives = 159/266 (59%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + RK  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 14  FAPFEWLLSGRYLRARRKEGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRKELLDKILG 73

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL D++ +A+R++ +  V    P V GQA  S      SGV VRGI  
Sbjct: 74  LNGHLLVQPLESPLTDWKDVADRINGVSGVRLAAPVVDGQALASS-PFNASGVFVRGIRA 132

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L +            F+ G+GV IG+ LA  L +  GD + +++P G VTPMG  
Sbjct: 133 EDLNNLTSIAKNLKQGTIEGFNEGQGVAIGRRLADQLSLHAGDSVTLVAPRGAVTPMGTT 192

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y V  +F +   +YD+  V+M L EAQ YFN  + V+ IEV+  +PD I+   + 
Sbjct: 193 PRIKPYKVAAVFEIGMSEYDSTFVFMPLAEAQAYFNRASDVTAIEVYTTNPDKIDSFRKL 252

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  V ++DW+QR   FF+  +
Sbjct: 253 VTEAAGRPVFLVDWRQRNSTFFNALQ 278


>gi|75676055|ref|YP_318476.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Nitrobacter winogradskyi Nb-255]
 gi|74420925|gb|ABA05124.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Nitrobacter winogradskyi Nb-255]
          Length = 426

 Score =  208 bits (530), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 158/266 (59%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + RK  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR +++ ++LG
Sbjct: 14  FAAFEWMLSGRYLRARRKEGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRTELLSKILG 73

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q    PL D++ +A R+  +  +    P V GQA  S      +GV VRGI  
Sbjct: 74  LNGHLLVQPLESPLTDWKEVAERVSQVKGIRLAAPVVDGQALGSS-PYNAAGVFVRGIRA 132

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D + L +          + FD G+GV IG+ LA  L +  GD + +++P G VTPMG  
Sbjct: 133 DDLNNLTSIARNIKQGTLDGFDEGQGVAIGRRLADQLSLHAGDSVTLVAPRGAVTPMGTT 192

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y +  +F +   +YD+  V+M L EAQ YFN  N V+ IEV+  +PD I+   ++
Sbjct: 193 PRIKPYKIAAVFEIGMSEYDSTFVFMPLAEAQAYFNRANDVTSIEVYTDNPDKIDDFRKS 252

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  V ++DW+QR   FF+  +
Sbjct: 253 VTEAAGRPVFLVDWRQRNSTFFNALQ 278


>gi|148255882|ref|YP_001240467.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Bradyrhizobium sp. BTAi1]
 gi|146408055|gb|ABQ36561.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Bradyrhizobium sp. BTAi1]
          Length = 426

 Score =  207 bits (527), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 103/269 (38%), Positives = 159/269 (59%), Gaps = 7/269 (2%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + R+  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 14  FAPFEWMLSGRYLRARRREGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRKELLDKILG 73

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSG---GSGVLVRG 120
           +NGH+++Q    PL D++ ++ R+  +  +    P V GQ    GL S     SGV +RG
Sbjct: 74  LNGHLLVQPLESPLTDWKDVSERISQVQGIRLAAPVVDGQ----GLGSSPFNASGVFIRG 129

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           I + D   L +            FD G+GV IG+ LA  L +  GD I +++P G VTPM
Sbjct: 130 IRSQDLVNLTSIAKNIKQGTLEGFDEGQGVAIGRRLADLLSLHAGDSITLVAPKGAVTPM 189

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G   R K Y V  +F +   +YD+  V+M L EAQ YFN  N V+ IE+F  +PD +E+ 
Sbjct: 190 GTTPRIKPYKVAAVFEIGMSEYDSSFVFMPLSEAQAYFNRNNDVTAIEIFTSNPDKVEQF 249

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + +    G  V ++DW+QR   FF+  +
Sbjct: 250 RKTVTEAAGRPVFLVDWRQRNSTFFNALQ 278


>gi|23012408|ref|ZP_00052501.1| COG4591: ABC-type transport system, involved in lipoprotein
           release, permease component [Magnetospirillum
           magnetotacticum MS-1]
          Length = 414

 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 160/267 (59%), Gaps = 2/267 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           IF+ FE +VA+RYL + RK  FIS+ +  S  G+ +GV  LIVVM+VMNGFR +++ R+L
Sbjct: 2   IFNSFERMVAFRYLRARRKEGFISVIAGFSLAGIGLGVATLIVVMAVMNGFRHELLGRIL 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           GINGH+ +     PL  Y  +A  +  +P V KV+P   GQ F +  + GG+G +VRG+ 
Sbjct: 62  GINGHIGVYGSGAPLSGYDPLAESIRKLPGVTKVIPTAEGQVFATS-AGGGTGAIVRGVR 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
             D    +  F + Y     DF     V+IGK LA  LG+ IGD ++++SP G+VT  G 
Sbjct: 121 AEDL-LTRPVFQKKYRGNPADFAGDDAVVIGKRLAEKLGVRIGDSVSLISPKGNVTAFGT 179

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R + Y V+G F +   +YD+G V+M L+ AQ YF L   V+ IEVF+++PD + +T +
Sbjct: 180 VPRMRGYRVVGTFDVGMFEYDSGFVFMPLEAAQTYFRLPQLVTQIEVFLENPDMVPETRK 239

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            I  + G+   + DWQQ    FF+  +
Sbjct: 240 AIWDLTGSSATIYDWQQANANFFNAIQ 266


>gi|300023434|ref|YP_003756045.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525255|gb|ADJ23724.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Hyphomicrobium denitrificans ATCC 51888]
          Length = 423

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 104/264 (39%), Positives = 157/264 (59%), Gaps = 1/264 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++A RYL + RK  FIS+ +  SF+G+M+GV  LI+VM+VMNGFR D+  +++G
Sbjct: 11  FSSFEWMIAGRYLRARRKEGFISVIAGFSFLGIMLGVATLIIVMAVMNGFRHDLFSKIMG 70

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGHV++Q+      DY+ +A+++  +P V   +P + GQ  VS  SS   G LVRG+  
Sbjct: 71  LNGHVIVQKLGERFDDYEQMADKIARVPGVQVAMPVIEGQVMVSS-SSQALGGLVRGVRE 129

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           SD   L+           + FD   G+ IG  LA  L + +GD I ++SP G  TP G  
Sbjct: 130 SDLKALKLVSGNIRAGTLDGFDEQTGIAIGVRLANQLHVGLGDSITLVSPRGAATPFGTA 189

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            RSK Y +  +F +   +YD  M++M L+EAQ YF+    V  +EV V DP+ ++K   +
Sbjct: 190 PRSKPYQITSIFELGMSEYDRMMIFMPLKEAQKYFSKGGEVDVVEVIVNDPENVDKFRTD 249

Query: 244 IVRILGNGVVVIDWQQRYQIFFSC 267
           I++  G  + V DW+QR + FF+ 
Sbjct: 250 ILQAGGPSIAVADWRQRNETFFNV 273


>gi|83311671|ref|YP_421935.1| ABC-type transport system, permease component [Magnetospirillum
           magneticum AMB-1]
 gi|82946512|dbj|BAE51376.1| ABC-type transport system, permease component [Magnetospirillum
           magneticum AMB-1]
          Length = 414

 Score =  206 bits (524), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 108/267 (40%), Positives = 160/267 (59%), Gaps = 2/267 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           IF+ FE +VA+RYL + RK  FIS+ +  S  G+ +GV  LIVVM+VMNGFR +++ R+L
Sbjct: 2   IFNSFERMVAFRYLRARRKEGFISVIAGFSLAGIGLGVATLIVVMAVMNGFRHELLGRIL 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           GINGH+ +     PL  Y  +A+ +  +P V +V+P   GQ F +  S GG+G +VRG+ 
Sbjct: 62  GINGHIGVYGSGAPLSGYDPLADSIRKLPGVTRVIPTAEGQVFATS-SGGGTGAIVRGVR 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
             D    +  F + Y     DF     V+IGK LA  LG+ IGD I+++SP G+VT  G 
Sbjct: 121 GQDL-LTRPVFQKKYRGNPADFAGDDAVVIGKRLADKLGVRIGDSISLISPKGNVTAFGT 179

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R + Y V+G F +   +YD+G ++M L+ AQ YF L   V+ IEVF+++PD + +T +
Sbjct: 180 VPRMRGYRVVGTFDVGMFEYDSGFIFMPLEAAQTYFRLPEQVTQIEVFLENPDMVPETRK 239

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            I  + G    + DWQQ    FF+  +
Sbjct: 240 AIWDLTGTTATIYDWQQANANFFNAIQ 266


>gi|182678767|ref|YP_001832913.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Beijerinckia indica subsp. indica ATCC 9039]
 gi|182634650|gb|ACB95424.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Beijerinckia indica subsp. indica ATCC 9039]
          Length = 439

 Score =  206 bits (523), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 102/264 (38%), Positives = 158/264 (59%), Gaps = 2/264 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++A RYL + R   F+S+ +  SF+G+ +GV  LIVVMSVMNGF ++++ +++G
Sbjct: 28  FAPFEWMIALRYLRARRSQGFVSVIAGFSFLGITLGVATLIVVMSVMNGFHKELLDKIVG 87

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+ +Q    PL DY+ + +++D +P +   LP V   A  S  ++  +  LVRGI  
Sbjct: 88  INGHIFLQATESPLTDYESVVHQIDGLPGIELALPLVEAPAAAS--TTNMAFALVRGIRE 145

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L            + FD+  GV+IG+ LA NLG+ +GDKI +L+  G  TP G+ 
Sbjct: 146 VDLKRLPGIAGHVTLGTLDGFDKAGGVVIGQRLAENLGLGLGDKIKLLTANGTQTPFGVT 205

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            RSK YTV G+F++   ++DN  VY+ L EAQ +FN E   S IE+F+ DPD I+     
Sbjct: 206 PRSKVYTVTGIFQIGMAEFDNLFVYLPLPEAQAFFNKEGEASVIEIFLTDPDRIDAARHV 265

Query: 244 IVRILGNGVVVIDWQQRYQIFFSC 267
           +   +   +++ DW++R + FF  
Sbjct: 266 LQDHITRPMIMTDWRERNRTFFDA 289


>gi|323139096|ref|ZP_08074154.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylocystis sp. ATCC 49242]
 gi|322395660|gb|EFX98203.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylocystis sp. ATCC 49242]
          Length = 430

 Score =  205 bits (522), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 106/270 (39%), Positives = 160/270 (59%), Gaps = 9/270 (3%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VA RYL + R + F+S+ +  SF+G+M+GV  LIVV SVMNGF  +++ +++G
Sbjct: 18  FSAFEWMVALRYLRARRADGFVSVIAGFSFLGIMLGVATLIVVTSVMNGFHRELMDKIMG 77

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH  +Q    P  D+  +A + + +P V   +P V G A +S    G SGVLVRG+  
Sbjct: 78  INGHAFLQAVETPFTDWDDVAGKTEKVPGVKLAIPMVEGAAGIS-TQFGQSGVLVRGVRE 136

Query: 124 SDFSYLQNSFSRFYGNVSND----FDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
            D   L        GNV +     FD G+ V IG+ LA NLG+++GDK+++L   G  TP
Sbjct: 137 KDIMRLPG----VTGNVKDGSFKGFDAGESVAIGQRLAENLGVAVGDKVSLLIAKGAQTP 192

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G+  R K+Y V  +F +   ++DN  VYM L EAQ +FN +N  + +E FV DP+ ++ 
Sbjct: 193 FGVAPRIKAYKVAAIFSIGMSEFDNVFVYMPLAEAQAFFNKDNEATVVEAFVDDPEQMDA 252

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              N+ + +   ++V DW+QR + FF   +
Sbjct: 253 FRANLEKAVTRPIIVTDWRQRNKTFFDTLQ 282


>gi|190891306|ref|YP_001977848.1| probable lipoprotein ABC transporter, permease protein [Rhizobium
           etli CIAT 652]
 gi|190696585|gb|ACE90670.1| probable lipoprotein ABC transporter, permease protein [Rhizobium
           etli CIAT 652]
          Length = 381

 Score =  205 bits (521), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 143/237 (60%), Gaps = 8/237 (3%)

Query: 37  MIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKV 96
           M+GV  LI+VM+VMNGFR +++ R+LGINGH+++Q    P  DY  + +RL  +P V   
Sbjct: 1   MLGVATLIIVMAVMNGFRTELVSRILGINGHMIVQPSDGPFTDYTDLTSRLAAVPGVKMA 60

Query: 97  LPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSN----DFDRGKGVII 152
           LP V GQ   S  + G +G LVRG    D + L+       GN+ +     F  G+GV+I
Sbjct: 61  LPLVEGQVLASAQAGGSTGALVRGARAEDLTKLKT----ISGNIKSGDMVGFASGQGVLI 116

Query: 153 GKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQ 212
           G  +A  LG+S+GD I + SP GD+TPMG+  R KSY + G+F +   +YD+ +++M L+
Sbjct: 117 GTGMANQLGLSVGDLITLTSPDGDITPMGVSPRVKSYKISGLFEIGMSEYDSSIIFMPLE 176

Query: 213 EAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           E+QL+FN E  V  IE+FV  PD I+     +    G  + + DW+QR Q FFS  +
Sbjct: 177 ESQLFFNAEGLVQSIELFVDHPDDIDALRSKVEEAAGRQINLTDWRQRNQTFFSALQ 233


>gi|158423311|ref|YP_001524603.1| lipoprotein releasing system transmembrane protein [Azorhizobium
           caulinodans ORS 571]
 gi|158330200|dbj|BAF87685.1| lipoprotein releasing system transmembrane protein [Azorhizobium
           caulinodans ORS 571]
          Length = 440

 Score =  202 bits (514), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 99/266 (37%), Positives = 159/266 (59%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +++ RYL + RK  FIS+ +  SF+G+++GV  LI+VM+VMNGFR++++ ++LG
Sbjct: 28  FAAFEWMLSLRYLRARRKEGFISVIAGFSFVGIVLGVATLIIVMAVMNGFRQELLGKILG 87

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+++Q     L DY  +A+R+  +  +   +P V GQA  S      SGVLVRG++ 
Sbjct: 88  LNGHMLVQPLENALTDYTAVADRISKLNGIKLAVPVVEGQALASS-PYNASGVLVRGLAE 146

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   + +  +       + FD+G+G+ IGK LA  L +  GD I +++P G VTPMG  
Sbjct: 147 KDLRSMPSVANNIRQGTLDGFDQGQGLAIGKRLADQLSLRAGDNITLVAPRGSVTPMGTS 206

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y +  +F +   +YD+  V+M L EAQ YFN    V+ IEV++ +PD + +    
Sbjct: 207 PRIKVYKIAAVFEIGMSEYDSAFVFMPLPEAQAYFNRNGDVNAIEVYIANPDDVGELRGA 266

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       V ++DW+QR   FF+  +
Sbjct: 267 VQAAAQRPVYIVDWRQRNATFFNALQ 292


>gi|306841941|ref|ZP_07474619.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brucella sp. BO2]
 gi|306287974|gb|EFM59382.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brucella sp. BO2]
          Length = 381

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 96/233 (41%), Positives = 140/233 (60%)

Query: 37  MIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKV 96
           M+GV  LI+VM+VMNGFR +++ R+LGINGH+++Q    PL DY  +  R+D IP +   
Sbjct: 1   MLGVATLIIVMAVMNGFRAELLTRILGINGHLIMQPIDRPLDDYADLIKRVDAIPGIKFA 60

Query: 97  LPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDL 156
           +P V GQA V G    G+G LVRG+   D   L+   +         FD   GV IG  +
Sbjct: 61  IPVVEGQALVQGNIGAGTGALVRGLREEDLDKLKLISTNIRQGTLKGFDHSGGVAIGTRM 120

Query: 157 ARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQL 216
           A NLG+S+GD + ++SP GDVTP G+  R K+Y ++ +F +   +YD+ +V M L EAQL
Sbjct: 121 AENLGLSVGDTLRVISPDGDVTPFGVNPRVKAYPIVAIFEIGMSEYDSSIVMMPLSEAQL 180

Query: 217 YFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +FN E  V  +E+FV +PD ++     +       + ++DW+QR Q FFS  E
Sbjct: 181 FFNQEGKVQSLEIFVDNPDKVDAMRAPVEEAAARQLSLVDWRQRNQTFFSALE 233


>gi|296446276|ref|ZP_06888222.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylosinus trichosporium OB3b]
 gi|296256177|gb|EFH03258.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylosinus trichosporium OB3b]
          Length = 457

 Score =  202 bits (513), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 101/271 (37%), Positives = 159/271 (58%), Gaps = 5/271 (1%)

Query: 1   MSIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKR 60
           + +F+ FE +VA RY+ + R N F+S+ +  SF+G+ +GV  LIVVMSVMNGF ++++ +
Sbjct: 42  LRLFAPFEWVVALRYVRARRANGFVSVIAGFSFLGITLGVATLIVVMSVMNGFHKELMDK 101

Query: 61  VLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSS--GGSGVLV 118
           ++GI+GH  +Q    PL D+  + +++  +P    V+P V G A   G+SS  G SG LV
Sbjct: 102 IVGIDGHAFVQAVERPLTDWAQVTDQMQRLPGAKLVIPMVEGAA---GISSPYGQSGALV 158

Query: 119 RGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           RG+   D   L              FD   GV +G+ LA  LGI +GD +++L   G  T
Sbjct: 159 RGMREQDLLRLPGMTGNVKDGTLEGFDAAGGVALGQRLAETLGIRVGDSVSLLIAKGAST 218

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K+Y V+ +F++   +YD   VYM L E+QL+FN EN  + IE F+ DP A++
Sbjct: 219 PFGVAPRIKAYPVVAIFQIGMSEYDRVFVYMPLAESQLFFNRENEATVIEAFIDDPQAVD 278

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           K   ++   +   +++ DW+QR + FF   +
Sbjct: 279 KFRADVETKIDRPLILTDWRQRNKTFFDTLQ 309


>gi|121601808|ref|YP_989087.1| ABC transporter, permease protein [Bartonella bacilliformis KC583]
 gi|120613985|gb|ABM44586.1| ABC transporter, permease protein [Bartonella bacilliformis KC583]
          Length = 422

 Score =  201 bits (511), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 106/266 (39%), Positives = 162/266 (60%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS ++ ++A RY+  N+K+ F SI S IS IG+M+GV AL+VVM+VMNGFR +++ R+LG
Sbjct: 9   FSSYQWMIALRYMIPNKKHMFTSIISIISLIGIMLGVFALVVVMAVMNGFRTELLNRILG 68

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+VIQ       DY  + + L+ +  V   LP + GQA V G   GG+G L+RG   
Sbjct: 69  MNGHLVIQTMDSDFSDYNTLIHSLESLNSVQFALPIIEGQALVQGNIGGGTGALIRGTRK 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L+             FD+ +GV IG  LA  LG++IG  + +++P GD TP G+ 
Sbjct: 129 EDLEKLKTVAQNIKSGSLAQFDQEEGVAIGSGLAEKLGLTIGSDLRMITPDGDETPFGVM 188

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K+Y V+ +F +   +YD+  ++M L EAQ +FNL   +  +E+F+ DPDAI++    
Sbjct: 189 PRVKAYKVVAIFEVGMSEYDSIFIFMPLHEAQAFFNLGTTIQSLELFLHDPDAIDQVKPV 248

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I++ +   V ++DW+ R Q FFS  +
Sbjct: 249 IMKEIDQPVYLVDWRIRNQAFFSALQ 274


>gi|170748458|ref|YP_001754718.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Methylobacterium radiotolerans JCM 2831]
 gi|170654980|gb|ACB24035.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylobacterium radiotolerans JCM 2831]
          Length = 436

 Score =  201 bits (511), Expect = 9e-50,   Method: Compositional matrix adjust.
 Identities = 104/266 (39%), Positives = 155/266 (58%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE I+A RYL + R+   +S+ +F S +G+ +GV  LI+V+SVMNGFR +++ +++G
Sbjct: 28  FAPFEWILAGRYLRARRRGGGVSVVAFFSVLGIALGVATLIIVLSVMNGFRAELLSKIVG 87

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+       P  D+  ++ RL  +  V   +P V GQAF S    GGSGV++RG+  
Sbjct: 88  INGHLFATPIDRPFNDWTDLSERLSKVAGVRAAVPLVEGQAFASS-QYGGSGVIIRGVRA 146

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           +D   L    S   G     FD G GV+IG+ LA  LG+  GD I +++P G  TP G  
Sbjct: 147 ADLDALAAVSSAIRGGTLEGFDDGTGVLIGRRLADTLGLQAGDTITLVTPKGSSTPFGTA 206

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R+KSYTV  +F +   ++D   V+M L EAQ +FN +  VS IE++V DPD +    E 
Sbjct: 207 PRTKSYTVKAVFEVGMTEFDQTFVFMPLTEAQAFFNKDGDVSMIEIYVDDPDHVGDMREP 266

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       +++ DW+QR + FF   E
Sbjct: 267 LEMAAERPILLTDWRQRNRTFFGALE 292


>gi|163850498|ref|YP_001638541.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Methylobacterium extorquens PA1]
 gi|163662103|gb|ABY29470.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylobacterium extorquens PA1]
          Length = 439

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 154/266 (57%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE I+A RYL + R+   +S+ +  S +G+ +GV  LI+V+SVMNGFR ++  +++G
Sbjct: 31  FAGFEWIIAGRYLRARRRGGGVSVVALFSVLGIAVGVATLIIVLSVMNGFRSELRSKIIG 90

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGHV          DY  +++RL+ +  V  V+P V GQAF S    GGSGVLVRG+  
Sbjct: 91  LNGHVFAAPIDRLFTDYVDLSDRLEKVAGVRAVVPMVQGQAFASS-PYGGSGVLVRGVRE 149

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           SD   +        G    +FD G+GV +GK LA  LG+  GD++ + +P G  TP G  
Sbjct: 150 SDLPKIPAVSGAIKGGTLENFDDGQGVALGKRLADALGLQAGDQVTLSTPKGASTPFGTA 209

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R+K+Y V  +F +   D+D  M +M L EAQ +FN +  VS IE+++ + DA+ +  E 
Sbjct: 210 PRTKTYAVKAIFEIGVTDFDTTMAFMPLAEAQAFFNRDGDVSVIEIYLDNADAVGEMREP 269

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       V++ DW+Q  + FF   E
Sbjct: 270 LEMAAERPVLLTDWRQTNRTFFGALE 295


>gi|188580266|ref|YP_001923711.1| lipoprotein releasing system, transhypothetical protein, LolC/E
           family [Methylobacterium populi BJ001]
 gi|179343764|gb|ACB79176.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylobacterium populi BJ001]
          Length = 439

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 102/266 (38%), Positives = 152/266 (57%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE I+A RYL + R+   +S+ +  S +G+ +GV  LI+V+SVMNGFR ++  +++G
Sbjct: 31  FAGFEWIIAGRYLRARRRGGGVSVVALFSVLGIAVGVATLIIVLSVMNGFRTELRSKIIG 90

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGHV          DY  ++ RL+ +  V  V+P V GQAF S    GGSGVLVRG+  
Sbjct: 91  LNGHVFAAPIDRLFTDYVDLSERLEKVAGVRAVVPMVQGQAFASS-PYGGSGVLVRGVRE 149

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           SD   +              FD G+GV +GK LA  LG+  GD++ + +P G  TP G  
Sbjct: 150 SDLPKIPAVSGAIKSGTLEGFDDGQGVALGKRLADALGLQAGDQVTLSTPKGASTPFGTA 209

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R+K+YTV  +F +   D+D  M +M L EAQ +FN +  VS IE+++ D DA+ +  E 
Sbjct: 210 PRTKTYTVKAIFEIGVTDFDTTMAFMPLAEAQAFFNRDGDVSVIEIYLDDADAVGEMREP 269

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       V++ DW+Q  + FF   E
Sbjct: 270 LEMAAERPVLLTDWRQTNRTFFGALE 295


>gi|86357258|ref|YP_469150.1| lipoprotein ABC transporter, permease protein [Rhizobium etli CFN
           42]
 gi|86281360|gb|ABC90423.1| probable lipoprotein ABC transporter, permease protein [Rhizobium
           etli CFN 42]
          Length = 381

 Score =  198 bits (504), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 94/233 (40%), Positives = 136/233 (58%)

Query: 37  MIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKV 96
           M+GV  LI+VM+VMNGFR +++ R+LGINGH+++Q    P  DY  +  +L  +P V   
Sbjct: 1   MLGVATLIIVMAVMNGFRTELVSRILGINGHMIVQPVDGPFTDYPELTAKLAAVPGVRMA 60

Query: 97  LPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDL 156
           LP V GQ   S  + G +G LVRG    D + L+             +  G+GV+IG  +
Sbjct: 61  LPLVEGQVLASAQAGGSTGALVRGARAEDLTKLKTISDNIKSGDMVGYASGEGVLIGTRM 120

Query: 157 ARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQL 216
           A  LG+ +GD I + SP GD+TPMG+  R KSY + G+F +   +YD+ +++M L+EAQL
Sbjct: 121 ADQLGLRVGDLITLTSPEGDITPMGVNPRVKSYKISGLFEIGMSEYDSSIIFMPLEEAQL 180

Query: 217 YFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           YFN    V  IE+FV  PD I+     +    G  + + DW+QR Q FFS  +
Sbjct: 181 YFNAAGLVQSIELFVDHPDDIDALRPKVEEAAGRQINLTDWRQRNQTFFSALQ 233


>gi|254560034|ref|YP_003067129.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylobacterium extorquens DM4]
 gi|254267312|emb|CAX23144.1| putative Lipoprotein releasing system, transmembrane protein,
           LolC/E family [Methylobacterium extorquens DM4]
          Length = 439

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 153/266 (57%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE I+A RYL + R+   +S+ +  S +G+ +GV  LI+V+SVMNGFR ++  +++G
Sbjct: 31  FAGFEWIIAGRYLRARRRGGGVSVVALFSVLGIAVGVATLIIVLSVMNGFRSELRSKIIG 90

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGHV          DY  +++RL+ +  V  V+P V GQAF S    GGSGVLVRG+  
Sbjct: 91  LNGHVFAAPIDRLFTDYVDLSDRLEKVAGVRAVVPMVQGQAFASS-PYGGSGVLVRGVRE 149

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           SD   +        G     FD G+GV +GK LA  LG+  GD++ + +P G  TP G  
Sbjct: 150 SDLPKIPAVSGAIKGGTLEGFDDGQGVALGKRLADALGLQAGDQVTLSTPKGASTPFGTA 209

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R+K+Y V  +F +   D+D  M +M L EAQ +FN +  VS IE+++ + DA+ +  E 
Sbjct: 210 PRTKTYAVKAIFEIGVTDFDTTMAFMPLAEAQAFFNRDGDVSVIEIYLDNADAVGEMREP 269

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       V++ DW+Q  + FF   E
Sbjct: 270 LEMAAERPVLLTDWRQTNRTFFGALE 295


>gi|218529195|ref|YP_002420011.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylobacterium chloromethanicum CM4]
 gi|218521498|gb|ACK82083.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylobacterium chloromethanicum CM4]
          Length = 439

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 153/266 (57%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE I+A RYL + R+   +S+ +  S +G+ +GV  LI+V+SVMNGFR ++  +++G
Sbjct: 31  FAGFEWIIAGRYLRARRRGGGVSVVALFSVLGIAVGVATLIIVLSVMNGFRSELRSKIIG 90

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGHV          DY  +++RL+ +  V  V+P V GQAF S    GGSGVLVRG+  
Sbjct: 91  LNGHVFAAPIDRLFTDYVDLSDRLEKVAGVRAVVPMVQGQAFASS-PYGGSGVLVRGVRE 149

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           +D   +        G     FD G+GV +GK LA  LG+  GD++ + +P G  TP G  
Sbjct: 150 ADLPKIPAVSGAIKGGTLEGFDDGQGVALGKRLADALGLQAGDQVTLSTPKGASTPFGTA 209

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R+K+Y V  +F +   D+D  M +M L EAQ +FN +  VS IE+++ + DA+ +  E 
Sbjct: 210 PRTKTYAVKAIFEIGVTDFDTTMAFMPLAEAQAFFNRDGDVSVIEIYLDNADAVGEMREP 269

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       V++ DW+Q  + FF   E
Sbjct: 270 LEMAAERPVLLTDWRQTNRTFFGALE 295


>gi|240137563|ref|YP_002962034.1| putative Lipoprotein releasing system, transmembrane protein,
           LolC/E family [Methylobacterium extorquens AM1]
 gi|240007531|gb|ACS38757.1| putative Lipoprotein releasing system, transmembrane protein,
           LolC/E family [Methylobacterium extorquens AM1]
          Length = 439

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 100/266 (37%), Positives = 153/266 (57%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE I+A RYL + R+   +S+ +  S +G+ +GV  LI+V+SVMNGFR ++  +++G
Sbjct: 31  FAGFEWIIAGRYLRARRRGGGVSVVALFSVLGIAVGVATLIIVLSVMNGFRSELRSKIIG 90

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGHV          DY  +++RL+ +  V  V+P V GQAF S    GGSGVLVRG+  
Sbjct: 91  LNGHVFAAPIDRLFTDYVDLSDRLEKVAGVRAVVPMVQGQAFASS-PYGGSGVLVRGVRE 149

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           +D   +        G     FD G+GV +GK LA  LG+  GD++ + +P G  TP G  
Sbjct: 150 ADLPKIPAVSGAIKGGTLEGFDDGQGVALGKRLADALGLQAGDQVTLSTPKGASTPFGTA 209

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R+K+Y V  +F +   D+D  M +M L EAQ +FN +  VS IE+++ + DA+ +  E 
Sbjct: 210 PRTKTYAVKAIFEIGVTDFDTTMAFMPLAEAQAFFNRDGDVSVIEIYLDNADAVGEMREP 269

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +       V++ DW+Q  + FF   E
Sbjct: 270 LEMAAERPVLLTDWRQTNRTFFGALE 295


>gi|217976886|ref|YP_002361033.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylocella silvestris BL2]
 gi|217502262|gb|ACK49671.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylocella silvestris BL2]
          Length = 423

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 99/264 (37%), Positives = 156/264 (59%), Gaps = 2/264 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE +VA RYL + R + F+S+ +  SF+G+++GV  LIVVMSVMNGF ++++ +++G
Sbjct: 12  FAAFEWMVALRYLRARRSSGFVSVIAGFSFLGIVLGVATLIVVMSVMNGFHKELLDKIVG 71

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           INGH+ +Q    PL DY  ++  +  +P V   +P + G A VS  ++  +  LVRG+  
Sbjct: 72  INGHIFLQATDSPLTDYDEVSREVGSLPGVQLAIPMIEGPAAVS--TTNMAFALVRGVRE 129

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L              FD+  GV IG+ +A NLG+ +GDKI +L   G  TP G+ 
Sbjct: 130 GDIKRLPGIAGNVRAGTLEGFDKAGGVAIGQRIADNLGLRVGDKIKVLIANGPQTPFGVA 189

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            RSK Y V  +F++   ++DN  VYM L EAQ +F+ +N  S IEVF+  P+ ++     
Sbjct: 190 PRSKVYPVTAIFQIGMAEFDNLFVYMPLPEAQGFFSKDNEASVIEVFLNRPEDLDAVRAR 249

Query: 244 IVRILGNGVVVIDWQQRYQIFFSC 267
           I +I+   +++ DW++R + FF  
Sbjct: 250 IDQIVTRPMIMTDWRERNRTFFDA 273


>gi|154253643|ref|YP_001414467.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Parvibaculum lavamentivorans DS-1]
 gi|154157593|gb|ABS64810.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Parvibaculum lavamentivorans DS-1]
          Length = 427

 Score =  192 bits (489), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 101/266 (37%), Positives = 149/266 (56%), Gaps = 2/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F  FE ++A RYL + R+  FIS+ +  SF G+M+GV  LI+VMSVMNGFR +++ R+LG
Sbjct: 16  FGAFEWLLAMRYLRARRREGFISVIAGFSFAGIMLGVAVLIIVMSVMNGFRTELLSRILG 75

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH+ ++     + DY  IA R+  +P V+ V+P V GQ  V       SG LVRG+  
Sbjct: 76  LNGHMFVRGVGASIADYDAIAERIRSVPGVVSVMPLVDGQVMVQS-PQNASGALVRGLRE 134

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L            + FD G GV IG  LA+N+G+++GD I +LSP G +TP G  
Sbjct: 135 QDLKSLSVVADNITVGSLDGFDEG-GVAIGSRLAQNMGLTVGDSITLLSPRGAITPFGTA 193

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R  S+ +  +F +   +YD   V+M L EA+ +F     VS +E+  ++PD +      
Sbjct: 194 PRVASFPIRAIFEIGMSEYDASFVFMPLDEARGFFRTYEGVSALELRFQNPDKVNDFIRP 253

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           ++   G    V+ WQQ  Q FFS  +
Sbjct: 254 VMEAAGPCCNVLTWQQMNQSFFSALQ 279


>gi|312116219|ref|YP_004013815.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodomicrobium vannielii ATCC 17100]
 gi|311221348|gb|ADP72716.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodomicrobium vannielii ATCC 17100]
          Length = 424

 Score =  189 bits (479), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 93/266 (34%), Positives = 153/266 (57%), Gaps = 1/266 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++A+RYL + RK   +S+ +F   +G+ +GV  LI+V+SVMNGFR+++  ++LG
Sbjct: 12  FAPFEWLLAFRYLRARRKKGSVSVIAFFCVLGIALGVATLIIVLSVMNGFRKELFDKILG 71

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGHV+++    P  DY  +A RL+ +  V   L  V GQ  +S   +G SGV+VRG+  
Sbjct: 72  LNGHVIVRPLARPFTDYDEVAKRLNAVKGVDHALAVVEGQVMISS-QNGSSGVIVRGLKG 130

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            D   L++          + FD   G+ IG  LA  L + +G ++ +L+P G  TP G  
Sbjct: 131 RDLQALKSISGNIRFGTLDGFDDSGGIAIGTRLANTLNVFVGSEVTLLAPKGASTPFGTA 190

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K Y +  +F M   +YD  + +M ++EAQ +FNL  AV  +EV + +PD +E+    
Sbjct: 191 PRVKRYRIAAVFEMGMSEYDGSIAFMPMKEAQGFFNLGEAVHVLEVVIDNPDNVERMRGV 250

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    G  +++ DW+QR   F++  +
Sbjct: 251 LQDAGGPDMLLTDWRQRNATFYNTLK 276


>gi|288958963|ref|YP_003449304.1| lipoprotein-releasing system permease protein [Azospirillum sp.
           B510]
 gi|288911271|dbj|BAI72760.1| lipoprotein-releasing system permease protein [Azospirillum sp.
           B510]
          Length = 415

 Score =  188 bits (478), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 100/268 (37%), Positives = 158/268 (58%), Gaps = 3/268 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           IF+ FE +VA RYL + R+  FIS+ +  S +G+ +GV  LI+VM+VMNGFR +++ RVL
Sbjct: 2   IFNAFERMVAMRYLRARRQEGFISVIAGFSLLGIALGVATLIIVMAVMNGFRAELLGRVL 61

Query: 63  GINGHV-VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
           G+NGH+ V   +  PL D+  +A +L   P V+ V P V GQA VS +    SG ++RG+
Sbjct: 62  GLNGHLNVYSSRGGPLPDFDILAGKLRDTPGVVNVTPTVEGQALVS-VRGVASGAVIRGV 120

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
              DF       S      +++F   + V IG  +A+ LG+++GD+I +++P G+VT  G
Sbjct: 121 RAEDFKVRPTLASNIVRGSADEFGEDR-VAIGVRMAQRLGLTVGDQITLIAPQGNVTAFG 179

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R +SY +  +F +   +YDN  +++ L+EAQ +F   +AV+ +EVFV DP  I    
Sbjct: 180 TVPRMRSYPIGAIFDVGMFEYDNSFIFLPLEEAQAFFRTGDAVTSLEVFVSDPMQIAAAR 239

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +  ++     V+DWQQ    FF+  +
Sbjct: 240 AAVQSVVAGEGRVVDWQQSNASFFTALQ 267


>gi|144899843|emb|CAM76707.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 414

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 102/267 (38%), Positives = 156/267 (58%), Gaps = 2/267 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           IF  FE +VA+RYL + RK  FIS+ +  S +G+ +GV  LIVVM+VMNGFR++++ R+L
Sbjct: 2   IFDAFERMVAFRYLRARRKEGFISVIAGFSLLGIGLGVATLIVVMAVMNGFRQELLTRIL 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           GINGH+ +      L  +  +A  +  +P V++V+P V GQ   +  SS     +VRG+ 
Sbjct: 62  GINGHMGVYGTGPALAQFDPLAQSIRGLPGVVRVIPTVEGQVMATSASSASG-AIVRGVR 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
             D    +  F++  G    +F  G GV++G  LA  LG+ IGD + ++SP G+ T  G 
Sbjct: 121 PDDL-LAREIFAKGLGGSGEEFKNGDGVLVGYRLAEKLGLQIGDTVTLISPKGNATAFGT 179

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R + YTV G F +   +YD+G ++M L+ AQ YF   +AV+ IEVF+ + D + +T  
Sbjct: 180 VPRMRGYTVAGTFNVGMFEYDSGFMFMPLEAAQTYFKFPDAVTQIEVFLDNHDKVTETRN 239

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            I R+    V + DWQQ    FF+  +
Sbjct: 240 AIFRLTQGNVRIYDWQQANASFFNAVQ 266


>gi|118581420|ref|YP_902670.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pelobacter propionicus DSM 2379]
 gi|118504130|gb|ABL00613.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Pelobacter propionicus DSM 2379]
          Length = 420

 Score =  188 bits (477), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 108/263 (41%), Positives = 162/263 (61%), Gaps = 13/263 (4%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+++  RYL + RK+ FISI S IS  GV +GVMALIVV++VM GF ED+ +++LG N 
Sbjct: 3   FELLICLRYLKAKRKSTFISIISLISTAGVSLGVMALIVVLAVMTGFEEDLKEKILGTNA 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGIS-N 123
           HVV+ +   P+ +Y+ +  +L  +P +    PF+  Q     LSSG   SGV++RGI   
Sbjct: 63  HVVVIRNGLPMDEYRQVMEKLTAMPGITAATPFIYNQVM---LSSGRNVSGVVLRGIDVP 119

Query: 124 SDFSYLQNSFSRFYGNVSN-DFDRG------KGVIIGKDLARNLGISIGDKINILSPYGD 176
           SD    + + S   GN  N D   G       G++IGK+LARNL + +GD+IN++SP G+
Sbjct: 120 SDRLVTRLNASLVEGNTDNLDPKMGDGAVALPGLLIGKELARNLNLRLGDRINVVSPMGN 179

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
           +TP+GM  R K + V+G+F     +YD+ + Y+SL +AQ +F+L + V+GI++ VKD   
Sbjct: 180 ITPLGMIPRMKPFRVVGIFNTGMFEYDSTLAYVSLTQAQTFFDLGDTVTGIQLKVKDVYH 239

Query: 237 IEKTHENIVRILGNGVVVIDWQQ 259
             +    I R+LG+     DW Q
Sbjct: 240 TGELAREINRVLGSDYFARDWMQ 262


>gi|16126173|ref|NP_420737.1| hypothetical protein CC_1930 [Caulobacter crescentus CB15]
 gi|221234944|ref|YP_002517380.1| lipoprotein releasing system transmembrane protein lolE
           [Caulobacter crescentus NA1000]
 gi|13423385|gb|AAK23905.1| conserved hypothetical protein [Caulobacter crescentus CB15]
 gi|220964116|gb|ACL95472.1| lipoprotein releasing system transmembrane protein lolE
           [Caulobacter crescentus NA1000]
          Length = 426

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 104/274 (37%), Positives = 152/274 (55%), Gaps = 13/274 (4%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSR+E  VA RYLF+ RKN  +++ S ISF  VM+ V ALI VMSVMNGFR +++ R+LG
Sbjct: 10  FSRWERSVARRYLFAKRKNGGVALISVISFSAVMLAVFALITVMSVMNGFRAELLGRILG 69

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
            NGH+  Q       D   I  R+   P VI+  P V  QA V G +   +G +VRG++ 
Sbjct: 70  FNGHLYAQSPLINGPDRDTIIRRIKAAPGVIQAAPMVEAQAMVIGPTQ-VTGAIVRGVTT 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKG--------VIIGKDLARNLGISIGDKINILSPYG 175
           SD  ++    S   GN+ N    G G        V+IG+ +A+ LG+  GD I I+SP G
Sbjct: 129 SDLRHM----SLISGNIKNGSMEGFGQGEYGGDIVLIGERMAQTLGVQPGDPITIISPSG 184

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPD 235
             T  G   R K+Y V G+F +    +D   +YM L++AQL+F  +  V  +E+ V+DPD
Sbjct: 185 PATAFGSSTREKNYIVGGVFSVGMSQFDEAFIYMPLEQAQLFFGRDTTVDYVEIKVEDPD 244

Query: 236 AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             ++  + +    G G +V DW  +   +F+  +
Sbjct: 245 KAKELKQAVEIASGPGALVNDWMDKNHSYFTALQ 278


>gi|295689604|ref|YP_003593297.1| lipoprotein releasing system transmembrane protein [Caulobacter
           segnis ATCC 21756]
 gi|295431507|gb|ADG10679.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Caulobacter segnis ATCC 21756]
          Length = 426

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 102/274 (37%), Positives = 149/274 (54%), Gaps = 13/274 (4%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSR+E  VA RYLF+ RKN  +++ S ISF  VM+ V ALI VMSVMNGFR +++ R++G
Sbjct: 10  FSRWERSVARRYLFAKRKNGGVALISIISFCAVMLAVFALITVMSVMNGFRAELLGRIVG 69

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
            NGH+  Q       D   +  R+   P V++  P V  QA V G +   +G +VRG++ 
Sbjct: 70  FNGHLYAQSPLINGPDRDTVIRRIMAAPGVVQAAPMVEAQAMVIGPTQ-VTGAIVRGVTT 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKG--------VIIGKDLARNLGISIGDKINILSPYG 175
           +D  ++    S   GN+      G G        V+IG  +A NLG+  GD I ++SP G
Sbjct: 129 ADLRHM----SLIAGNIKQGSLAGFGEGEYGGDMVLIGDRMALNLGVRPGDAITLISPSG 184

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPD 235
             T  G   R K+Y V G+F +    +D   VYM L++AQL+F  + +V  +E+ V DPD
Sbjct: 185 PATAFGSSTREKNYIVGGVFSVGMSQFDEAFVYMPLEQAQLFFGRDTSVDYVEIKVDDPD 244

Query: 236 AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +     +    G G +V DWQ R   +F+  +
Sbjct: 245 KAKDYKHAVEVASGPGALVSDWQDRNHSYFTALQ 278


>gi|167646773|ref|YP_001684436.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Caulobacter sp. K31]
 gi|167349203|gb|ABZ71938.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Caulobacter sp. K31]
          Length = 424

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 101/270 (37%), Positives = 146/270 (54%), Gaps = 5/270 (1%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F  +E  VAWRYL + RKN  +++ + ISF  VM+ V ALI VMSVMNGFR +++ R+LG
Sbjct: 8   FGTWERTVAWRYLRNKRKNGGVALIAIISFAAVMLAVFALITVMSVMNGFRAELLGRLLG 67

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
            NGHV  Q       D   +  R+  +P V +  P V  QA V G S   SG +VRG++ 
Sbjct: 68  FNGHVYAQGPLLNGPDRDGVITRIKAVPGVTQAAPMVEAQAMVIGPSQV-SGAIVRGVTP 126

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKG----VIIGKDLARNLGISIGDKINILSPYGDVTP 179
            D   ++   +         F  G+     V+IG  +ARNLG+S+GD I ++SP G  T 
Sbjct: 127 QDLRGMKMISTNIKRGSLAGFGEGEYGGDIVLIGDRMARNLGLSVGDAITLISPSGPATA 186

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G   R K YTV G+F +    +D   VYM+L +AQL+F  + ++  +E+ V DPD  + 
Sbjct: 187 FGTSTREKDYTVGGIFSVGMSQFDESFVYMALPQAQLFFGRDASIDYVEIKVADPDKAKA 246

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               I +  G G  V DW  +   +F+  +
Sbjct: 247 IKPVIEQASGPGAFVQDWMDKNSSYFNALQ 276


>gi|296536134|ref|ZP_06898263.1| lipoprotein ABC superfamily ATP binding cassette transporter,
           membrane protein [Roseomonas cervicalis ATCC 49957]
 gi|296263546|gb|EFH10042.1| lipoprotein ABC superfamily ATP binding cassette transporter,
           membrane protein [Roseomonas cervicalis ATCC 49957]
          Length = 421

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 100/273 (36%), Positives = 149/273 (54%), Gaps = 6/273 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F  FE  VA+RYL + +   F+S+ +  S +G+ +GV  LI+VMSVMNGFR++++ R+L
Sbjct: 1   MFGAFERKVAFRYLRARKGERFVSVIATFSLVGIALGVATLIIVMSVMNGFRQELLGRIL 60

Query: 63  GINGHVVIQQKYYP-----LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVL 117
           G+NGH+ I           + DY  IA R+  +  V    P V GQ  ++  + G +G +
Sbjct: 61  GLNGHLGIHAAASGPGGGGIRDYDAIAERVRQMAGVASATPIVEGQVLMTSEAGGATGGI 120

Query: 118 VRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
            RGI   D                ++F     ++IG  LA+ LG+ +G KI ++SP G  
Sbjct: 121 ARGIKPEDLRARPLLAGNIRAGSLDNFQGDDAILIGTRLAQKLGLGVGSKITLVSPQGRS 180

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           T +G   R K+YTV+ +F     +YD+G V++ L  AQ+YF L +A S IEVFV DPD +
Sbjct: 181 TVIGTVPRLKAYTVVALFEAGMNEYDSGYVFLPLPAAQVYFQLRDAASMIEVFVNDPDNV 240

Query: 238 EKTHENIVRILGN-GVVVIDWQQRYQIFFSCYE 269
                 IVR L    V V+DWQ     FF+  +
Sbjct: 241 RAVTREIVRGLSPLPVRVLDWQAANSSFFAAVQ 273


>gi|163795648|ref|ZP_02189614.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [alpha proteobacterium BAL199]
 gi|159179247|gb|EDP63780.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [alpha proteobacterium BAL199]
          Length = 415

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 93/267 (34%), Positives = 154/267 (57%), Gaps = 1/267 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           IF  FE ++A RYL + R+  FIS+ +  S +G+ +GV  LI+VMSVMNGFR +++ R+L
Sbjct: 2   IFGAFERMLAMRYLRARRQEGFISVIAGFSLLGIGLGVATLIIVMSVMNGFRTELMGRIL 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NGH  +  +   + D+  +A ++  IP +  V P V GQA +    S  SG +VRG+ 
Sbjct: 62  GLNGHAAVYSRTGHIEDFDQVAVQVASIPGIFSVTPQVEGQAMLVANGSA-SGAVVRGLR 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
            +D    +       G   + F+    +I+G+ LA  L + +GDK+ ++SP   VT MG 
Sbjct: 121 PTDMKAKRLIAQNIIGGSLDRFEGRDAIILGQRLAERLRLGVGDKVTLISPTSAVTVMGS 180

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R+K+Y ++G+F +   +YDN  VYM ++ AQ++F     V+ +E+F  DP+ I +   
Sbjct: 181 IPRTKAYDIVGLFNVGMFEYDNTFVYMPMEAAQVFFQSGQTVNALEIFTTDPNNIRRYRL 240

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            ++  L + +   DWQQ+   FF+  +
Sbjct: 241 PLLEALPSDLYFFDWQQQNSSFFNALQ 267


>gi|46204233|ref|ZP_00050294.2| COG4591: ABC-type transport system, involved in lipoprotein
           release, permease component [Magnetospirillum
           magnetotacticum MS-1]
          Length = 386

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 139/241 (57%), Gaps = 1/241 (0%)

Query: 29  SFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLD 88
           +  S +G+ +GV  LI+V+SVMNGFR ++  +++G+NGHV          DY  +++RL+
Sbjct: 3   ALFSVLGIAVGVATLIIVLSVMNGFRSELRSKIIGLNGHVFAAPIDKLFTDYVDLSDRLE 62

Query: 89  FIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGK 148
            +  V  V+P V GQAF S    GGSGVLVRG+  +D   +    S         FD G+
Sbjct: 63  KVAGVRAVVPMVQGQAFASS-PYGGSGVLVRGVRAADLPKIPAVSSAIKSGTLEGFDDGQ 121

Query: 149 GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVY 208
           GV +GK LA +LG+  GD++ + +P G  TP G   R+K+YTV  +F +   D+D+ M +
Sbjct: 122 GVALGKRLADSLGLQAGDQVTLSTPKGASTPFGTAPRTKAYTVKAIFEIGVTDFDSTMAF 181

Query: 209 MSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCY 268
           M L E+Q +FN +  VS IE+++ D D + +  E +       V++ DW+Q  + FF   
Sbjct: 182 MPLSESQAFFNRDGDVSVIEIYLDDADTVGEMREPLEMAAERPVLLTDWRQTNRTFFGAL 241

Query: 269 E 269
           E
Sbjct: 242 E 242


>gi|189423827|ref|YP_001951004.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Geobacter lovleyi SZ]
 gi|189420086|gb|ACD94484.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Geobacter lovleyi SZ]
          Length = 420

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/261 (39%), Positives = 160/261 (61%), Gaps = 11/261 (4%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ +  RYL + RK+ FISI +FIS  GV +GVMALIVV++VM GF  D+ +++LG N 
Sbjct: 5   FELKIGLRYLKAKRKSTFISIITFISTAGVTLGVMALIVVLAVMTGFERDLKEKILGTNA 64

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGI-SN 123
           H+V+ +   P+ DY+ +  RL  +P V  V PF+  Q     LS+G   SGV++RGI   
Sbjct: 65  HLVVIRSGAPMDDYRSMMERLQQLPGVEAVTPFIYNQVM---LSTGRHVSGVVLRGIDPA 121

Query: 124 SDFSYLQNSFSRFYGNV-SNDFDRG----KGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           SD    + S +   G + S D  RG     G++IG++LA++L + +GD++N++SP G +T
Sbjct: 122 SDKKVTRLSRTIVQGTMDSLDPPRGSDADPGIMIGRELAKHLNLFLGDRVNVVSPTGTIT 181

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P+GM  + K + V G+F     +YD+ + Y+S+ +AQ +F+L + V+GI++ V D  A  
Sbjct: 182 PLGMMPKLKPFKVTGIFNTGMFEYDSTLAYVSINQAQKFFDLGDTVTGIQLKVADVYATT 241

Query: 239 KTHENIVRILGNGVVVIDWQQ 259
           +  + I R  G  +   DW Q
Sbjct: 242 ELAKKINRTYGPDLYARDWMQ 262


>gi|209964525|ref|YP_002297440.1| lipoprotein releasing system, transmembrane protein, LolC
           [Rhodospirillum centenum SW]
 gi|209957991|gb|ACI98627.1| lipoprotein releasing system, transmembrane protein, LolC
           [Rhodospirillum centenum SW]
          Length = 414

 Score =  175 bits (444), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 96/267 (35%), Positives = 150/267 (56%), Gaps = 2/267 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           IFS FE +VA RYL + R+  FIS+ +  S +G+ +GV  LI+VMSVMNGFR +++ R+L
Sbjct: 2   IFSAFERMVAMRYLRARRQEGFISVIAGFSLLGIALGVATLIIVMSVMNGFRAELLGRIL 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NGH  +     PL DY  +A R+   P V+ V+P+V GQA VS +    +GV VRGI 
Sbjct: 62  GVNGHAYVYATMGPLEDYGPLAERVKAAPGVVAVMPYVEGQALVS-IQGVATGVQVRGIR 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
             DF   +            +     G+ IG  LA+  G+ +GD++ ++SP G  T  G 
Sbjct: 121 PEDFRT-RPVVGDSVVLGDGNGFGEGGIAIGIRLAQRFGLRVGDELTLISPRGATTAFGT 179

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R+  + +  +F +   +YD+ +VYM L+ AQ ++ +   ++ +EVFV DP+ I     
Sbjct: 180 VPRTGRFPIAAIFEVGMSEYDSNIVYMPLETAQAFYRMPGQITALEVFVADPNDIGLLRA 239

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
           ++   +     V+DWQQ    FF+  +
Sbjct: 240 SLGGAVAGQGRVLDWQQTNSSFFTALQ 266


>gi|326403095|ref|YP_004283176.1| putative ABC transporter permease [Acidiphilium multivorum AIU301]
 gi|325049956|dbj|BAJ80294.1| putative ABC transporter permease protein [Acidiphilium multivorum
           AIU301]
          Length = 415

 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 93/266 (34%), Positives = 148/266 (55%), Gaps = 2/266 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +FS FE  VA+RYL + +   F+SI +  S +G+ +GV  LI+VMSVMNGFR++++ ++L
Sbjct: 1   MFSAFERRVAFRYLRARKGERFVSIIAIFSLVGIALGVATLIIVMSVMNGFRQELLAQIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NG + +    + +  Y   A RL+ IP VI  +P V G+  ++G   G  G + RGI 
Sbjct: 61  GLNGDIGVYGAGHNITQYDAAAGRLEKIPGVISAIPIVQGEVLMTGPHGGAIGGVARGIQ 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
               + L+            DF  G+ + +G  +A  LGIS+G  I ++ P GD T +G 
Sbjct: 121 PDGLAKLRTVSRHIVAGSLKDFT-GRNIAVGAGVASQLGISLGGTITLVLPQGDATIIGT 179

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R +S+ V  +FR     YD+  V++ L  AQ  F  ++A + I++FVK+PD       
Sbjct: 180 IPRIQSFHVSAIFRTGMAQYDSSFVFLPLTSAQTLFRAKDAATQIQLFVKNPDNTGPIKA 239

Query: 243 NIVRILGNGVV-VIDWQQRYQIFFSC 267
            I +++G+  V V+DWQ     FF+ 
Sbjct: 240 AIPKVMGSAPVNVVDWQDSNNAFFAA 265


>gi|148259951|ref|YP_001234078.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Acidiphilium cryptum JF-5]
 gi|146401632|gb|ABQ30159.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidiphilium cryptum JF-5]
          Length = 415

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 93/266 (34%), Positives = 147/266 (55%), Gaps = 2/266 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +FS FE  VA+RYL + +   F+SI +  S +G+ +GV  LI+VMSVMNGFR++++ ++L
Sbjct: 1   MFSAFERRVAFRYLRARKGERFVSIIAIFSLVGIALGVATLIIVMSVMNGFRQELLAQIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NG + +    + +  Y   A RL+ IP VI  +P V G+  ++G   G  G + RGI 
Sbjct: 61  GLNGDIGVYGAGHNITQYDAAAGRLEKIPGVISAIPIVQGEVLMTGPHGGAIGGVARGIQ 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
               + L+            DF  G+ + +G  +A  LGIS+G  I ++ P GD T +G 
Sbjct: 121 PDGLAKLRTVSRHIVAGSLKDFT-GRNIAVGAGVASQLGISLGGTITLVLPQGDATIIGT 179

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R +S+ V  +FR     YD+  V++ L  AQ  F  ++A + I++FVK+PD       
Sbjct: 180 IPRIQSFHVSAIFRTGMAQYDSSFVFLPLTSAQTLFRAKDAATQIQLFVKNPDNTGPIKA 239

Query: 243 NIVRILGNGVV-VIDWQQRYQIFFSC 267
            I + +G+  V V+DWQ     FF+ 
Sbjct: 240 AIPKAMGSAPVNVVDWQDSNNAFFAA 265


>gi|320353043|ref|YP_004194382.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfobulbus propionicus DSM 2032]
 gi|320121545|gb|ADW17091.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfobulbus propionicus DSM 2032]
          Length = 408

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 89/269 (33%), Positives = 156/269 (57%), Gaps = 4/269 (1%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
            + FE  V+ RYL + RK  FIS+ + IS +GV +GV+ALIVV+SV  GF E +  +++G
Sbjct: 1   MAAFEWFVSLRYLRAKRKQKFISLITVISILGVAVGVLALIVVLSVWTGFTEGLRDQIIG 60

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +N H ++Q+   P+ D + +  R+  +  V    PF++GQA +S  SS  +GV +RGI  
Sbjct: 61  VNAHALVQRFGGPIADTEEVTARIQAVEGVAATTPFINGQALISS-SSQSTGVFLRGIDA 119

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRG---KGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           +    + +   +       D D+      +++G+D+AR L + +GD++ ++SP G ++PM
Sbjct: 120 ASALRVLSIGQKMQAGALTDLDQPLEVPAIVLGRDMARQLQVGVGDRVRLMSPNGPLSPM 179

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G+  + ++  V+G+F     +YD+ + Y+SL  A+   +L   V GIE+ V D D  ++T
Sbjct: 180 GVLPKIRTCLVVGIFHTGMSEYDSTIGYISLDTARSLTDLRQGVHGIEIRVADIDQADRT 239

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + + + LG+G  V DW +  Q  F+  +
Sbjct: 240 AQAVQQALGSGYSVRDWMRLNQNMFAALK 268


>gi|116751161|ref|YP_847848.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Syntrophobacter fumaroxidans MPOB]
 gi|116700225|gb|ABK19413.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Syntrophobacter fumaroxidans MPOB]
          Length = 410

 Score =  172 bits (436), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 95/269 (35%), Positives = 151/269 (56%), Gaps = 7/269 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ V+ RYLF+ R+  FIS+ + IS  GV +GV ALIVV++VMNGF+ED+  R+LG+  
Sbjct: 3   FELFVSLRYLFAKRRQTFISLITLISIAGVAVGVTALIVVLAVMNGFQEDLRNRILGVTS 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           HVV+      + +Y  +  +++  P V+   PFV  Q  ++    G SG ++RGI     
Sbjct: 63  HVVVGSLTGAMNNYPDVIAKVEKEPGVVAAAPFVYSQVMLTS-GRGISGAILRGIDPLSA 121

Query: 127 SYLQNSFSRFYGNVSN------DFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           S +        GN+++      D D    +I+G +LA NLG+  GD + ++SP G +TPM
Sbjct: 122 SKVIRLQENMIGNLADLSSPRGDADAPPAIILGSELAGNLGVRTGDWVTMISPTGRLTPM 181

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G   +SK + V+GM +    +YDN +VY+ L  AQ +  + + V+G+E+ ++D     K 
Sbjct: 182 GQTPKSKLFQVVGMLQSGMYEYDNTLVYVDLPAAQQFLGIGDTVTGVEIRLQDIYEAAKV 241

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            E++   LG      DW Q  +  FS  +
Sbjct: 242 SESLRERLGAPYWARDWMQMNRSLFSALK 270


>gi|78223562|ref|YP_385309.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Geobacter metallireducens GS-15]
 gi|78194817|gb|ABB32584.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Geobacter metallireducens GS-15]
          Length = 423

 Score =  171 bits (434), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 98/264 (37%), Positives = 149/264 (56%), Gaps = 12/264 (4%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+ +  RYL + RK+ FISI +FIS  GV +GVMALIVV++VM GF ED+ +++LG N 
Sbjct: 3   YELFIGLRYLKAKRKSTFISIITFISTAGVALGVMALIVVLAVMTGFEEDLKEKILGTNA 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           HVV+ +    + DY  I  RL  +  V+   PF+  Q  +S   S  SGV++RGI     
Sbjct: 63  HVVVLKSSGTMEDYPAIMERLKKMKGVVAATPFIYSQVMLST-GSNVSGVVLRGIDVKTD 121

Query: 127 SYLQNSFSRFYGNVSNDFDRG-----------KGVIIGKDLARNLGISIGDKINILSPYG 175
             + N +         D +R             G+IIG++LAR+L I  GD +N++SP G
Sbjct: 122 PLVTNLYRSLVEGKLGDLERSPLPLATPEPPKPGIIIGRELARSLNIYPGDTVNVISPLG 181

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPD 235
           ++TP+GM  + K + V+G+F     +YD+ + Y+ L EAQ + +L +A +GI++ V+D  
Sbjct: 182 NITPLGMVPKMKQFRVVGLFNTGMFEYDSTLAYVGLSEAQEFLSLGHAATGIQLRVQDVY 241

Query: 236 AIEKTHENIVRILGNGVVVIDWQQ 259
              +    I R LG      DW Q
Sbjct: 242 RTGELVRKIDRELGFPFHARDWMQ 265


>gi|255020530|ref|ZP_05292594.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidithiobacillus caldus ATCC 51756]
 gi|254970050|gb|EET27548.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidithiobacillus caldus ATCC 51756]
          Length = 414

 Score =  171 bits (433), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 94/271 (34%), Positives = 153/271 (56%), Gaps = 14/271 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
            + +E+ +  RY  + R+N FIS  +  + +G++IGV ALI VM+VMNGF   +  R+L 
Sbjct: 1   MTPYELWIGLRYTRAKRRNHFISFITGTAILGMVIGVAALIAVMAVMNGFDHTLRSRILA 60

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVS--GLSSGGSGVLVRGI 121
           +   ++IQ    P++D+     RL  +P V  V P+V  QA +S  GL SG    +V GI
Sbjct: 61  VTSDIIIQGNGVPVLDWPVAVRRLQRLPGVTGVAPYVQAQAMLSHDGLVSGA---VVEGI 117

Query: 122 SNSDFSYLQNSFSRF-----YGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
                  L+   +R       G++     R  G+++G+ LAR LG+ +G K+ ++SP G 
Sbjct: 118 DPE----LEGRVNRLGADMKAGSLDALHTRDWGIVLGRALARQLGVGVGGKVTLISPQGG 173

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
           VTP+G+  R + +TV+G+F +    YD+GM Y+SL++AQ  + L+  V+G+ + +KDP A
Sbjct: 174 VTPLGVTPRLRQFTVVGLFSVGIYAYDSGMAYISLKDAQRLYGLDQGVTGLRMQIKDPFA 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
                +++   LG    V DW Q ++ FF  
Sbjct: 234 APAFAKDLQTRLGPAFYVQDWTQTHENFFKA 264


>gi|83592913|ref|YP_426665.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Rhodospirillum rubrum ATCC 11170]
 gi|83575827|gb|ABC22378.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodospirillum rubrum ATCC 11170]
          Length = 417

 Score =  168 bits (425), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 97/271 (35%), Positives = 150/271 (55%), Gaps = 7/271 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           IF+ FE ++A RYL + RK  F+S+ +  S  G+ +GV  LI+VM+VMNGFRED++ R+ 
Sbjct: 2   IFNAFERMMAGRYLRARRKEGFVSVIAGFSLAGIGLGVATLIIVMAVMNGFREDLMGRIF 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVS--GLSSGGSGVLVRG 120
           G+NGH+ +  +Y  ++DY    + +  IP V  V P V GQ  ++  G S GG   LVRG
Sbjct: 62  GLNGHLTVLGQYDVMMDYDRATDIIRGIPGVRAVTPTVEGQVMLTDNGRSVGG---LVRG 118

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           +   D        +       +D      ++IG  LA N G+ +GDK+ ++SP G VT M
Sbjct: 119 VRPEDLRQRPMLANAVIAGSLDDLRGQDSIMIGNRLAENFGLRVGDKLTLVSPKGKVTAM 178

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLEN-AVSGIEVFVKDPDAIEK 239
           G   R ++YTV  +F +   +YD+  V++ L+ AQ YF +    V+ +EV V  PD + +
Sbjct: 179 GTVPRVRAYTVRVIFSIGMSEYDSSFVFLPLEAAQTYFQVPTEGVNHLEVVVDHPDRVGE 238

Query: 240 THENIVRILG-NGVVVIDWQQRYQIFFSCYE 269
               I    G  G+ + DW+Q    FF+  +
Sbjct: 239 VAGTIASTNGLGGIRLRDWRQTNATFFNALQ 269


>gi|253702016|ref|YP_003023205.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Geobacter sp. M21]
 gi|251776866|gb|ACT19447.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Geobacter sp. M21]
          Length = 416

 Score =  168 bits (425), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 91/259 (35%), Positives = 155/259 (59%), Gaps = 9/259 (3%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ +  RYL + RK+ FIS+ + IS  GV +GVMALI+V++VM GF ED+  ++LG N 
Sbjct: 3   FELFIGLRYLKAKRKSTFISLITLISVAGVALGVMALIIVLAVMTGFEEDLKDKILGTNA 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGI--- 121
           H+V+      + +Y  +  +L+ +  V    PF+  Q     LS+G   SGV++RGI   
Sbjct: 63  HIVVLSSLGAVQEYPQVIKKLEGMDGVQAATPFIYNQVM---LSTGKNVSGVVLRGIDVK 119

Query: 122 SNSDFSYLQNSFSR-FYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           S++  + L  S        + N+  +  GV++GK+LA+NLG+ +GD ++++SP G++TP+
Sbjct: 120 SDARVTNLHKSMVEGKLETLENEVGKTPGVVVGKELAKNLGLFLGDTVDVISPMGNITPL 179

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           GM  +   + + G+F     +YD+ + Y+SL+EAQ + +L + V+G+++ V+D    ++ 
Sbjct: 180 GMMPKLNRFRITGIFNTGMFEYDSTLAYVSLREAQQFLDLGDVVTGVQLKVRDVYKADQL 239

Query: 241 HENIVRILGNGVVVIDWQQ 259
            + I R LG      DW Q
Sbjct: 240 AQQINRELGPPYHARDWMQ 258


>gi|197117229|ref|YP_002137656.1| lipoprotein release ABC transporter membrane protein [Geobacter
           bemidjiensis Bem]
 gi|197086589|gb|ACH37860.1| lipoprotein release ABC transporter, membrane protein [Geobacter
           bemidjiensis Bem]
          Length = 416

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 89/259 (34%), Positives = 157/259 (60%), Gaps = 9/259 (3%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ +  RYL + RK+ FIS+ + IS  GV +GVMALI+V++VM GF E + +++LG N 
Sbjct: 3   FELFIGLRYLKAKRKSTFISLITLISVAGVALGVMALIIVLAVMTGFEEQLKEKILGTNA 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGI--- 121
           H+V+      + DY  +  +L+ +  V+   PF+  Q     LS+G   SGV++RGI   
Sbjct: 63  HIVVLSSLGAVHDYPQVIKKLEGMDGVVAATPFIYNQVM---LSTGKNVSGVVLRGIDVK 119

Query: 122 SNSDFSYLQNSFSR-FYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           S++  + LQ S        + ++  +  G+++GK+LA+NLG+ +GD ++++SP G++TP+
Sbjct: 120 SDAKVTNLQKSMVEGKLDTLESEVGKTPGLVVGKELAKNLGLFLGDTVDVISPMGNITPL 179

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           GM  +   + + G+F     +YD+ + Y+SL+EAQ + +L + V+G+++ V+D    ++ 
Sbjct: 180 GMMPKLNRFRITGIFNTGMFEYDSTLAYVSLKEAQQFLDLGDVVTGVQLKVRDVYKSDQL 239

Query: 241 HENIVRILGNGVVVIDWQQ 259
            + I + LG      DW Q
Sbjct: 240 AQKINQELGPPYHARDWMQ 258


>gi|322418265|ref|YP_004197488.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Geobacter sp. M18]
 gi|320124652|gb|ADW12212.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Geobacter sp. M18]
          Length = 416

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 93/259 (35%), Positives = 155/259 (59%), Gaps = 9/259 (3%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ +  RYL + RK+ FIS+ + IS  GV +GVMALI+V++VM GF ED+  ++LG N 
Sbjct: 3   FELFIGLRYLKAKRKSTFISLITLISVAGVALGVMALIIVLAVMTGFEEDLKDKILGTNA 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGISNS 124
           H+V+      + DY  +  +L+    V+   PF+  Q     LS+G   SGV++RGI  +
Sbjct: 63  HIVVLSGVGAVQDYPQVIRKLEGTDGVVAATPFIYNQVM---LSTGKNVSGVVLRGIEVA 119

Query: 125 DFSYLQNSF-SRFYGNVSN---DFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
             + + N   S   GN+++   +  +  GV+IGK+LA+NLG+ +GD ++++SP G++TP+
Sbjct: 120 TDAKVTNLHKSMVEGNLTSLEAEVGKTPGVVIGKELAKNLGLFLGDTVDVISPMGNITPL 179

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           GM  +   + + G+F     +YD+ + Y+SL+EAQ +  L + V+G+++ V+D     + 
Sbjct: 180 GMMPKLNRFRITGIFNTGMFEYDSTLAYVSLKEAQQFLGLGDVVTGVQLKVRDVYKTGEL 239

Query: 241 HENIVRILGNGVVVIDWQQ 259
            + I R LG      DW Q
Sbjct: 240 AQVINRELGPPYHARDWMQ 258


>gi|39997368|ref|NP_953319.1| ABC transporter permease [Geobacter sulfurreducens PCA]
 gi|39984259|gb|AAR35646.1| ABC transporter, permease protein [Geobacter sulfurreducens PCA]
 gi|298506305|gb|ADI85028.1| lipoprotein release ABC transporter, membrane protein [Geobacter
           sulfurreducens KN400]
          Length = 423

 Score =  166 bits (421), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 96/266 (36%), Positives = 152/266 (57%), Gaps = 16/266 (6%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+ +  RYL + RK+ FISI +FIS  GV +GV+ALIVV++VM GF ED+ +++LG N 
Sbjct: 3   YELFIGLRYLKAKRKSTFISIITFISTAGVALGVLALIVVLAVMTGFEEDLKEKILGTNA 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGISNS 124
           H+V+ +    + DY  +  RL  +  V  V PF+  Q     LSSGG  SGV++RG+  +
Sbjct: 63  HIVVLKSSGGIEDYHAMMERLSAVKGVKAVTPFIYSQVM---LSSGGNVSGVVLRGVDPA 119

Query: 125 DFSYLQN-----------SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSP 173
               + N             +     +++      G+IIGK+LAR+L + +GD +N++SP
Sbjct: 120 TDPQVTNLSRSLVDGKLTDLTTVPAPLASAEPVRPGIIIGKELARSLNLYVGDTLNVISP 179

Query: 174 YGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
            G++TP+GM  + K + V+G+F     +YD+ + Y+ L EAQ + ++  AV+GI++ V D
Sbjct: 180 LGNITPLGMVPKMKQFRVVGLFNTGMFEYDSTLAYVGLGEAQEFLSMGKAVTGIQLRVAD 239

Query: 234 PDAIEKTHENIVRILGNGVVVIDWQQ 259
                +    I R LG      DW Q
Sbjct: 240 VYHTGEMVREINRDLGFPYYARDWMQ 265


>gi|258592405|emb|CBE68714.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [NC10 bacterium 'Dutch sediment']
          Length = 416

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 99/275 (36%), Positives = 156/275 (56%), Gaps = 13/275 (4%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ V  RYL + R  AFIS+ + IS  GV +GVMALIVV++VM+GF  D+  ++LG N 
Sbjct: 3   FELFVGLRYLKARRGQAFISLITLISIGGVALGVMALIVVLAVMSGFERDLRSKILGTNA 62

Query: 67  HV-VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI---S 122
           H+ +++     + D    A R+  +P V+ V PF   Q  +S    G  G ++RGI   S
Sbjct: 63  HLWIVRAGDRGIEDPVQTAARVREVPRVVAVSPFTYHQVMLS-TGRGAGGAVLRGIDLDS 121

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRG-------KGVIIGKDLARNLGISIGDKINILSPYG 175
             + + L  SF+        +   G       +G+IIG+ LA NLG+ +G ++N++SP+G
Sbjct: 122 AREVTTLTESFAEVDPTRLKEPAEGSGWRLDPEGIIIGRALATNLGVGLGGRVNVISPFG 181

Query: 176 DV-TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           +V TP G+  R +S+TV G+F M   +YD+ + Y+++  AQ  F +  +V+GIEV V D 
Sbjct: 182 NVLTPFGLAPRMRSFTVAGIFEMGMYEYDSALAYITITAAQQLFQMGQSVTGIEVKVDDL 241

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              ++   +I R LG   V  DW Q ++  F+  +
Sbjct: 242 YRAKEVGADIQRRLGFPYVARDWMQLHRNLFAALK 276


>gi|326387644|ref|ZP_08209250.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Novosphingobium nitrogenifigens DSM 19370]
 gi|326207690|gb|EGD58501.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Novosphingobium nitrogenifigens DSM 19370]
          Length = 413

 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 89/264 (33%), Positives = 138/264 (52%), Gaps = 3/264 (1%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
            S FE  +A RY+   R  AFI++ + IS + VM+GV AL++VMSVMNGFR D++ +++G
Sbjct: 3   LSSFERTIARRYILPGRGEAFIALVAGISLVAVMLGVAALVIVMSVMNGFRADLMDKIVG 62

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGH VIQ     L D+Q +  +L+  P + +  P +  Q  ++  +     ++ RG + 
Sbjct: 63  LNGHAVIQAYGGRLDDWQGLVRQLEKTPGITRATPLIE-QPLLATFNGRVEAIIARGNTQ 121

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           +D + +     +  G+  +       V IG  LA NLG+ +GD I +++P G  TP G  
Sbjct: 122 ADIARMAE--KKVAGSFKDIQPGASEVAIGSRLAENLGVQVGDTITVINPAGRTTPFGTV 179

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R   Y V  +F +   DYDN  V M + +AQ      + +  IEV  KDPD + +T   
Sbjct: 180 PREIGYRVAAIFEVGVYDYDNAFVVMPIPDAQTLLLTGDTIGMIEVMTKDPDTVGQTLAP 239

Query: 244 IVRILGNGVVVIDWQQRYQIFFSC 267
           I + L    VV DW+      F  
Sbjct: 240 IKQALNGRAVVTDWKTLNASLFQA 263


>gi|148265267|ref|YP_001231973.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Geobacter uraniireducens Rf4]
 gi|146398767|gb|ABQ27400.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Geobacter uraniireducens Rf4]
          Length = 424

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 96/270 (35%), Positives = 151/270 (55%), Gaps = 23/270 (8%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ +  RYL + RK+ FIS+ + IS  GV +GVMALI+V++VM GF ED+  ++LG N 
Sbjct: 3   FELFIGLRYLKAKRKSTFISLITLISVAGVALGVMALIIVLAVMTGFEEDLKDKILGTNA 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGISNS 124
           H+V+ +    + DY  +  RL  +  V+   PF+  Q     L++G   SGV++RGI   
Sbjct: 63  HIVVLKSSDGIEDYPRLTERLMGLKGVVAATPFIYSQVM---LTTGKNVSGVVLRGIDTK 119

Query: 125 DFSYLQNSFSRFYGNVSNDFDR------------GKGVIIGKDLARNLGISIGDKINILS 172
             + + N           D DR              GV+IGK+LA+NL + +GD +N++S
Sbjct: 120 SDAQVTNLHKAVVEGKLADLDRPAPLPLNSSEAPSPGVVIGKELAKNLNLFLGDTVNVVS 179

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G++TP+GM  + K + V+G+F     +YD+ + Y+ L EAQ +  +  AV+GI++ V+
Sbjct: 180 PMGNITPLGMMPKMKRFRVVGIFNTGMYEYDSTLAYVGLDEAQAFLGMGKAVTGIQLKVE 239

Query: 233 DPDAIEKTHENIVRI---LGNGVVVIDWQQ 259
           D   + KT   + RI   +G      DW Q
Sbjct: 240 D---VYKTGMLVRRINSEIGYPYFARDWMQ 266


>gi|330994072|ref|ZP_08318002.1| Lipoprotein-releasing system transmembrane protein lolC
           [Gluconacetobacter sp. SXCC-1]
 gi|329759018|gb|EGG75532.1| Lipoprotein-releasing system transmembrane protein lolC
           [Gluconacetobacter sp. SXCC-1]
          Length = 414

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 86/269 (31%), Positives = 142/269 (52%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F  FE +VA RYL + R   F+S+ +  S +G+ +GV  LI+VMSVMNGF+ D++ R+L
Sbjct: 1   MFGPFERMVAGRYLHARRGERFVSVIAIFSLVGIALGVATLIIVMSVMNGFKADLLGRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSG--GSGVLVRG 120
           G+NG + +      + DY  +A R+  +P V+   P V  Q     L+SG   +G LVRG
Sbjct: 61  GLNGDLSVYGLTRTITDYDDVAGRVRRVPGVVSAAPLVESQVL---LNSGTYNAGGLVRG 117

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           ++ +D   L            +DF     +++G  LA   G+++G ++ ++SP G  T  
Sbjct: 118 MTRADLLGLHEVSDNLVAGSVDDFGADDTIVVGTTLAERAGLTVGGRLTLVSPQGAATAF 177

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G   R ++Y V+ +F     DY+   V++ L  AQ+YF L   V+ ++V  +D + +   
Sbjct: 178 GTMPRVRAYRVVAIFDAGVNDYNASYVFLPLHAAQVYFQLPGQVTQVQVMTRDAENVAPI 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              I + +   V V+DW Q    FF   +
Sbjct: 238 RAAIEKAMNGEVRVMDWTQSNNAFFGAVQ 266


>gi|198282780|ref|YP_002219101.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218667228|ref|YP_002424977.1| lipoprotein releasing system transmembrane protein LolC
           [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|198247301|gb|ACH82894.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218519441|gb|ACK80027.1| lipoprotein releasing system transmembrane protein LolC
           [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 414

 Score =  163 bits (413), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 90/268 (33%), Positives = 150/268 (55%), Gaps = 14/268 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+ +  RY  + R+N FIS  +  + +G++IGV ALI VM+VMNGF   +  R+L +  
Sbjct: 4   YELWIGLRYTRAKRRNHFISFITGTAIMGMVIGVAALIAVMAVMNGFDHTLRSRILAVTS 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVS--GLSSGGSGVLVRGISNS 124
            V+IQ    P++D+     RL  +P V  V P+V  QA +S  GL SG    ++ GI  +
Sbjct: 64  DVIIQGNGVPVLDWPTAVKRLSTVPGVTGVAPYVQAQAMLSHEGLVSGA---VIEGIDPA 120

Query: 125 DFSYLQNSFSRF-----YGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
               L+N  ++       G + +       +++G+ LAR LG+++GDKI ++SP G VTP
Sbjct: 121 ----LENRVNKLNQDMKMGELQSLQTHPWSIVLGRALARQLGVTVGDKITLISPQGGVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           +G+    + +TV+G+F +    YD+GM Y++L +AQ  + L   V+G+ + +KDP     
Sbjct: 177 LGVTPALRQFTVVGLFSVGIYAYDSGMAYINLGDAQRLYGLNQGVTGLRMQIKDPFTAPA 236

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSC 267
              ++ + LG    + DW Q ++ FF  
Sbjct: 237 FAAHLQQQLGAAFYIQDWTQTHENFFKA 264


>gi|82703624|ref|YP_413190.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Nitrosospira multiformis ATCC 25196]
 gi|82411689|gb|ABB75798.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Nitrosospira multiformis ATCC 25196]
          Length = 414

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 90/268 (33%), Positives = 152/268 (56%), Gaps = 4/268 (1%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
            S +E+ +  RY  + R+N FIS  S IS +G+ +G+ ALI VMSVMNGF++++  R+LG
Sbjct: 1   MSSYELFIGLRYTRAKRRNHFISFISLISLLGITLGMTALITVMSVMNGFQKEVRSRILG 60

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ +      L D++ +A      P+V    P++S Q  VS      SGV VRGI  
Sbjct: 61  VASHIQVSGVEGTLTDWRKVAEEARRHPEVEAAAPYISAQGMVS-FDQAVSGVAVRGILP 119

Query: 124 SDFSYLQNSFSRFY--GNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
               ++ +   R    G + N      G++IG++LAR+LG+  GD+I ++SP G VTP G
Sbjct: 120 GMEDHVAD-LGRMMIDGRLENLAPGEFGIVIGRELARSLGVFTGDRIVLISPQGQVTPAG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R K +T++G+F     +YD+G+V + L +AQ  + +EN VSG+ + + D     +  
Sbjct: 179 IIPRLKQFTIIGIFEAGHFEYDSGLVLIHLADAQKLYRMENQVSGVRLKLHDLFKAPQVA 238

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +V ++ + V + DW +++  +F   +
Sbjct: 239 RELVPLISSDVYISDWTRQHANYFRAIQ 266


>gi|297569277|ref|YP_003690621.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296925192|gb|ADH86002.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 409

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 98/266 (36%), Positives = 149/266 (56%), Gaps = 11/266 (4%)

Query: 12  AW----RYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGH 67
           AW    RYL + R+  FIS+ S IS  GVM+GV ALIVV++VM GF  +   ++LGIN H
Sbjct: 4   AWFISRRYLQAKRRKGFISLISLISVAGVMVGVAALIVVLAVMTGFTAEFRDKILGINSH 63

Query: 68  VVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFS 127
           +++QQ  Y + +Y   A R+  IP V  V P++ GQA ++G   GG+G +VRGI     +
Sbjct: 64  IIVQQPGYEIDNYHEPARRIAAIPGVAGVTPYIYGQAMITG-GVGGTGAIVRGIDPETVN 122

Query: 128 -YLQNSFSRFYGNVSN-----DFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
             LQ       G ++      +     GVI+GKDLARNLG+ + D++ ++S  G +TPMG
Sbjct: 123 RVLQLEDYLEAGELAGLAAPANRRAAPGVILGKDLARNLGVGLDDRVKLISAAGPLTPMG 182

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  +  ++ V G+F     +YD+ + Y+SL  A+ + +L + V G+EV V D +  ++  
Sbjct: 183 VIPQITTFRVAGLFASGMYEYDSSLAYLSLDTAREFMDLGDRVHGLEVRVDDINRADRIA 242

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
             I   LG      DW    +  FS 
Sbjct: 243 RAINDELGPSYHARDWMNMNRQIFSA 268


>gi|224827159|ref|ZP_03700255.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Lutiella nitroferrum 2002]
 gi|224600668|gb|EEG06855.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Lutiella nitroferrum 2002]
          Length = 415

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 87/264 (32%), Positives = 144/264 (54%), Gaps = 2/264 (0%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE ++ +RYL + R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+LG+  
Sbjct: 5   FEALIGFRYLRAKRRNGFISFISLVSVLGIALGVAALIIVLSVMNGFQKEIRGRILGVAS 64

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           HV +      L D+Q +A      P VI   PFV+ Q  +S  +    G L+RGI  +  
Sbjct: 65  HVEVSTYQGKLSDWQSVAGLAAKEPHVIAAAPFVNAQGLMSA-AGNVRGALIRGIDPASE 123

Query: 127 SYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIR 185
             + +               G+ G+++G +LAR L +  GDK+ +++P G VTP GM  R
Sbjct: 124 DRVVDVGKHMVTGKLASLKPGEFGILLGVELARQLNVVTGDKVTVITPEGSVTPAGMLPR 183

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIV 245
            K +TV+GMF++   +YD+ +  + L++AQ+ F + + VSG+ + + DP A       + 
Sbjct: 184 LKQFTVVGMFKVDMFEYDSSLAMIHLKDAQVLFRMGSMVSGVRLKLDDPMAAPLVKAELR 243

Query: 246 RILGNGVVVIDWQQRYQIFFSCYE 269
             L    +  DW      +F   +
Sbjct: 244 NKLSASALTTDWTDTNANYFRAVQ 267


>gi|94270668|ref|ZP_01291796.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [delta proteobacterium MLMS-1]
 gi|93450712|gb|EAT01790.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [delta proteobacterium MLMS-1]
          Length = 410

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 93/268 (34%), Positives = 151/268 (56%), Gaps = 8/268 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           F   V+ RYL + R   FIS+ S IS  GVM+GV ALIVV++VM GF  +   ++LGIN 
Sbjct: 3   FPWFVSRRYLKAKRHRGFISLISLISVAGVMVGVAALIVVLAVMTGFTAEFRDKILGINS 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+V+Q+    ++D++  A R+  IP V  V P++ GQ  ++G   GG+G ++RGI  +  
Sbjct: 63  HIVVQKSGAEMLDHRQPAARIAEIPGVDGVTPYIYGQGMITG-GVGGTGAIIRGIEPATV 121

Query: 127 SYLQNSFSRFYGNVSNDFD------RGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           + +             D        R  GVI+G+DLA  LG+++G+++ +LS  G +TPM
Sbjct: 122 TEVLQLDDYLEAGELTDLAVPPGSRRAPGVILGRDLAEQLGVTVGERVKLLSASGPLTPM 181

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPDAIEK 239
           G+  + K+  V+G+F     +YD+ + Y+ L  A+ + +L  +AV G+EV V + +  ++
Sbjct: 182 GVMPKIKTCLVVGIFSSGMYEYDSSLAYLDLATARDFMDLGSSAVHGLEVRVANINRADR 241

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSC 267
               I + LG G    DW   ++  FS 
Sbjct: 242 IALQINQELGPGYQARDWMNMHRNIFSA 269


>gi|94267599|ref|ZP_01290934.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [delta proteobacterium MLMS-1]
 gi|93451928|gb|EAT02650.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [delta proteobacterium MLMS-1]
          Length = 410

 Score =  162 bits (411), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 93/268 (34%), Positives = 150/268 (55%), Gaps = 8/268 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           F   V+ RYL + R   FIS+ S IS  GVM+GV ALIVV++VM GF  +   ++LGIN 
Sbjct: 3   FSWFVSRRYLKAKRHRGFISLISLISVAGVMVGVAALIVVLAVMTGFTAEFRDKILGINS 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+V+Q+    ++D++  A R+  IP V  V P++ GQ  ++G   GG+G ++RGI     
Sbjct: 63  HIVVQKSGAEMLDHRQPAARIAEIPGVDGVTPYIYGQGMITG-GVGGTGAIIRGIEPETV 121

Query: 127 SYLQNSFSRFYGNVSNDFD------RGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           + +             D        R  GVI+G+DLA  LG+++G+++ +LS  G +TPM
Sbjct: 122 TEVLQLDDYLEAGELTDLAVPPGSRRAPGVILGRDLAEQLGVTVGERVKLLSASGPLTPM 181

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPDAIEK 239
           G+  + K+  V+G+F     +YD+ + Y+ L  A+ + +L  +AV G+EV V + +  ++
Sbjct: 182 GVMPKIKTCLVVGIFSSGMYEYDSSLAYLDLATARDFMDLGSSAVHGLEVRVANINRADR 241

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSC 267
               I + LG G    DW   ++  FS 
Sbjct: 242 IALQINQELGPGYQARDWMNMHRNIFSA 269


>gi|126725671|ref|ZP_01741513.1| lipoprotein releasing system transmembrane protein LolE
           [Rhodobacterales bacterium HTCC2150]
 gi|126704875|gb|EBA03966.1| lipoprotein releasing system transmembrane protein LolE
           [Rhodobacterales bacterium HTCC2150]
          Length = 428

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 99/279 (35%), Positives = 145/279 (51%), Gaps = 19/279 (6%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSRFE ++AWRYL + R    IS+ ++IS IG+ + V ALI  ++V +GFR + +  +LG
Sbjct: 8   FSRFEWMIAWRYLRARRSEGGISVMTWISLIGIALAVFALIATLAVRSGFRSEFVDTILG 67

Query: 64  INGHVVIQQKYYPL------------VDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSS 111
            N HV +   Y PL             DY  +A R+  +  V++V P + G+  VS L +
Sbjct: 68  ANAHVAV---YSPLRVDEFGKTTRLIADYDEMAERVRAVDGVVRVAPILKGEVLVS-LRN 123

Query: 112 GGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINI 170
             +GV + G+S +D   L    +        D +R G+G+ IG  +AR LG  +GD+I I
Sbjct: 124 RSAGVQIYGMSPNDLLSLPGMVNS--DQAIGDINRFGEGLAIGSGVARQLGAGLGDRIKI 181

Query: 171 LSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVF 230
           LSP G  T  G   R K+Y +  +F +   D D   +YM L EAQ +FN E  V  +EV 
Sbjct: 182 LSPDGVKTAFGTSPRVKTYEITYIFSLGRYDIDRVRIYMPLTEAQSFFNAEERVEELEVM 241

Query: 231 VKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           V  P+ IE+    I+R  G   ++  WQ     F    E
Sbjct: 242 VDRPELIEQYELPILRAAGTDAILWTWQDSSGSFLRALE 280


>gi|114327947|ref|YP_745104.1| lipoprotein releasing system transmembrane protein lolE
           [Granulibacter bethesdensis CGDNIH1]
 gi|114316121|gb|ABI62181.1| lipoprotein releasing system transmembrane protein lolE
           [Granulibacter bethesdensis CGDNIH1]
          Length = 417

 Score =  162 bits (409), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 141/265 (53%), Gaps = 2/265 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F+ FE  VA RYL + +   F+S+ +  S IG+ +GV  LIVV SVM+GFR+D++ R+L
Sbjct: 1   MFNAFERAVAARYLRARKGERFVSVIALFSLIGIALGVATLIVVSSVMSGFRQDIVNRML 60

Query: 63  GINGHVVIQQ-KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
           G+NGH  I+      L DYQ I +RL  +P V   +P + GQ  +S  + G +GVLVRG+
Sbjct: 61  GVNGHAEIEAYAGEQLHDYQAIVSRLKALPQVASAMPMIQGQVLLSTDAGGSTGVLVRGM 120

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
              D + +            +D      + IG  LA+   +  GD + +L+  G  T +G
Sbjct: 121 EPKDIAAMPAIGGHIVMGSLDDLKGDDAIAIGAGLAQRFRLRPGDPVTLLAKEGAATAIG 180

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R  +Y V+ +F      YD+G+V++ L  AQ++F   +  +GIE+ V  PD ++   
Sbjct: 181 VIPRVATYRVVAVFSAGLSQYDSGVVFLPLHAAQIFFQKPDGATGIEIRVHQPDQVDAIV 240

Query: 242 ENIVRIL-GNGVVVIDWQQRYQIFF 265
            ++ + L G      DW+    +  
Sbjct: 241 PDLRQALNGQKAFARDWRHSNDLLL 265


>gi|296116518|ref|ZP_06835128.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Gluconacetobacter hansenii ATCC 23769]
 gi|295976730|gb|EFG83498.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Gluconacetobacter hansenii ATCC 23769]
          Length = 415

 Score =  162 bits (409), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 89/270 (32%), Positives = 143/270 (52%), Gaps = 6/270 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F  FE  VA RYL + R   F+S+ +  S +G+ +GV  LI+VMSVMNGF+ D++ R+L
Sbjct: 1   MFGPFERAVAGRYLHARRGERFVSVIAIFSLVGIALGVATLIIVMSVMNGFKADLLGRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRG 120
           G+NG + +      + DY  +A R+  +P V    P +  Q     L+SGG  +G LVRG
Sbjct: 61  GLNGDLSVYGISRTISDYDALAGRIRKVPGVESANPLIEAQVL---LNSGGYNAGGLVRG 117

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           ++ +D   L+           ++F     +++G  LA   G+S+G ++ ++SP G  T  
Sbjct: 118 MTQADLQGLKEISGSLVAGSLDEFGSDDTIVVGTTLAERAGLSVGARLTLVSPNGAATAF 177

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G   R ++Y V+ +F     DY+   V++ L  AQ+YF +   V+ I+V   D + +   
Sbjct: 178 GTMPRVRAYRVIAIFDAGVNDYNASYVFLPLHAAQVYFQMPRQVTQIQVMTHDAENVGPI 237

Query: 241 HENIVRILGNGVV-VIDWQQRYQIFFSCYE 269
             NI + LG   V V+DW Q    FF   +
Sbjct: 238 RANIEQALGGTQVRVMDWTQSNNAFFGAVQ 267


>gi|328954382|ref|YP_004371716.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfobacca acetoxidans DSM 11109]
 gi|328454706|gb|AEB10535.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfobacca acetoxidans DSM 11109]
          Length = 409

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 89/269 (33%), Positives = 148/269 (55%), Gaps = 6/269 (2%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           +FE +VA RYL + R+  FIS+ SFIS  GV +GVMAL+VV+ VM GF +D+ +++L +N
Sbjct: 2   QFERLVALRYLKAKRREKFISLISFISIAGVAVGVMALLVVIGVMTGFDQDLKRKILSVN 61

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
            HV++ +  Y +VDY  +  +++ +P V    PF+  Q   SG ++   GV +RG+  + 
Sbjct: 62  AHVILIKPGYSIVDYDALVKKVEAVPGVASAKPFIYTQVMFSGPNNISGGV-IRGLDLAS 120

Query: 126 FSYLQNSFSRFYGNVSNDFDRGK-----GVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
                 +            D+ +      V +G +LA+N+G+ +G +I I+SP G +TPM
Sbjct: 121 IHQGGPAAIEVRDGSFTTLDKVQPAELPSVAVGNELAKNIGVRVGSQIKIISPLGTLTPM 180

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G   R K++ V  +F     ++DN +VY S+ + Q Y  L + V+G+E+ V D  A +  
Sbjct: 181 GRIPRVKNFQVGAIFHSGMFEFDNTLVYASIPQVQEYLGLGDKVTGLEIRVDDIYAADTV 240

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +   LG G    DW +  +  F+  +
Sbjct: 241 AAAVQTALGPGYQTRDWMRMNRSLFAALK 269


>gi|114763440|ref|ZP_01442847.1| lipoprotein releasing system transmembrane protein LolE [Pelagibaca
           bermudensis HTCC2601]
 gi|114543978|gb|EAU46989.1| lipoprotein releasing system transmembrane protein LolE
           [Roseovarius sp. HTCC2601]
          Length = 428

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 94/277 (33%), Positives = 144/277 (51%), Gaps = 15/277 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++AWRYL + R    +S+ ++IS +G+ + V ALI  ++V +GFR + +  +LG
Sbjct: 8   FAPFEWMIAWRYLRARRAEGGVSVMTWISLVGITLAVFALIATLAVRSGFRAEFVDTILG 67

Query: 64  INGHVVI---------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSG-G 113
            N HV +          +      DY   A R+  +P VI+V P V GQ  V G ++G  
Sbjct: 68  ANAHVTVYASQRLDEYDRPVRTFDDYAERAARVAEVPGVIRVAPLVKGQ--VMGTAAGRN 125

Query: 114 SGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINILS 172
           +GV V GI+  D   +        G    D D   +G+ IG  +AR LG+S+GD++ ++S
Sbjct: 126 AGVEVFGIAEDDLKGIPRIADPETGQ--GDIDNFEQGIAIGSGVARELGLSVGDQLKLIS 183

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G+  R K Y V+ +F     D D   VYM  +EAQLYFN E     +EV + 
Sbjct: 184 PDGVRTAFGVSPRVKLYDVVYIFTAGRYDIDRTRVYMPFEEAQLYFNREGVADELEVMID 243

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           DP+ +E+    +++  G G ++  WQ     F    E
Sbjct: 244 DPERVERLALPVLQAAGEGALIWTWQDASGAFLRALE 280


>gi|56696020|ref|YP_166374.1| lipoprotein releasing system transmembrane protein LolE [Ruegeria
           pomeroyi DSS-3]
 gi|56677757|gb|AAV94423.1| lipoprotein releasing system transmembrane protein LolE [Ruegeria
           pomeroyi DSS-3]
          Length = 447

 Score =  159 bits (403), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 96/280 (34%), Positives = 145/280 (51%), Gaps = 21/280 (7%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE  +AWRYL + R    +S+ ++IS IG+ + V ALI  ++V +GFR D +  +LG
Sbjct: 27  FAPFEWKIAWRYLRARRAEGGVSVMTWISLIGITLAVFALIATLAVRSGFRSDFVGTILG 86

Query: 64  INGHVVIQQKYYP------------LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSS 111
            N HV +   Y P            + +Y  +A R+  +  V +  P V GQ   +  + 
Sbjct: 87  ANAHVTV---YNPGEYRENGQIDRTIPNYAEMAARVAEVAGVTRAAPLVKGQVMAAAQNR 143

Query: 112 GGSGVLVRGISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKIN 169
             +GV V GI+  D + L    +  R YG++S  FD  +G+ +G  +AR LG+++GD+I 
Sbjct: 144 N-AGVEVFGIATGDLAALPGITNSDRSYGDLSR-FD--QGIALGSGVARELGVTVGDRIK 199

Query: 170 ILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEV 229
           ++SP G  TPMG   R  +Y V+ +F     D D   VYM   EAQ YFN E     IEV
Sbjct: 200 LISPNGARTPMGTSPRVNAYEVVYVFSAGRYDIDRTRVYMPFGEAQAYFNREGVADEIEV 259

Query: 230 FVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            V +P+ +++    I+   G+G  V  WQ     F    E
Sbjct: 260 MVSEPERLDRVLIPILSAAGDGAQVWTWQDASGGFLRALE 299


>gi|83858392|ref|ZP_00951914.1| hypothetical protein OA2633_02796 [Oceanicaulis alexandrii
           HTCC2633]
 gi|83853215|gb|EAP91067.1| hypothetical protein OA2633_02796 [Oceanicaulis alexandrii
           HTCC2633]
          Length = 444

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 153/278 (55%), Gaps = 12/278 (4%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSR+E ++A++YL + RK+  +++ S ISF+G+M+ V  LI VMSVMNGFR +++ R+LG
Sbjct: 19  FSRYEFLLAFKYLRARRKHGGVTLISVISFVGIMLAVAVLITVMSVMNGFRHELLTRLLG 78

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG----SGVLVR 119
           +  HV +          + +A+R+  +  V +  P  +GQA V+   S      SGV   
Sbjct: 79  VQPHVYVMVPADQGELSRTLADRIRALDGVRQAGPVATGQALVTSGRSAAFASVSGVRPE 138

Query: 120 GISNSDF-SYLQNSFSRFYGNVSNDFDR-GKG------VIIGKDLARNLGISIGDKINIL 171
            ++  D  +    +     G  +   DR G+G      +I+G  +A  LG+ +GD++ ++
Sbjct: 139 DLARFDLITGAHGADDAGGGLAAGSIDRFGEGRNGGDVIIMGTVMANQLGVGVGDQVTLV 198

Query: 172 SPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFV 231
           SP G  T +GM  RSK YT+ G+  +   D D  ++YM L +A L+FN       I+V +
Sbjct: 199 SPQGATTALGMTPRSKRYTIGGLLSVGVQDLDQVLIYMPLDQASLFFNKPAQGEYIDVRI 258

Query: 232 KDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +PDA E   E I  +   G V+ DW+++ Q F++  +
Sbjct: 259 ANPDAPEPVMEQIRAMAPQGAVIFDWRRQNQAFWNALQ 296


>gi|222055189|ref|YP_002537551.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Geobacter sp. FRC-32]
 gi|221564478|gb|ACM20450.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Geobacter sp. FRC-32]
          Length = 424

 Score =  159 bits (401), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 94/270 (34%), Positives = 152/270 (56%), Gaps = 23/270 (8%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ +  RYL + RK  FIS+ + IS  GV +GVMALI+V++VM GF ED+ +++LG N 
Sbjct: 3   FELFIGLRYLKAKRKATFISLITLISVAGVALGVMALIIVLAVMTGFEEDLKEKILGTNA 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGISNS 124
           H+V+ +    + D+Q + +RL     V+   PF+  Q     L++G   SGV++RG+   
Sbjct: 63  HIVVLKSGEGIEDHQQLMDRLKKFKGVVATTPFIYSQVM---LTTGKNVSGVVLRGVDTK 119

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGK------------GVIIGKDLARNLGISIGDKINILS 172
             + + N           D DR              G++IGK+LA+NL + +GD +N++S
Sbjct: 120 TDAQVTNLHKTVVEGNLVDLDRRTPLPSKSDESPLPGIVIGKELAKNLNLFLGDSVNVVS 179

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G++TP+GM  + K + ++G+F     +YD+ + Y+ L +AQ +  L +AV+GI++ V 
Sbjct: 180 PMGNITPLGMMPKMKRFRLVGIFNTGMFEYDSTLAYVGLGDAQDFLGLGSAVTGIQLKVA 239

Query: 233 DPDAIEKTHENIVRI---LGNGVVVIDWQQ 259
           D   + K+ E   RI   LG      DW Q
Sbjct: 240 D---VYKSGEITRRINQELGFPYFARDWMQ 266


>gi|51245480|ref|YP_065364.1| lipoprotein releasing system transmembrane protein (LolC)
           [Desulfotalea psychrophila LSv54]
 gi|50876517|emb|CAG36357.1| related to lipoprotein releasing system transmembrane protein
           (LolC) [Desulfotalea psychrophila LSv54]
          Length = 410

 Score =  158 bits (399), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 89/269 (33%), Positives = 149/269 (55%), Gaps = 6/269 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E  ++ RYL +  K  FIS+ S IS  G+ +GV+ALIVVM+V +GF   +  ++LG+N 
Sbjct: 4   YEWFISLRYLRAKHKQRFISLISLISIAGITVGVIALIVVMAVYSGFTTSLRDQILGVNA 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD- 125
           H+++QQ+   + DY  +   +  +P+V    P++  Q  +S    GGSGV++RGI  +  
Sbjct: 64  HIIVQQQGGKMYDYLNVRKEIIALPNVRGATPYLYAQTLLSSPRGGGSGVVLRGIDPTTA 123

Query: 126 ---FSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
                  +   +    N+++   R   +IIGK+LA+NL +  GDK+ ++SP G +TPMG+
Sbjct: 124 VGVLGLPEQMIAGKVDNLTDKTTRVPNIIIGKNLAKNLRVGQGDKVRLISPSGPLTPMGV 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFV--KDPDAIEKT 240
             +  +  V G+F     +YD+ + YMS+   Q +    +   GIEV V     D+ ++ 
Sbjct: 184 IPKITTCQVSGIFETGMYEYDSTLAYMSIANTQNFLASGDLAHGIEVTVDHNKLDSADQI 243

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              I + LG+  VV DW Q  Q  F+ ++
Sbjct: 244 AATIRKSLGSLYVVRDWMQMNQNLFAAFK 272


>gi|254420218|ref|ZP_05033942.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brevundimonas sp. BAL3]
 gi|196186395|gb|EDX81371.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brevundimonas sp. BAL3]
          Length = 428

 Score =  158 bits (399), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 88/269 (32%), Positives = 141/269 (52%), Gaps = 6/269 (2%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS +E+ +A RYL + RK   ++  + ISFIG+M+ V  LI VMS+M GFR +++ R+L 
Sbjct: 11  FSSWEIGLALRYLRAKRKEGGVATIAVISFIGIMLAVAVLISVMSIMAGFRSELLGRMLS 70

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
            NGH+ +Q       D      R+  +P V+ V P    Q+ V  + +  +G +VRG+  
Sbjct: 71  FNGHMYVQGPVLASEDRDAALKRIAAVPGVVSVTPLNESQSLVR-VGNFTTGAMVRGVRP 129

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK----GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
            D +  +  F         DF +G      +++G  LA +LG+ +GD + + SP G  + 
Sbjct: 130 QDLATTKYVFDSLTPKERADFGKGAYGGDRILMGAALANSLGLRVGDPVTLYSPTGADSA 189

Query: 180 MG-MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
            G +G   K+Y V G+FR    D+D   ++M L++ QL+F  E     IE+ V DPD + 
Sbjct: 190 FGNLGGLEKTYFVGGLFRSGTADFDRAFLFMPLEQQQLFFGKEGVWDAIEIKVDDPDRVG 249

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSC 267
           +    I    G G V+ DW++R   F+  
Sbjct: 250 ELTPAIRDAAGPGSVISDWRERLAAFYGA 278


>gi|126732791|ref|ZP_01748586.1| lipoprotein releasing system transmembrane protein LolE [Sagittula
           stellata E-37]
 gi|126706787|gb|EBA05858.1| lipoprotein releasing system transmembrane protein LolE [Sagittula
           stellata E-37]
          Length = 427

 Score =  157 bits (397), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 143/276 (51%), Gaps = 13/276 (4%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++AWRYL + R    +S+ ++IS +G+ + V ALI  ++V +GFR + +  +LG
Sbjct: 7   FAPFEWMIAWRYLRARRAEGGVSVMTWISLVGITLAVFALIATLAVRSGFRAEFVDTILG 66

Query: 64  INGHVVI------QQKYYP---LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N H+ +       +   P   + DY+ +A +++ +P + +V P V GQ   +  +   +
Sbjct: 67  SNAHMTVYSTTRTDEAGNPDRTIADYEGMAQQVERVPFIQRVAPLVKGQVMATA-NGNNA 125

Query: 115 GVLVRGISNSDFSYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINILSP 173
           GV V GI+  D   +        G    D DR G+GV IG  +A  LG+ +GD + ++SP
Sbjct: 126 GVEVFGIAPDDLKAIPRIADPETGR--GDLDRFGEGVAIGSGVAMMLGVGVGDDVKLISP 183

Query: 174 YGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
            G  T  G+  R KSYTV  +F     D D   +YM   EAQLYFN E     +EV V D
Sbjct: 184 NGVKTAFGVSPRVKSYTVTWIFTAGRYDIDRTRIYMPFTEAQLYFNREGVADELEVIVSD 243

Query: 234 PDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           P+ +E   + +   +G G ++  WQ     F    E
Sbjct: 244 PEDVESFVQPVSEAVGPGALIWTWQDASGGFLRALE 279


>gi|159043299|ref|YP_001532093.1| lipoprotein releasing system [Dinoroseobacter shibae DFL 12]
 gi|157911059|gb|ABV92492.1| lipoprotein releasing system [Dinoroseobacter shibae DFL 12]
          Length = 428

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/276 (32%), Positives = 136/276 (49%), Gaps = 13/276 (4%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+RFE ++AWRYL + R    +S+ ++IS +G+ + V ALI  ++V +GFR + +  +LG
Sbjct: 8   FARFEWLIAWRYLRARRSEGGVSVMTWISLVGITLAVFALIATLAVRSGFRAEFVDTILG 67

Query: 64  INGHVVIQQKYYP---------LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +    Y          L +Y      L  +P V +  P + GQ  ++      S
Sbjct: 68  ANAHVTVYGAIYDAETGATSRLLTEYAARTEALAAVPGVTRAAPLIRGQ-VITTHEGRTS 126

Query: 115 GVLVRGISNSDFSYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINILSP 173
           GV V G+S  D   L    +        D DR   G+ IG  +AR LG  +GD I ++SP
Sbjct: 127 GVEVFGLSEGDLRSLPGIAAD--ETARGDLDRFSDGIAIGSGVARELGAGVGDMIRLISP 184

Query: 174 YGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
            G  TP G   R K+Y V+ +F +   D D   VYM   EAQ +FN E     IEV V D
Sbjct: 185 DGVKTPFGTSPRVKAYEVVYVFSLGRFDIDRTRVYMPFAEAQAFFNREGGADEIEVMVAD 244

Query: 234 PDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           P+ +++    +++  G G ++  WQ     F    E
Sbjct: 245 PENLDRYTLGLMQAAGQGALLWTWQDASGGFLRALE 280


>gi|218661192|ref|ZP_03517122.1| lipoprotein ABC transporter, permease protein [Rhizobium etli
           IE4771]
          Length = 344

 Score =  156 bits (395), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 76/194 (39%), Positives = 107/194 (55%)

Query: 76  PLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSR 135
           P  DY  +A+RL  +P V   LP V GQ   S  + G +G LVRG    D + L+     
Sbjct: 3   PFTDYPELASRLAAVPGVKMALPLVEGQVLASAQAGGSTGALVRGARAEDLTKLKTISDN 62

Query: 136 FYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMF 195
                   +  G+GV+IG  +A  LG+ +GD I + SP GDVTPMG+  R KSY + G+F
Sbjct: 63  IKSGDMVGYASGEGVLIGTRMADQLGLRVGDLITLTSPEGDVTPMGVNPRVKSYKISGLF 122

Query: 196 RMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVI 255
            +   +YD+ +++M L+EAQLYFN    V  IE+FV  PD I+     +    G  + + 
Sbjct: 123 EIGMSEYDSSIIFMPLEEAQLYFNAAGLVQSIELFVDHPDDIDALRPKVEEAAGRQINLT 182

Query: 256 DWQQRYQIFFSCYE 269
           DW+QR Q FFS  +
Sbjct: 183 DWRQRNQTFFSALQ 196


>gi|114776311|ref|ZP_01451356.1| lipoprotein releasing system trasmembrane protein [Mariprofundus
           ferrooxydans PV-1]
 gi|114553141|gb|EAU55539.1| lipoprotein releasing system trasmembrane protein [Mariprofundus
           ferrooxydans PV-1]
          Length = 405

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 94/266 (35%), Positives = 146/266 (54%), Gaps = 13/266 (4%)

Query: 10  IVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVV 69
           ++A RYL S R   F+S+ S+ S IG+ IGVM LIVV+SVMNG   ++  ++LG + HV 
Sbjct: 1   MLARRYLRSRRSERFVSLISWSSGIGIAIGVMTLIVVLSVMNGAAVEIRDKILGFSSHVD 60

Query: 70  IQQKYYPLVDYQF---IANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           IQ     L  +      A+RLD    V++V P++S Q   S   +   G +++G+  ++ 
Sbjct: 61  IQGPDESLHGWHAWLDTASRLD---GVVRVAPYISTQVLASA-GTRAVGAILKGVDPANS 116

Query: 127 SYLQNSF--SRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGI 184
           S + +     RF     + F     V+IGKDLA  LG+++GDK+ ++SP G ++P G   
Sbjct: 117 SEIADHVVQGRFIKTDKSPFQ----VVIGKDLAHKLGLTVGDKVRLMSPSGGISPSGATP 172

Query: 185 RSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENI 244
           R +++ V+G+F   F +YD GM+   L   Q    + N ++GIEVF+KD D         
Sbjct: 173 RMRAFDVVGIFDSGFYEYDVGMIITPLSAVQRLNRMGNGITGIEVFLKDRDQASAVAAMA 232

Query: 245 VRILGNGVVVIDWQQRYQIFFSCYES 270
              L  G  V DWQ R++ FF   ++
Sbjct: 233 REQLPAGAWVTDWQHRHRSFFKALKT 258


>gi|85860097|ref|YP_462299.1| lipoprotein releasing system, permease component [Syntrophus
           aciditrophicus SB]
 gi|85723188|gb|ABC78131.1| lipoprotein releasing system, permease component [Syntrophus
           aciditrophicus SB]
          Length = 425

 Score =  155 bits (393), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 87/254 (34%), Positives = 145/254 (57%), Gaps = 19/254 (7%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E  +  RYL + RK  F+SI +FIS  G+ +GV ALI+V++VMNGF  D+  ++LGIN 
Sbjct: 3   YEFFINLRYLRAKRKQVFVSIITFISIAGIFLGVAALIIVLAVMNGFETDLRNKILGINS 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+V+ +    + +Y  +   +  +P V+   PF+  QA +    +G SGV++RG+S  D 
Sbjct: 63  HIVLMEYQGMMKNYVQVMQEVKEVPGVVATTPFIYSQAMLKS-ENGMSGVVLRGLSLKD- 120

Query: 127 SYLQNSFSRFY--------------GNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           ++      R +              G    + +   G++IG++LA+NLG+ + D + I++
Sbjct: 121 AFGVIDLGRMHAGSVQALAEPVRRDGATEGEPEVLPGIVIGRELAKNLGLILHDSVYIIT 180

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  TPMG   R K + V+G+F   F +YD+ + Y+SL++ Q + NL++  SG+E+ V 
Sbjct: 181 PMGISTPMGYVPRMKKFVVVGIFDSGFYEYDSTLAYLSLRDCQAFLNLDDVASGLEIKVN 240

Query: 233 D---PDAIEKTHEN 243
           D    D I +T E 
Sbjct: 241 DIYRADTIARTIEK 254


>gi|260427455|ref|ZP_05781434.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Citreicella sp. SE45]
 gi|260421947|gb|EEX15198.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Citreicella sp. SE45]
          Length = 428

 Score =  155 bits (393), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 93/279 (33%), Positives = 142/279 (50%), Gaps = 19/279 (6%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++AWRYL + R    +S+ ++IS +G+ + V ALI  +SV +GFR + +  +LG
Sbjct: 8   FAPFEWMIAWRYLRARRAEGGVSVMTWISLVGITLAVFALIATLSVRSGFRAEFVDTILG 67

Query: 64  INGHVVIQQ-----------KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSG 112
            N HV +             + +P  DY   A R+  +P V +V P V GQ  V G ++G
Sbjct: 68  ANAHVTVYAQSREDEFGRVVRTFP--DYTQRAERVAEVPGVTRVAPLVKGQ--VMGTANG 123

Query: 113 -GSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINI 170
             +GV V GI+  D + +        G    D  R  +G+ IG  +AR LG+ +GD++ +
Sbjct: 124 RNAGVEVFGIAADDLAAIPRIADPETGQ--GDMARFDEGIAIGSGVARELGVGVGDEVRL 181

Query: 171 LSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVF 230
           +SP G  T  G+  R  SY V+ +F     D D    YM  +EAQLYFN E     +EV 
Sbjct: 182 ISPDGVKTAFGVSPRVVSYEVVYIFTAGRYDIDRTRAYMPFEEAQLYFNREGVADELEVM 241

Query: 231 VKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +DP+ +E     + +  G G ++  WQ     F    E
Sbjct: 242 TEDPEHVEDIALGVQQAAGQGALIWTWQDASGAFLRALE 280


>gi|317153109|ref|YP_004121157.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio aespoeensis Aspo-2]
 gi|316943360|gb|ADU62411.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio aespoeensis Aspo-2]
          Length = 409

 Score =  155 bits (392), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 99/270 (36%), Positives = 153/270 (56%), Gaps = 8/270 (2%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RFE  VA RYLF+ R+ AFIS+ S  +  GV IGV ALIVV+ VMNGF  D+  ++LG+N
Sbjct: 2   RFETFVALRYLFALRRQAFISVISLFAVFGVAIGVGALIVVIGVMNGFSTDLRNKILGVN 61

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI---- 121
            H+++      + DY+ +A+    +P VI V PF+  +  +S   SG  GV++RGI    
Sbjct: 62  AHILVTSLRGGIKDYRNLADEATQVPGVIGVTPFIYSEVILS-TRSGVKGVVLRGIDPTT 120

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
           S+S  S  ++  S    N+  + D+  G+IIG +LA  LG++ G ++N+LSP G     G
Sbjct: 121 SDSVLSLSKDMISGGLANLDANVDK-PGIIIGSELANRLGLAQGSEVNLLSPSGRAGSAG 179

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEA-QLYFNLENAVSGIEVFVKDPDAIEKT 240
              + + + V G+FR    +YD+ + Y+++  A QL    E+ VSG+E+ V D   +E  
Sbjct: 180 FTPKIRPFLVAGIFRTGMFEYDSSLGYVTIPAARQLLGFKEDVVSGLEISVNDVYNVEHI 239

Query: 241 HENIVRILGN-GVVVIDWQQRYQIFFSCYE 269
            E +   +G+  V V  WQ+     F+  E
Sbjct: 240 SELLRERVGSFTVYVRHWQEMNANLFAALE 269


>gi|71908449|ref|YP_286036.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Dechloromonas aromatica RCB]
 gi|71848070|gb|AAZ47566.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Dechloromonas aromatica RCB]
          Length = 415

 Score =  155 bits (391), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 87/264 (32%), Positives = 148/264 (56%), Gaps = 2/264 (0%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+++  RY  + R+N FIS  S IS +G+ +GV ALIVV+SVMNGF++++  R+LG+  
Sbjct: 5   YELLIGLRYTRAKRRNHFISFISLISMLGIGLGVAALIVVLSVMNGFQKELRTRILGVAS 64

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+ I      L ++Q +A +    P+V    PFV  Q   + +     G +VRGI     
Sbjct: 65  HIQITGISGELPNWQAVAEQAMKHPEVRASAPFVQSQGMFT-VDGTVKGTIVRGILPDQE 123

Query: 127 SYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIR 185
             + +          +D   G+ GV++G DLAR+L +  GDK+ +++P G VTP G+  R
Sbjct: 124 DRVADFRKTIQSGSLDDLRPGEFGVVLGADLARSLRVFTGDKVTLIAPQGTVTPAGVVPR 183

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIV 245
            KS+ V+G+F +   +YD+G+  ++L++AQ  + +E+ VSG+ + V D     +    +V
Sbjct: 184 LKSFKVVGIFEVGMYEYDSGLALINLEDAQKLYQMEDRVSGVRLKVDDLFQAPRIARELV 243

Query: 246 RILGNGVVVIDWQQRYQIFFSCYE 269
           R +     + DW + +  FF   +
Sbjct: 244 RYIDADAYLNDWTKSHANFFRAVQ 267


>gi|261854851|ref|YP_003262134.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Halothiobacillus neapolitanus c2]
 gi|261835320|gb|ACX95087.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Halothiobacillus neapolitanus c2]
          Length = 415

 Score =  155 bits (391), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 84/269 (31%), Positives = 150/269 (55%), Gaps = 2/269 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F  FE ++  RY  + R+N F+S  S  S IG+ +GV ALIVV+SVMNGF++++  R+L
Sbjct: 1   MFRSFEWLIGLRYTRAKRRNRFVSFISATSIIGITLGVTALIVVISVMNGFQDELRHRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I +    L D++ +A ++   PDV+   P+V  +A +S      SG ++RGI 
Sbjct: 61  GMTAHATISENGQALQDWRSLAKKVQNEPDVMASAPYVQAEAMLSA-QPNVSGAIIRGIE 119

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
                 + +          +D   G  G+++G+ LA++LG+++GDK+ +++    VTP+G
Sbjct: 120 PKYEDAVTDIGKHMVAGSLSDLKPGGFGIVLGEALAQSLGVAVGDKLMLITANVAVTPVG 179

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
             +R + +TV+G+F++   +YD G  ++ L++AQ  F + + V+G+ + + D        
Sbjct: 180 GLLRQRQFTVVGIFKVGMYEYDRGSAFIDLKDAQALFRMGDGVTGLRLKLDDMFRAPWVA 239

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYES 270
            ++   LGN     DW Q    FF   ++
Sbjct: 240 RDLNLKLGNPYWTTDWTQANGNFFRAVQT 268


>gi|84501595|ref|ZP_00999767.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Oceanicola batsensis HTCC2597]
 gi|84390216|gb|EAQ02775.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Oceanicola batsensis HTCC2597]
          Length = 429

 Score =  154 bits (390), Expect = 8e-36,   Method: Compositional matrix adjust.
 Identities = 90/286 (31%), Positives = 142/286 (49%), Gaps = 28/286 (9%)

Query: 2   SIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRV 61
           + F+ FE ++AWRYL + R    +S+ ++IS IG+ + V ALI+ ++V  GFR + +  +
Sbjct: 6   AAFAPFEWMIAWRYLRARRAEGGVSVMTWISLIGIALAVAALIITLAVRAGFRAEFVDTI 65

Query: 62  LGINGHVVIQQKYYP---------LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSG 112
           LG N HV +     P         + DY  +A R+  +P V +  P V GQ   S  + G
Sbjct: 66  LGANAHVTVYNSGQPNEAGRLDRTIADYAGMAERIVAVPGVTRAAPLVKGQVMASA-NGG 124

Query: 113 GSGVLVRGISNSDFSYL---------QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGIS 163
            SGV V GI+ +D + +         Q   SRF          G+ + +G  +AR+L ++
Sbjct: 125 TSGVEVFGIAAADLATIPRVANPETAQGDLSRF---------GGEAIAMGSGVARSLNLT 175

Query: 164 IGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENA 223
           +GD++ ++SP G  T  G   R K+Y +  +F     D D   VYM   EAQ YFN E  
Sbjct: 176 VGDRVKLISPDGVKTAFGTSPRVKTYEIAYLFTAGRYDIDQTRVYMPFDEAQSYFNREGV 235

Query: 224 VSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              IEV V+ P+ ++     I+R  G+  +V  W+     F    +
Sbjct: 236 ADEIEVMVERPEQVDAQVFEILRAAGDRALVWTWRDSAGSFLRALD 281


>gi|329889350|ref|ZP_08267693.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Brevundimonas diminuta ATCC 11568]
 gi|328844651|gb|EGF94215.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Brevundimonas diminuta ATCC 11568]
          Length = 437

 Score =  154 bits (390), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 89/273 (32%), Positives = 142/273 (52%), Gaps = 10/273 (3%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS +E+ +A RYL + RK   +++ + ISFIG+M+ V  LI VMS+M GFR  ++ R+L 
Sbjct: 20  FSSWEIGLALRYLRAKRKQGGVALIAMISFIGIMLAVAVLISVMSIMAGFRGTLMDRILS 79

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAF--VSGLSSGGSGVLVRGI 121
            NGH+ +Q       D      R+  +P V+ V P +   A     G ++GG   +VRG+
Sbjct: 80  FNGHMYVQGPVLYAPDRDAALKRIADVPGVVAVTPLIESPAMFRAGGAATGG---VVRGV 136

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGK----GVIIGKDLARNLGISIGDKINILSPYGDV 177
              D +  +  +          F +G+     V+IGK LA  +G+  GD I++ SP G  
Sbjct: 137 RPQDLASTKFVYDSLTPEAREHFGKGQYGGDHVLIGKSLAEQMGLREGDPISLYSPTGAD 196

Query: 178 TPMG-MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
           +  G +G   K+Y V G++     DYD   ++M L++AQL+F  +     IE+ V +PD 
Sbjct: 197 SAFGNLGGLEKTYIVGGIYTSGAADYDRAFIFMPLEQAQLFFGKDGVWDVIEMKVAEPDL 256

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +E     + R  G+G VV DW+ R    +   +
Sbjct: 257 VENLLTPVQRAAGSGSVVTDWRNRQAAIWGALK 289


>gi|87199782|ref|YP_497039.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Novosphingobium aromaticivorans DSM 12444]
 gi|87135463|gb|ABD26205.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 413

 Score =  154 bits (389), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 89/256 (34%), Positives = 135/256 (52%), Gaps = 3/256 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           I S FE  +A RY+   R  AFI++ + IS + VM+GV AL++VMSVMNGFR +++ +++
Sbjct: 2   ILSPFEWTIAKRYMLPGRGEAFIALVAGISLVAVMLGVAALVIVMSVMNGFRAELLDKIV 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NGH +IQ     L ++Q I  R+   PDV    P +  Q  ++  +     +LVRG +
Sbjct: 62  GLNGHAIIQAYGGRLDNWQDILKRVQQTPDVTHASPLIE-QPLLASFNGRVEAILVRGNT 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
             D   L++   R  G + +       V +G  LA NLG  +GD I I++P G  TP G 
Sbjct: 121 AEDIKRLED--KRVDGVIGSLRPGSGNVALGSRLAENLGARVGDSITIINPQGRSTPFGT 178

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R  +YTV  +F +   DYD   V M + +AQ      + +  IEV   + D +  T  
Sbjct: 179 VPREIAYTVSAIFEVGVYDYDQAYVVMPISDAQTLLLTGDTIGMIEVTTTNADTVMDTLG 238

Query: 243 NIVRILGNGVVVIDWQ 258
            + + L    VV DW+
Sbjct: 239 PLKKELEGQAVVTDWK 254


>gi|157826123|ref|YP_001493843.1| lipoprotein releasing system, transmembrane protein [Rickettsia
           akari str. Hartford]
 gi|157800081|gb|ABV75335.1| Lipoprotein releasing system, transmembrane protein [Rickettsia
           akari str. Hartford]
          Length = 415

 Score =  154 bits (388), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 146/260 (56%), Gaps = 7/260 (2%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A+RY  + +   F+SI S  S +GVMIGV ALIVVMSVMNGF  ++ K ++G+NG +VI
Sbjct: 10  IAFRYFRAKKNEKFVSIISAFSLVGVMIGVAALIVVMSVMNGFHIELTKNIIGLNGDIVI 69

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVS-GQAFVSGLSSGGSGVLVRGISNSDFSYL 129
            ++   + +Y+ I  +L    D +K + F++ GQA   G  S  SGVLV+G+   D S  
Sbjct: 70  NRQGASIDNYEEIKTKL-LKQDYVKHVTFIAHGQALALG-KSNNSGVLVKGMKLKDLSLR 127

Query: 130 QNSFSRF-YGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSK 187
              F    +G+  N +  GK VI +G+ LA NLG+++GDKI ++SP+   T  G   RSK
Sbjct: 128 NEIFKNVNFGSFDNFY--GKNVIALGEQLASNLGVTVGDKIRLISPHSVSTAFGSMPRSK 185

Query: 188 SYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRI 247
            + V+ +F     DYD   + M L  AQ + +L N ++ IE+   DPD        I  +
Sbjct: 186 EFKVIAIFNSGMYDYDLTTILMPLTAAQNFLSLGNDINLIEINSLDPDKALTYSYKIQSL 245

Query: 248 LGNGVVVIDWQQRYQIFFSC 267
           LG  + V +WQ     F S 
Sbjct: 246 LGPNLYVFNWQTLNSQFLSA 265


>gi|146276454|ref|YP_001166613.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Rhodobacter sphaeroides ATCC 17025]
 gi|145554695|gb|ABP69308.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 428

 Score =  154 bits (388), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 91/275 (33%), Positives = 141/275 (51%), Gaps = 15/275 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++AWRYL + R    +S+ ++IS +G+ + V ALI  +SV  GFR + +  +LG
Sbjct: 8   FAAFEWMIAWRYLRARRAEGGVSVMTWISLVGITLAVFALIATLSVRAGFRAEFVDTILG 67

Query: 64  INGHVVI---------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +          Q      D+  +A RL  +P V++  P V GQ   +  S   S
Sbjct: 68  ANAHVTVYSAGQVSETGQLIRGFDDFDPVAERLRTVPGVVRAAPVVKGQVMATA-SGRSS 126

Query: 115 GVLVRGISNSDFSYLQN--SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           GV V G+  +D + +      S   G+V   FD  +G+ IG  +A+ LG+++GD+I ++S
Sbjct: 127 GVEVFGMRQADLATIPRIGHGSGHVGDVGR-FD--EGIAIGSGVAQELGVTVGDRIRLIS 183

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R  +Y V+ +F     D D   +YM L EAQ YFN E     IEV V 
Sbjct: 184 PDGVKTAFGTSPRVSAYEVVYVFTAGRYDIDRTRIYMPLAEAQSYFNREGRADEIEVMVT 243

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
           DP+A++     +++  G G ++  W+     F   
Sbjct: 244 DPEAVDAMGPALMQAAGEGSMLWTWRDSAGAFLRA 278


>gi|307292879|ref|ZP_07572725.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Sphingobium chlorophenolicum L-1]
 gi|306880945|gb|EFN12161.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Sphingobium chlorophenolicum L-1]
          Length = 416

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 91/266 (34%), Positives = 133/266 (50%), Gaps = 2/266 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           I SR+E ++A RYL   +   FI + + IS + VM+GV ALI+VMSVMNGFR ++  +++
Sbjct: 2   ILSRYERMIAKRYLLPGKGEGFIFLVAGISLVAVMLGVAALIIVMSVMNGFRAELFDKIV 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NGH V+Q     L D++ +       P V    P +  Q  +         VLVRG++
Sbjct: 62  GLNGHAVVQGYGGRLPDWKAVLKEAKATPGVTSATPLIE-QPLLGSFQGRVEAVLVRGMT 120

Query: 123 NSDFSYLQNSFSR-FYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +D        ++   G++S     G  V IG  LA NLGI +GD I I++P G  TP G
Sbjct: 121 VNDIRNNATLKAKVIAGSLSTLTANGDKVAIGSRLAENLGIQLGDSITIINPAGRSTPFG 180

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R  SY V  +F +   DYD   V M +++AQ    L + V  IEV   + D +    
Sbjct: 181 TVPRQVSYQVAAIFEVGIYDYDKAFVVMPMEDAQTLLLLGDVVGMIEVETVNADKVAAIL 240

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
           E +   +     V DW+Q     F  
Sbjct: 241 EPLAGKVAGRATVTDWRQMNASLFEA 266


>gi|126463193|ref|YP_001044307.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Rhodobacter sphaeroides ATCC 17029]
 gi|126104857|gb|ABN77535.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodobacter sphaeroides ATCC 17029]
          Length = 428

 Score =  153 bits (386), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 88/275 (32%), Positives = 142/275 (51%), Gaps = 15/275 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++AWRYL + R    +S+ ++IS +G+ + V ALI  +SV  GFR + +  +LG
Sbjct: 8   FAAFEWMIAWRYLRARRAEGGVSVMTWISLVGITLAVFALIATLSVRAGFRAEFVDTILG 67

Query: 64  INGHVVI---------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +          Q      DY  +A R+  +P V++  P V GQ   +  +   S
Sbjct: 68  ANAHVTVYSAGRVTETGQLIRGFEDYDPVAARMGAVPGVLRAAPVVKGQVMATA-NGASS 126

Query: 115 GVLVRGISNSDFSYLQNSF--SRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           GV V G+  +D + +      +   G++   FD  +G+ +G  +A+ LG+S+GD++ ++S
Sbjct: 127 GVEVFGMRQADLATIPRIGIGAEHVGDIER-FD--EGIALGSGVAQELGVSVGDRVRLIS 183

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R  +Y V+ +F     D D   VYM L EAQ YFN E     IEV V+
Sbjct: 184 PDGVKTAFGTSPRVSAYEVVYVFTAGRYDIDRTRVYMPLAEAQSYFNREGRADEIEVMVE 243

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
           DP+A++     +++  G G ++  W+     F   
Sbjct: 244 DPEAVDAMAPALMQAAGEGSMLWTWRDSAGSFLRA 278


>gi|291613869|ref|YP_003524026.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Sideroxydans lithotrophicus ES-1]
 gi|291583981|gb|ADE11639.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Sideroxydans lithotrophicus ES-1]
          Length = 414

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 88/262 (33%), Positives = 140/262 (53%), Gaps = 2/262 (0%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+ +  RY  + R+N FIS  S IS +G+ +GVMALIVV+SVMNGF++++  R+LG+  
Sbjct: 4   YELFIGLRYTRAKRRNHFISFISMISMLGIGLGVMALIVVLSVMNGFQKEIRARILGVTP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+ +      L D+Q +   +   P+V    P+V GQ  VS L+    GV+VRGI     
Sbjct: 64  HLQVMSDSGQLNDWQHVLGIVARDPEVRAAAPYVDGQGMVS-LNESVQGVMVRGILPDAE 122

Query: 127 SYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIR 185
             L     +       D   G   +++G DLAR LG  +GD + +++P G +TP GM  R
Sbjct: 123 QRLTGLGDKMKNGALGDLRAGSFNIVLGVDLARALGAHVGDTVLLITPQGQITPAGMLPR 182

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIV 245
            K + V G+F +    YDN +  ++L++AQ  + + N+VSGI   + + D   +    + 
Sbjct: 183 LKQFHVAGIFEIGMSPYDNALALINLEDAQKLYRMGNSVSGISGSLHNLDLAPQVAYKLE 242

Query: 246 RILGNGVVVIDWQQRYQIFFSC 267
             L       DW ++   +FS 
Sbjct: 243 DKLPKDTYATDWTRQNANYFSV 264


>gi|114332442|ref|YP_748664.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Nitrosomonas eutropha C91]
 gi|114309456|gb|ABI60699.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Nitrosomonas eutropha C91]
          Length = 415

 Score =  152 bits (385), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 91/272 (33%), Positives = 147/272 (54%), Gaps = 11/272 (4%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
            + +E ++  RY  + R+N FIS  S IS +G+ +G+ ALI VMSVMNGF +++  R+LG
Sbjct: 1   MASYEFLIGLRYTRAKRRNHFISFISLISLLGMTLGMTALITVMSVMNGFHKEVRARILG 60

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H  I      L D++ I   +   P ++   P++  Q  +S   +   GV+VRGI  
Sbjct: 61  VASHAQISSYEGSLYDWEKIEEIVTRNPQIVAAAPYIDAQGMLSH-DNMVHGVMVRGILP 119

Query: 124 SDFSYLQNSFSRF-----YGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
            D    +N  + F      G +      G G++IG++LARNL +  GDKI ++SP G +T
Sbjct: 120 DD----ENKVADFGDKMIMGKLDQLVPGGFGIVIGRELARNLNVFPGDKIVLISPQGQIT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDPDAI 237
           P G+  R K +TV+G+F +   +YD+G+  + L +AQ LY    N VSGI + + D    
Sbjct: 176 PAGILPRLKQFTVIGIFEVGHFEYDSGLALIHLSDAQKLYRMAPNQVSGIRLKLHDMFDA 235

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   ++  IL   +   DW Q++  +F   +
Sbjct: 236 PQVIRDLAEILPPDLYFTDWTQQHANYFRAIQ 267


>gi|221640236|ref|YP_002526498.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodobacter sphaeroides KD131]
 gi|221161017|gb|ACM01997.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodobacter sphaeroides KD131]
          Length = 428

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 88/273 (32%), Positives = 142/273 (52%), Gaps = 15/273 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++AWRYL + R    +S+ ++IS +G+ + V ALI  +SV  GFR + +  +LG
Sbjct: 8   FAAFEWMIAWRYLRARRAEGGVSVMTWISLVGITLAVFALIATLSVRAGFRAEFVDTILG 67

Query: 64  INGHVVI---------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +          Q      DY  +A R+  +P V++  P V GQ   +  +   S
Sbjct: 68  ANAHVTVYSAGRVTETGQLIRGFEDYDPVAARVAAVPGVLRAAPVVKGQVMATA-NGASS 126

Query: 115 GVLVRGISNSDFSYLQNSF--SRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           GV V G+  +D + +      +   G++   FD  +G+ +G  +A+ LG+S+GD++ ++S
Sbjct: 127 GVEVFGMRQADLATIPRIGIGAEHVGDIER-FD--EGIALGSGVAQELGVSVGDRVRLIS 183

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R  +Y V+ +F     D D   VYM L EAQ YFN E     IEV V+
Sbjct: 184 PDGVKTAFGTSPRVSAYEVVYVFTAGRYDIDRTRVYMPLAEAQSYFNREGRADEIEVMVE 243

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFF 265
           DP+A++     +++  G G ++  W+     F 
Sbjct: 244 DPEAVDAMAPALMQAAGEGSMLWTWRDSAGSFL 276


>gi|77464351|ref|YP_353855.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Rhodobacter sphaeroides 2.4.1]
 gi|77388769|gb|ABA79954.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Rhodobacter sphaeroides 2.4.1]
          Length = 428

 Score =  152 bits (384), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 88/273 (32%), Positives = 142/273 (52%), Gaps = 15/273 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++AWRYL + R    +S+ ++IS +G+ + V ALI  +SV  GFR + +  +LG
Sbjct: 8   FAAFEWMIAWRYLRARRAEGGVSVMTWISLVGITLAVFALIATLSVRAGFRAEFVDTILG 67

Query: 64  INGHVVI---------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +          Q      DY  +A R+  +P V++  P V GQ   +  +   S
Sbjct: 68  ANAHVTVYSAGRITETGQLIRGFEDYDPVAARVAAVPGVLRAAPVVKGQVMATA-NGASS 126

Query: 115 GVLVRGISNSDFSYLQNSF--SRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           GV V G+  +D + +      +   G++   FD  +G+ +G  +A+ LG+S+GD++ ++S
Sbjct: 127 GVEVFGMRQADLATIPRIGIGAEHVGDIER-FD--EGIALGSGVAQELGVSVGDRVRLIS 183

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R  +Y V+ +F     D D   VYM L EAQ YFN E     IEV V+
Sbjct: 184 PDGVKTAFGTSPRVSAYEVVYVFTAGRYDIDRTRVYMPLAEAQSYFNREGLADEIEVMVE 243

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFF 265
           DP+A++     +++  G G ++  W+     F 
Sbjct: 244 DPEAVDAMAPALMQAAGEGSMLWTWRDSAGSFL 276


>gi|197105247|ref|YP_002130624.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Phenylobacterium zucineum HLK1]
 gi|196478667|gb|ACG78195.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Phenylobacterium zucineum HLK1]
          Length = 431

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 94/278 (33%), Positives = 138/278 (49%), Gaps = 21/278 (7%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F  +E ++A RYL + R    +++ S ISFIG+++ V  LI+VMSVMNGFR +M+ R+LG
Sbjct: 15  FGYWERMLAGRYLRAKRSQGGVALISVISFIGILLAVAVLIIVMSVMNGFRSEMLTRILG 74

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
             GH+ +        D +    RL  +P V +    V  QA   G +   +G +VRGIS 
Sbjct: 75  FQGHLYVTGGVLDGPDREAAVQRLRQVPRVTQAASIVEAQAIALGPTQI-TGAIVRGISP 133

Query: 124 SDFSYL--------QNSFSRF----YGNVSNDFDRGKGVIIGKDLARNLGISIGDKINIL 171
           +D            Q S   F    YG        G+ ++IG+ LA++LG++ GD + ++
Sbjct: 134 ADLKATRLVSANVTQGSLEEFGVGEYG--------GETIVIGERLAQSLGVAPGDVLTLI 185

Query: 172 SPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFV 231
           SP G  T  G     K Y V   F +    YD   V+M  ++AQL+F  E     IEV V
Sbjct: 186 SPSGGATAFGGTPMQKDYVVGATFSVGMSQYDQAYVFMPFEQAQLFFGREGTADAIEVRV 245

Query: 232 KDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            DPD   +    I +  G   +V DW QR   F+   +
Sbjct: 246 DDPDQAARMKAAIAQAAGPAAIVTDWTQRDSSFWGALK 283


>gi|118595159|ref|ZP_01552506.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylophilales bacterium HTCC2181]
 gi|118440937|gb|EAV47564.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylophilales bacterium HTCC2181]
          Length = 423

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 93/268 (34%), Positives = 148/268 (55%), Gaps = 9/268 (3%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+ +A RY     KN FIS  S  S IG+ +GVMALIVV+SVMNGF+ ++  R+L +  
Sbjct: 12  YELWIASRYTRLRNKNNFISFISLTSIIGIALGVMALIVVLSVMNGFQSELRARILNVAS 71

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
            V +      L D+Q    ++  + ++    PF S QA VS +     GVLVRG+   + 
Sbjct: 72  DVEVISAASNLGDWQETERKISSLNNIESTAPFTSSQALVS-IGKYNRGVLVRGVDPENE 130

Query: 127 SYLQNSFSRFYGNVSNDFDRGKG---VIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           S + N   +     + DF    G   ++IG DLAR   + +GDKI+++S   + +P+GM 
Sbjct: 131 STVSNLEQQL---TAGDFKVTPGKFEILIGIDLARYFSLDLGDKISMISSQANFSPVGML 187

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K +TV G+F     +YD G+V + +++AQ +F + + +SGI V +KD D   ++   
Sbjct: 188 PRIKQFTVAGIFDAGMYEYDAGLVLIHMKDAQKFFQMGSEISGIRVKLKDLDKTSESSAA 247

Query: 244 IVRIL--GNGVVVIDWQQRYQIFFSCYE 269
           I   +  GN   V+DW +++   FS  +
Sbjct: 248 INNAINAGNKFYVLDWTKKHTNLFSAIQ 275


>gi|157828923|ref|YP_001495165.1| hypothetical protein A1G_05965 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165933648|ref|YP_001650437.1| lipoprotein releasing system transmembrane protein [Rickettsia
           rickettsii str. Iowa]
 gi|157801404|gb|ABV76657.1| hypothetical protein A1G_05965 [Rickettsia rickettsii str. 'Sheila
           Smith']
 gi|165908735|gb|ABY73031.1| lipoprotein releasing system transmembrane protein [Rickettsia
           rickettsii str. Iowa]
          Length = 451

 Score =  152 bits (384), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 99/259 (38%), Positives = 143/259 (55%), Gaps = 5/259 (1%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A+RY  + +   F+SI S  S +GVMIGV ALIVVMSVMNGF  ++ K ++G+NG +VI
Sbjct: 46  IAFRYFRAKKNEKFVSIISAFSLVGVMIGVAALIVVMSVMNGFHIELTKNIIGLNGDIVI 105

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVS-GQAFVSGLSSGGSGVLVRGISNSDFSYL 129
            ++   + +Y+ I  +L    D IK + F++ GQA   G  S  SGVLV+G+   D S  
Sbjct: 106 NRQGGSIDNYEEIKAKL-LKQDYIKHVTFIAHGQALALG-KSNNSGVLVKGMKLKDLSVR 163

Query: 130 QNSFSRFYGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKS 188
              F        ++F  GK VI +G+ LA NLG+++GDKI ++SP    T  G   RSK 
Sbjct: 164 NEIFKNVNFGSFDNF-HGKNVIALGEQLASNLGVTVGDKIRLISPNSVSTTFGSMPRSKE 222

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL 248
           + V+ +F     DYD   + M L  AQ + +L N ++ IE+   DPD        I  +L
Sbjct: 223 FKVIAIFNSGMYDYDLTTILMPLTAAQNFLSLGNDINLIEINSLDPDKALTYSHKIQSLL 282

Query: 249 GNGVVVIDWQQRYQIFFSC 267
           G  + V +WQ     F S 
Sbjct: 283 GPTLYVFNWQTLNSQFLSA 301


>gi|242279992|ref|YP_002992121.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio salexigens DSM 2638]
 gi|242122886|gb|ACS80582.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio salexigens DSM 2638]
          Length = 409

 Score =  152 bits (383), Expect = 6e-35,   Method: Compositional matrix adjust.
 Identities = 97/270 (35%), Positives = 153/270 (56%), Gaps = 8/270 (2%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           +FE+ VA RYLF+ RKN FIS+ S  +  GV +GV ALIVV+ VMNGF  D+  ++LG+N
Sbjct: 2   KFELFVALRYLFTLRKNNFISVISLFAVCGVALGVAALIVVIGVMNGFSTDLRDKILGVN 61

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG-SGVLVRGI-SN 123
            HV++      L +Y  + +R++ IP V  V PF+  +  +S  SSGG  GV++RG+ + 
Sbjct: 62  AHVIVTAYDGTLENYHHMTDRIEKIPGVTGVTPFIYSEVMLS--SSGGVKGVVLRGVDAE 119

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK--GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
           +    L        G+V +    GK   ++IG  LAR LG+ +GD +N+LSP G  T  G
Sbjct: 120 TAKGVLSLPGDMLSGSVDSLSKDGKLPEIVIGNQLARRLGLVLGDTVNLLSPSGTRTAAG 179

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEKT 240
              + + + V G+FR    +YD+ + Y+S   AQ     + + VSG+E+ + D  A++  
Sbjct: 180 FTPKVRVFKVGGIFRTGMYEYDSSLAYISNTSAQKLLGFKRDFVSGLEIRLADVYAVDNI 239

Query: 241 HENIVRIL-GNGVVVIDWQQRYQIFFSCYE 269
            + + R L G  V + +WQ+     F+  +
Sbjct: 240 GKLLDRELAGYPVQIRNWQEMNSNLFAALK 269


>gi|67458603|ref|YP_246227.1| lipoprotein releasing system, transmembrane protein [Rickettsia
           felis URRWXCal2]
 gi|67004136|gb|AAY61062.1| Lipoprotein releasing system, transmembrane protein [Rickettsia
           felis URRWXCal2]
          Length = 415

 Score =  151 bits (382), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 98/259 (37%), Positives = 144/259 (55%), Gaps = 5/259 (1%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A+RY  + +   F+SI S  S +GVMIGV ALIVVMSVMNGF  ++ K ++G+NG +VI
Sbjct: 10  IAFRYFRAKKNEKFVSIISAFSLVGVMIGVAALIVVMSVMNGFHIELTKNIIGLNGDIVI 69

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVS-GQAFVSGLSSGGSGVLVRGISNSDFSYL 129
            ++   + +Y+ I  +L    D +K + F++ GQA   G  S  SGVLV+G+   D S  
Sbjct: 70  NRQGGSIDNYEEIKAKL-LKQDYVKHVTFIAHGQALALG-KSNNSGVLVKGMKLKDLSLR 127

Query: 130 QNSFSRFYGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKS 188
              F        +DF  GK VI +G+ LA NLG++IGDKI ++SP    T +G   RSK 
Sbjct: 128 NEIFKNVNFGSFDDF-HGKNVIALGEQLASNLGVTIGDKIRLISPNSVSTALGSMPRSKE 186

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL 248
           + ++ +F     DYD   + M L  AQ + +L + ++ IE+   DPD        I  +L
Sbjct: 187 FKIIAIFNSGMYDYDLTTILMPLTAAQNFLSLGDDINLIEINSLDPDKALAYSYKIQSLL 246

Query: 249 GNGVVVIDWQQRYQIFFSC 267
           G  + V +WQ     F S 
Sbjct: 247 GPNLYVFNWQTLNSQFLSA 265


>gi|297537850|ref|YP_003673619.1| LolC/E family lipoprotein releasing system transmembrane protein
           [Methylotenera sp. 301]
 gi|297257197|gb|ADI29042.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylotenera sp. 301]
          Length = 431

 Score =  151 bits (382), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 143/273 (52%), Gaps = 8/273 (2%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE+ V  RY  + RKN FIS  S  S IG+ +GV ALI+V+SVMNGF++D+  R+LG
Sbjct: 12  FSVFELFVGMRYTRAKRKNHFISFISLTSMIGIALGVAALIIVLSVMNGFQKDLRTRILG 71

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ I      L D+  IA        V+   P+++ QA +S    G  G ++RG+  
Sbjct: 72  VASHLEITGSNNTLSDWPNIAESSVKREHVLASAPYITAQAMLS-YGQGVQGAIIRGVIP 130

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +    + +          ND   G+ G+I+G DLA NLG  +GDK+ +++P G  TP G+
Sbjct: 131 AAEDKVADLGKSMRVGSLNDLRAGEFGIILGTDLAYNLGAQMGDKVVVMAPQGQFTPAGV 190

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD G+  + + +A   + ++N VSG+ + + D         
Sbjct: 191 VPRLKQFTVIGLFSSGMQEYDAGLALIHMDDAAKLYRMDNKVSGVRLKLDDLFIAPNVAA 250

Query: 243 NIVRILGN------GVVVIDWQQRYQIFFSCYE 269
           +I + L           V DW Q++  FF   +
Sbjct: 251 SISKDLNQPSNPTGAYYVTDWTQQHSNFFKAVQ 283


>gi|158522856|ref|YP_001530726.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Desulfococcus oleovorans Hxd3]
 gi|158511682|gb|ABW68649.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfococcus oleovorans Hxd3]
          Length = 408

 Score =  151 bits (382), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 145/267 (54%), Gaps = 5/267 (1%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+ +  R+L + ++N F+S+ + +S +GV+IGVMALI+V++VM+GF  D+  R+LGI  
Sbjct: 3   YELFIGRRHLMTAKRNVFVSLITLLSVVGVIIGVMALIIVIAVMSGFEADIKARILGIES 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           HVV+ +    L DY+ +   +   P+V   LPF+  Q      S G SG L++G+     
Sbjct: 63  HVVLSRHGGELHDYERVVQEVSRHPEVETQLPFIMTQVMFRS-SYGVSGGLLKGVEPDKA 121

Query: 127 SYLQNSFSRFYGNVSN----DFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +++   F               D+  G+++GK+LA+ LG++ GD + ++   G ++P+G 
Sbjct: 122 AHVMTIFKNMEPLAEKLRQRTKDQAPGIVLGKELAQRLGVTEGDTVYLVLSMGALSPVGH 181

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
               K + V G+F     +YD+   Y+ L EAQ   +++N+V GIE+ VKD    +   E
Sbjct: 182 MPAVKRFAVTGIFEAGMHEYDSAFSYIHLAEAQHILHMDNSVGGIEIRVKDIYRADTVGE 241

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +V  LG      DW    +  FS  +
Sbjct: 242 QLVARLGYPYYARDWMSMNRNLFSALK 268


>gi|157804089|ref|YP_001492638.1| hypothetical protein A1E_04640 [Rickettsia canadensis str. McKiel]
 gi|157785352|gb|ABV73853.1| hypothetical protein A1E_04640 [Rickettsia canadensis str. McKiel]
          Length = 415

 Score =  151 bits (382), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 95/258 (36%), Positives = 141/258 (54%), Gaps = 3/258 (1%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A+RY  S +   F+SI S  S +GVMIGV ALIVVMSVMNGF  ++ K ++G+NG +VI
Sbjct: 10  IAFRYFRSKKNEKFVSIISAFSLVGVMIGVAALIVVMSVMNGFHIELTKNIIGLNGDIVI 69

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVS-GQAFVSGLSSGGSGVLVRGISNSDFSYL 129
             +   + +Y+ I  +L    D IK + F++ GQA   G  S  SGVLV+GI+  D S  
Sbjct: 70  NPQAGSIDNYEEIKAKL-LKQDYIKHVTFIAHGQALALG-KSNNSGVLVKGINLKDLSLR 127

Query: 130 QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSY 189
              F        ++F     + +G +LA NLG+++GDKI ++SP    T  G   RSK +
Sbjct: 128 NEIFKNVNFGSFDNFHSKNVIALGGELASNLGVTVGDKIRLISPSVVSTAFGSMPRSKEF 187

Query: 190 TVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILG 249
            ++ +F     DYD+  + M L  AQ + +L N ++ IE+   DPD        +  +LG
Sbjct: 188 KIIAIFNSGMYDYDSATILMPLTAAQNFLSLGNDINLIEINSLDPDKALSYSYKLQILLG 247

Query: 250 NGVVVIDWQQRYQIFFSC 267
             + V  WQ+    F S 
Sbjct: 248 TMLRVTSWQKLNAPFLSA 265


>gi|302878887|ref|YP_003847451.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Gallionella capsiferriformans ES-2]
 gi|302581676|gb|ADL55687.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Gallionella capsiferriformans ES-2]
          Length = 414

 Score =  151 bits (382), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 86/272 (31%), Positives = 147/272 (54%), Gaps = 18/272 (6%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+ +  RY  + R+N FIS  S IS +G+ +GVMALIVV+SVMNGF++++  R+LG + 
Sbjct: 4   YELFIGLRYTRAKRRNHFISFISLISMLGMGLGVMALIVVLSVMNGFQKEIRARMLGASP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+ +      + ++Q +   +   P V    P+V+GQ  +S       GV+VRGI     
Sbjct: 64  HLEVVADGGRMENWQPLLGTVLHHPQVSAAAPYVAGQGMLS-FGQSVQGVMVRGIDPERE 122

Query: 127 SYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPYGDV 177
           + + +        +SN+   GK         G+++G DLAR LG+ +G+K+ +++P G +
Sbjct: 123 TAITD--------LSNNIKAGKLTDLRSTEFGIVLGSDLARALGVRMGEKVMLIAPQGSI 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           TP GM  R K + V+G+F +    YDN +  +++ +AQ  F L +AV+GI   +++ D  
Sbjct: 175 TPAGMMPRVKQFRVVGIFEIGMAPYDNSLALVNINDAQKLFQLGDAVTGISTKLREIDKA 234

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
                 +   L  G+   DW  +   +F   +
Sbjct: 235 PDVASELQNQLPQGLYANDWTHQNSNYFKAVQ 266


>gi|30249056|ref|NP_841126.1| hypothetical protein NE1057 [Nitrosomonas europaea ATCC 19718]
 gi|30138673|emb|CAD84968.1| DUF214 [Nitrosomonas europaea ATCC 19718]
          Length = 415

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 94/272 (34%), Positives = 149/272 (54%), Gaps = 11/272 (4%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
            + +E ++  RY  + R+N FIS  S IS +G+ +G+ ALI VMSVMNGF +++  R+LG
Sbjct: 1   MASYEFLIGLRYTRAKRRNHFISFISLISLLGMTLGMTALITVMSVMNGFHKEVRARILG 60

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H  I      L D++ I       P +    P++  Q  +S   +   GV+VRGI  
Sbjct: 61  VASHAQISSYQGSLYDWEQIREAAIQNPQIAAAAPYIDAQGMLSH-DNMVRGVMVRGILP 119

Query: 124 SDFSYLQNSFSRFYGN-VSNDFDR---GK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
           +D    +N  + F G  V    DR   G+ G+IIG++LARNL    G+KI ++SP G +T
Sbjct: 120 AD----ENRVADFAGKMVEGSLDRLAPGEFGIIIGQELARNLNAFPGNKIVLISPQGQIT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDPDAI 237
           P G+  R K +TV G+F +   +YD+G+  + L +AQ LY    N VSGI + + D    
Sbjct: 176 PAGILPRLKQFTVTGIFDVGHFEYDSGLALIHLADAQKLYRMAPNQVSGIRLKLHDMFKA 235

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +  +++ R+L   +   DW Q++  +F   +
Sbjct: 236 PQVIQDLARVLPADLYFTDWTQQHANYFRAIQ 267


>gi|167563342|ref|ZP_02356258.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia oklahomensis EO147]
 gi|167570514|ref|ZP_02363388.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia oklahomensis C6786]
          Length = 417

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 142/267 (53%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV +      + D+Q  A      P VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEVFSPTGSMPDWQLTAKEARLNPSVIGAAPYVDAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    + +               G+ G+++G  LA NLG+ +GDK+ +++P G +TP GM
Sbjct: 124 SLEPQVSDIGKDMKAGALTALAPGQFGIVLGNALAGNLGVGVGDKVTLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  + +Q+AQ  F L  A +G+ + + D     +   
Sbjct: 184 MPRLKQFTVVGLFESGHYEYDSSLAMIDIQDAQALFRLP-APTGVRLRLTDMQKAPQVAR 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   L   + + DW Q+ + +FS  +
Sbjct: 243 ELAHTLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|94498255|ref|ZP_01304815.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Sphingomonas sp. SKA58]
 gi|94422257|gb|EAT07298.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Sphingomonas sp. SKA58]
          Length = 408

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 87/259 (33%), Positives = 132/259 (50%), Gaps = 2/259 (0%)

Query: 10  IVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVV 69
           ++A RYL   +   FI + + IS + VM+GV ALI+VMSVMNGFR ++  +++G+NGH V
Sbjct: 1   MIAKRYLLPGKGEGFIFLVAGISLVAVMLGVAALIIVMSVMNGFRAELFDKIVGLNGHAV 60

Query: 70  IQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYL 129
           +Q     L D+Q I  +    P V    P +  Q  ++  +     VLVRG++  D    
Sbjct: 61  VQGYGGRLPDWQSILKQAKATPGVTSATPMIE-QPLLATFNGRVEAVLVRGMTVPDIRAN 119

Query: 130 QNSFSRFYGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKS 188
           +    +      +    G G + IG  LA NLG+ +GD + I++P G  TP G   R  S
Sbjct: 120 KTLKGKVLAGSLDSLTPGAGKVGIGSRLAENLGVQLGDSLTIINPAGRSTPFGTVPRQIS 179

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL 248
           Y V  +F +   DYD  MV M +++AQ    L + V  IEV   +PD + +  E +   +
Sbjct: 180 YQVSAIFEVGIYDYDKAMVVMPVEDAQTLLLLGDVVGMIEVETVNPDRVGQILEPLAAKV 239

Query: 249 GNGVVVIDWQQRYQIFFSC 267
               V+ DW+Q     F  
Sbjct: 240 AGRAVITDWRQMNASLFEA 258


>gi|254475141|ref|ZP_05088527.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ruegeria sp. R11]
 gi|214029384|gb|EEB70219.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ruegeria sp. R11]
          Length = 430

 Score =  151 bits (381), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 96/279 (34%), Positives = 135/279 (48%), Gaps = 16/279 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSRFE ++AWRYL + R    +S  ++IS IG+ + V ALI  ++V  GFR + +  +LG
Sbjct: 7   FSRFEWLIAWRYLRARRAEGGVSTMTWISLIGIALAVFALIATLAVRTGFRSEFVGTILG 66

Query: 64  INGHVVIQQKYY---------PLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +               L DY  +A R   +P VI+  P + GQ   S L    S
Sbjct: 67  ANAHVTLYSHGTVTDQGRIDRKLTDYDALAARAAEVPGVIRTAPLIKGQVMAS-LQQRNS 125

Query: 115 GVLVRGISNSDFSYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINILSP 173
           GV V GIS  +   +             D DR  +GV IG  +AR LG+ IGD+I ++SP
Sbjct: 126 GVEVFGISAENIRTIPGVAES--EQAIGDLDRFEEGVAIGSGVARELGVQIGDRIKLISP 183

Query: 174 YGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
            G  T  G   R  +Y V+ +F     D D   +YM   EAQ YFN E     +EV V+D
Sbjct: 184 NGVKTAFGTSPRVNAYEVVYIFTAGRYDIDRTRLYMPFAEAQSYFNREGFADEVEVIVED 243

Query: 234 PDAIEKTHENIVRILG---NGVVVIDWQQRYQIFFSCYE 269
           P+ +E+    ++   G   N + V  W+     F    E
Sbjct: 244 PENVERLVLPLLSATGEISNAIGVWTWRDASGGFLRALE 282


>gi|162148794|ref|YP_001603255.1| putative lipoprotein-releasing system transmembrane protein
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209545457|ref|YP_002277686.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|161787371|emb|CAP56966.1| putative lipoprotein-releasing system transmembrane protein
           [Gluconacetobacter diazotrophicus PAl 5]
 gi|209533134|gb|ACI53071.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Gluconacetobacter diazotrophicus PAl 5]
          Length = 415

 Score =  150 bits (380), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 81/266 (30%), Positives = 141/266 (53%), Gaps = 2/266 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F  FE  VA RYL + +   F+S+ +  S +G+ +GV  LI+VMSVMNGF+ D++ R+L
Sbjct: 1   MFGPFERAVAGRYLRARKGERFVSVIAIFSLVGIALGVATLIIVMSVMNGFKADLMGRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NG + +      + +Y  +A  +  +P V+   P + GQ  ++   S  +G +VRG++
Sbjct: 61  GLNGDLSLFGVTRTIQNYDDLAATVRQVPGVVTATPLIEGQVLLNS-GSYNAGGMVRGMT 119

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
            +    L            +DF     +I+G  LA   G+S+G K+ ++SP G  TP G 
Sbjct: 120 RAGLHDLHEISDSLIAGSLDDFAGNDAIIVGVTLAERAGLSVGSKLTLISPNGAATPFGT 179

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R ++Y V+ +F     DY++  V++ L  AQ+YF +   V+ ++V  +D   ++    
Sbjct: 180 MPRIRAYRVVAIFDAGMHDYNSSYVFLPLPAAQIYFEMPAQVTQVQVTTRDATNVQPVRM 239

Query: 243 NIVRILGNG-VVVIDWQQRYQIFFSC 267
            I + + +  + V+DW Q    FF  
Sbjct: 240 AIEQAVADPRIRVLDWTQSNNAFFGA 265


>gi|85704334|ref|ZP_01035437.1| lipoprotein releasing system transmembrane protein LolE
           [Roseovarius sp. 217]
 gi|85671654|gb|EAQ26512.1| lipoprotein releasing system transmembrane protein LolE
           [Roseovarius sp. 217]
          Length = 428

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 87/284 (30%), Positives = 141/284 (49%), Gaps = 29/284 (10%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++AWRYL + R    +S+ ++IS IG+ + V ALI  ++V +GFR + +  +LG
Sbjct: 8   FAAFEWMIAWRYLRAKRAEGGVSVMTWISLIGITLAVFALIATLAVRSGFRAEFVDTILG 67

Query: 64  INGHVVIQQK---------YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +               L DY  +A+R+  +P V +V P V GQ   +  S   +
Sbjct: 68  ANAHVTVYNSGSVDASGRVDRSLEDYAAMADRVRAVPGVTRVAPLVKGQVMANA-SDRNA 126

Query: 115 GVLVRGISNSDFSYL---------QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIG 165
           GV V GI+  D   +         Q   +RF           +G+ IG  +A+ LGI++G
Sbjct: 127 GVQVYGITPEDLQTIPRVADPETSQGDIARF----------SQGIAIGSGVAQELGITLG 176

Query: 166 DKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVS 225
           D+I ++SP G  TP+G   R  +Y V+ +F     D D    Y+  +EAQ +FN +    
Sbjct: 177 DRIKLISPNGVKTPLGTSPRVNAYEVVYIFSAGRYDIDRVRAYLPFEEAQSFFNRDGRAD 236

Query: 226 GIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +EV V+DP+ ++     +++  G   ++  WQ     F    E
Sbjct: 237 ELEVMVEDPETVDSLTLPLLQAAGERAMLWTWQDASGSFLRALE 280


>gi|226940747|ref|YP_002795821.1| LolC [Laribacter hongkongensis HLHK9]
 gi|226715674|gb|ACO74812.1| LolC [Laribacter hongkongensis HLHK9]
          Length = 412

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 152/266 (57%), Gaps = 6/266 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE ++A RY+ + R+N+FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+LG+  
Sbjct: 3   FESMIAMRYVRARRQNSFISFISLVSIVGIALGVAALIIVLSVMNGFQKEIRTRMLGVAS 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H+ +      L D+  +   +   P V    PF++ Q     LS+ G+  G LVRG+   
Sbjct: 63  HLEVSSVTGQLNDWPAVQKLVAADPRVEASAPFIAAQGL---LSAQGAVRGALVRGVVPK 119

Query: 125 DFSYLQNSFSRFY-GNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
               + N  S    G +++    G G+++G +LAR LG+ +GDK+N+++P G  TP GM 
Sbjct: 120 LEDQVVNVGSHMVVGKLTDLQPGGFGIVLGVELARALGVGMGDKVNLITPEGQFTPAGML 179

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K++TV+G+F++   +YD  +  + L +AQ  F + ++VSG+ + + D         +
Sbjct: 180 PRLKTFTVVGVFKVDMYEYDATLAMIDLADAQRLFRMGDSVSGLRLKLDDVLQAPVVKRD 239

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +   +   +V+ DW  ++  +F   +
Sbjct: 240 LYPRITQNLVLTDWTDQHSNYFRAVQ 265


>gi|315499826|ref|YP_004088629.1| lipoprotein releasing system, transmembrane protein, lolc/e family
           [Asticcacaulis excentricus CB 48]
 gi|315417838|gb|ADU14478.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Asticcacaulis excentricus CB 48]
          Length = 427

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 149/277 (53%), Gaps = 18/277 (6%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS +E  +A RYL + RK+  I++ + ISFIG+ + V  LI+VMSVMNGFR++++ RVL 
Sbjct: 10  FSAWETDLALRYLRTKRKDGGIALIAIISFIGITLAVGVLIIVMSVMNGFRDELMSRVLA 69

Query: 64  INGHVVIQQKYYPLVDY---QFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
            NGH  +  +  PL D+     +  RL  IP VI+  P+V       G  S      +RG
Sbjct: 70  FNGHQFVAGE--PLSDWNGRDAMLKRLRAIPGVIEASPYVESPGLAQGPFSQAGLAFMRG 127

Query: 121 ISNSDFSYLQNS--------FSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           +   D + L+N+             G  + +F  G  ++IG+ LA  + + +GD++ +LS
Sbjct: 128 V---DVAALKNTPIIRDNIKSGSLDGFGAGEFG-GDVILIGEGLASQMSVRVGDELTLLS 183

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R K Y V G+F+    + D   V+M LQ+AQL+F+ E+    +E+ VK
Sbjct: 184 PSGS-TAFGAMPRRKPYVVGGIFKSGVSELDAAFVFMPLQQAQLFFDREDEWDAVEIKVK 242

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           DP  I+  +    +  G+  V++DW +R    ++  +
Sbjct: 243 DPYNIKDYYPAFRKASGDKAVLLDWTERNAPLWNALQ 279


>gi|259415802|ref|ZP_05739722.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Silicibacter sp. TrichCH4B]
 gi|259347241|gb|EEW59018.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Silicibacter sp. TrichCH4B]
          Length = 427

 Score =  150 bits (379), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 92/277 (33%), Positives = 139/277 (50%), Gaps = 15/277 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSRFE ++AWRYL + R    +S+ ++IS IG+ + V ALI  ++V +GFR + +  +LG
Sbjct: 7   FSRFEWMIAWRYLRARRSEGGVSVMTWISLIGITLAVFALIATLAVRSGFRSEFVGTILG 66

Query: 64  INGHVVIQQKY---------YPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N H  +               + DY  +A+ +  +P V++  P + GQ   S      +
Sbjct: 67  ANAHATVYAHGEVTEAGTLDRRITDYAALADAVGQVPGVLQAAPLIKGQVMAS-RGDRNA 125

Query: 115 GVLVRGISNSDFSYLQNSFSR--FYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           GV V GI   D + +         YG++   FD  +G+ IG  +AR LG+SIGDK+ ++S
Sbjct: 126 GVQVYGIHAEDLAEIPGVAQSDVAYGDLGR-FD--EGIAIGSGVARALGLSIGDKVKLIS 182

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R  +Y V+ +F     D DN   Y+   EAQ YFN E A   IEV V 
Sbjct: 183 PNGVKTAFGTSPRVNAYEVVYVFTAGRYDIDNTRAYLPFAEAQSYFNREGAADEIEVMVD 242

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           DP+ +++    +V+  G    V  W+     F    E
Sbjct: 243 DPERVDQYILPLVQAAGQSYGVWSWRDSSGGFLRALE 279


>gi|294677978|ref|YP_003578593.1| lipoprotein-releasing system transmembrane protein LolE
           [Rhodobacter capsulatus SB 1003]
 gi|294476798|gb|ADE86186.1| lipoprotein-releasing system transmembrane protein LolE
           [Rhodobacter capsulatus SB 1003]
          Length = 430

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 86/276 (31%), Positives = 140/276 (50%), Gaps = 15/276 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE ++AWRYL + R    +S+ ++IS IG+M+GV ALI+ ++V  GFR + +  +LG
Sbjct: 8   FSGFEFLIAWRYLRARRAEGGVSVMTWISLIGIMLGVAALIITLAVRAGFRAEFVDTILG 67

Query: 64  INGHVVI---QQKYYP--------LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSG 112
            N HV +     +  P        + DY   A R+  +P V +  P + GQ   + ++  
Sbjct: 68  SNAHVTVYSAPMEVAPETGIFSSLMPDYAARAARIAQVPGVTRAAPLIRGQVMAT-MNDR 126

Query: 113 GSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINIL 171
            +   V GIS  +   +          +  + +  G+G+ +G +LAR LG++ GD + ++
Sbjct: 127 SNVAEVYGISYENLMTIPRV--AHSAQIDGEIESFGQGIAMGSELARELGVAAGDTVKLI 184

Query: 172 SPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFV 231
           SP G  TP G+  R  +YTV+ +F     D D   +YM   EAQ +FN E     IEV V
Sbjct: 185 SPNGVKTPFGVSPRVNAYTVVYVFTAGRWDIDRTRIYMPFAEAQSFFNREGGADEIEVMV 244

Query: 232 KDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
           KDP+ ++     ++   G G ++  W+     F   
Sbjct: 245 KDPEHVDDLTPQLIAAGGAGTMLWSWRDASGSFLRA 280


>gi|34581307|ref|ZP_00142787.1| hypothetical protein [Rickettsia sibirica 246]
 gi|28262692|gb|EAA26196.1| unknown [Rickettsia sibirica 246]
          Length = 424

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 144/260 (55%), Gaps = 6/260 (2%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A+RY  + +   F+SI S  S +GVMIGV ALIVVMSVMNGF  ++ K ++G+NG +VI
Sbjct: 18  IAFRYFRAKKNEKFVSIISAFSLVGVMIGVAALIVVMSVMNGFHIELTKNIIGLNGDIVI 77

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVS-GQAFVSGLSSGGSGVLVRGISNSDFSYL 129
            ++   + +Y+ I  +L    D +K + F++ GQA   G  S  SGVLV+G+   D S  
Sbjct: 78  NRQGGSIDNYEEIKAKL-LKQDYVKHVTFIAHGQALALG-KSNNSGVLVKGMKLKDLSVR 135

Query: 130 QNSFSRFYGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDV-TPMGMGIRSK 187
              F        ++F  GK VI +G+ LA NLG+++GDKI ++SP   V T  G   RSK
Sbjct: 136 NEIFKNVNFGSFDNF-HGKNVIALGEQLASNLGVTVGDKIRLISPNNSVSTTFGSMPRSK 194

Query: 188 SYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRI 247
            + V+ +F     DYD   + M L  AQ + +L N ++ IE+   DPD        I  +
Sbjct: 195 EFKVIAIFNSGMYDYDLTTILMPLTAAQNFLSLGNDINLIEINSLDPDKALTYSHKIQSL 254

Query: 248 LGNGVVVIDWQQRYQIFFSC 267
           LG  + V +WQ     F S 
Sbjct: 255 LGPTLYVFNWQTLNSQFLSA 274


>gi|239946768|ref|ZP_04698521.1| lipoprotein releasing system transmembrane protein [Rickettsia
           endosymbiont of Ixodes scapularis]
 gi|239921044|gb|EER21068.1| lipoprotein releasing system transmembrane protein [Rickettsia
           endosymbiont of Ixodes scapularis]
          Length = 451

 Score =  150 bits (378), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 99/259 (38%), Positives = 145/259 (55%), Gaps = 5/259 (1%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A+RY  + +   F+SI S  S +GVMIGV ALIVVMSVMNGF  ++ K ++G+NG +VI
Sbjct: 46  IAFRYFRAKKNEKFVSIISAFSLVGVMIGVAALIVVMSVMNGFHIELTKNIIGLNGDIVI 105

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVS-GQAFVSGLSSGGSGVLVRGISNSDFSYL 129
            ++   + +Y+ I  +L    D +K + F++ GQA   G  +  SGVLV+G+   D S L
Sbjct: 106 NRQGGSIDNYEEIKAKL-LKQDYVKHVTFIAHGQALALG-KNNNSGVLVKGMKLKDLS-L 162

Query: 130 QNSFSRFYGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKS 188
           +N   +     S D   GK VI +G+ LA NLG+++GDKI ++SP    T  G   RSK 
Sbjct: 163 RNEIFKNVNFGSFDNFHGKNVIALGEQLASNLGVTVGDKIRLISPNSVSTAFGSMPRSKE 222

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL 248
           + V+ +F     DYD   + M L  AQ + +L N ++ IE+   DPD        I  +L
Sbjct: 223 FKVIAIFNSGMYDYDLTTILMPLTAAQNFLSLGNDINLIEINSLDPDKALAYSYKIQSLL 282

Query: 249 GNGVVVIDWQQRYQIFFSC 267
           G  + V +WQ     F S 
Sbjct: 283 GPNLYVFNWQTLNSQFLSA 301


>gi|229587058|ref|YP_002845559.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Rickettsia africae ESF-5]
 gi|228022108|gb|ACP53816.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Rickettsia africae ESF-5]
          Length = 416

 Score =  150 bits (378), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 144/260 (55%), Gaps = 6/260 (2%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A+RY  + +   F+SI S  S +GVMIGV ALIVVMSVMNGF  ++ K ++G+NG +VI
Sbjct: 10  IAFRYFRAKKNEKFVSIISAFSLVGVMIGVAALIVVMSVMNGFHIELTKNIIGLNGDIVI 69

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVS-GQAFVSGLSSGGSGVLVRGISNSDFSYL 129
            ++   + +Y+ I  +L    D +K + F++ GQA   G  S  SGVLV+G+   D S  
Sbjct: 70  NRQGGSIDNYEEIKAKL-LKQDYVKHVTFIAHGQALALG-KSNNSGVLVKGMKLKDLSIR 127

Query: 130 QNSFSRFYGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDV-TPMGMGIRSK 187
              F        ++F  GK VI +G+ LA NLG+++GDKI ++SP   V T  G   RSK
Sbjct: 128 NEIFKNVNFGSFDNF-HGKNVIALGEQLASNLGVTVGDKIRLISPNNSVSTTFGSMPRSK 186

Query: 188 SYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRI 247
            + V+ +F     DYD   + M L  AQ + +L N ++ IE+   DPD        I  +
Sbjct: 187 EFKVIAIFNSGMYDYDLTTILMPLTAAQNFLSLGNDINLIEINSLDPDKALTYSHKIQSL 246

Query: 248 LGNGVVVIDWQQRYQIFFSC 267
           LG  + V +WQ     F S 
Sbjct: 247 LGPTLYVFNWQTLNSQFLSA 266


>gi|302383073|ref|YP_003818896.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brevundimonas subvibrioides ATCC 15264]
 gi|302193701|gb|ADL01273.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 433

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 141/273 (51%), Gaps = 10/273 (3%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS +E+ +A RYL + RK   ++  + ISF+G+M+ V  LI VMS+M GFR +++ R+L 
Sbjct: 16  FSAWEIGLALRYLRAKRKEGGVATIAIISFVGIMLAVAVLISVMSIMAGFRTELLGRMLS 75

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFV--SGLSSGGSGVLVRGI 121
            NGH+ +Q +     +   I +RL  +  V+ V P    QA +   G ++GG   +VRG+
Sbjct: 76  FNGHMYVQGEVLNAPNRDAIVDRLRGVEGVVSVSPLTESQALIIAGGQTTGG---VVRGL 132

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGK----GVIIGKDLARNLGISIGDKINILSPYGDV 177
              D   +Q   S         F +G      V+IG+ LA  LG+ +GD I I SP G  
Sbjct: 133 RPEDLDTMQYVSSSLSAQAKASFGQGAYGGDNVLIGQALADQLGLRVGDPIQIYSPTGAD 192

Query: 178 TPMG-MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
           +  G +G  SK+Y V G +     DYD   ++M L++AQL+F  E     IE+ V +PD 
Sbjct: 193 SAFGNLGGLSKTYRVGGTYSSGTADYDRIFIFMPLEQAQLFFGKEGVWDVIEMKVANPDR 252

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           + +    +    G    V DW+ R   F+   +
Sbjct: 253 VGEYIAPVRAAAGPAAFVQDWRDRLAAFWGALK 285


>gi|15892999|ref|NP_360713.1| hypothetical protein RC1076 [Rickettsia conorii str. Malish 7]
 gi|15620197|gb|AAL03614.1| unknown [Rickettsia conorii str. Malish 7]
          Length = 452

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 99/260 (38%), Positives = 144/260 (55%), Gaps = 6/260 (2%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A+RY  + +   F+SI S  S +GVMIGV ALIVVMSVMNGF  ++ K ++G+NG +VI
Sbjct: 46  IAFRYFRAKKNEKFVSIISAFSLVGVMIGVAALIVVMSVMNGFHIELTKNIIGLNGDIVI 105

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVS-GQAFVSGLSSGGSGVLVRGISNSDFSYL 129
            ++   + +Y+ I  +L    D +K + F++ GQA   G  S  SGVLV+G+   D S  
Sbjct: 106 NRQGGSIDNYEEIKAKL-LKQDYVKHVTFIAYGQALALG-KSNNSGVLVKGMKLKDLSVR 163

Query: 130 QNSFSRFYGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDV-TPMGMGIRSK 187
              F        ++F  GK VI +G+ LA NLG+++GDKI ++SP   V T  G   RSK
Sbjct: 164 NEIFKNVNFGSFDNF-HGKNVIALGEQLASNLGVTVGDKIRLISPNNSVSTTFGSMPRSK 222

Query: 188 SYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRI 247
            + V+ +F     DYD   + M L  AQ + +L N ++ IE+   DPD        I  +
Sbjct: 223 EFKVIAIFNSGMYDYDLTTILMPLTAAQNFLSLGNDINLIEINSLDPDKALTYSHKIQLL 282

Query: 248 LGNGVVVIDWQQRYQIFFSC 267
           LG  + V +WQ     F S 
Sbjct: 283 LGPTLYVFNWQTLNSQFLSA 302


>gi|86137437|ref|ZP_01056014.1| lipoprotein releasing system transmembrane protein LolE
           [Roseobacter sp. MED193]
 gi|85825772|gb|EAQ45970.1| lipoprotein releasing system transmembrane protein LolE
           [Roseobacter sp. MED193]
          Length = 428

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 145/278 (52%), Gaps = 17/278 (6%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+RFE ++AWRYL + R    +S+ ++IS IG+ + V ALI  ++V +GFR + +  +LG
Sbjct: 8   FARFEWMIAWRYLRARRAEGGVSVMTWISLIGITLAVFALIATLAVRSGFRSEFVGTILG 67

Query: 64  INGHVVIQ-----------QKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSG 112
            N HV +            ++Y  + D+  +A R+  +P VI+  P V GQ   +     
Sbjct: 68  ANAHVTLYAHGELNEAGHFERY--IKDFDEMAARVAQVPGVIRAAPLVKGQVMANARQRN 125

Query: 113 GSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINIL 171
            +GV V GI+ +    +    ++  G +  D D   +GV IG  +AR LG+S+GD+I ++
Sbjct: 126 -AGVEVFGIAKAGIMTIPG-VAQSDGAI-GDLDLFQEGVAIGSGVARELGVSVGDRIKLI 182

Query: 172 SPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFV 231
           SP G  TP G   R K+Y V+ +F     D D   +YM   EAQ +FN E     IEV +
Sbjct: 183 SPNGVKTPFGTSPRVKAYEVVYIFTAGRYDIDRTRLYMPFGEAQSFFNREGVADEIEVMI 242

Query: 232 KDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +DP+ ++     ++R  G  V V  W+     F    E
Sbjct: 243 EDPEGVDLKVLPLLRAAGGAVGVWTWRDASGGFLRALE 280


>gi|187924544|ref|YP_001896186.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia phytofirmans PsJN]
 gi|187715738|gb|ACD16962.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia phytofirmans PsJN]
          Length = 417

 Score =  149 bits (377), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 144/267 (53%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMSGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  A       +VI   P+V  QA ++      SGV +RG+  
Sbjct: 65  VLAHVEIFSPTGSMPDWQLTAKEARQNKEVIGAAPYVEAQALLT-RQDAVSGVALRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    + +      G   N    G  G+++G DLA NLG+++ DKI +++P G +TP GM
Sbjct: 124 SLEPQVSDIGKEMKGGSLNALVPGDFGIVLGADLATNLGVTVNDKITLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  +++++AQ  F L  A +G+ + + D     +   
Sbjct: 184 LPRLKQFTVVGIFESGHYEYDSTLALINIKDAQALFRLP-APTGVRLRLTDMQRAPEVAH 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + R L   + + DW Q+ + +FS  +
Sbjct: 243 QLARTLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|302343541|ref|YP_003808070.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfarculus baarsii DSM 2075]
 gi|301640154|gb|ADK85476.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfarculus baarsii DSM 2075]
          Length = 407

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 144/266 (54%), Gaps = 4/266 (1%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE  VA RYL S RK AFIS+ + +S  GV +GV ALIVV+SVM GF+ +  K++LG + 
Sbjct: 3   FESFVALRYLRSRRKQAFISVITMLSMAGVALGVCALIVVLSVMGGFQREWQKKILGQSS 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           HV++      + D + +  ++   PDV  V PFV GQ  +      G G L+RGI  +  
Sbjct: 63  HVLVHGLSGSIDDPEAVMAKVRQDPDVTAVAPFVYGQVMLLAPGDAG-GALLRGIDVASA 121

Query: 127 SYLQNSFSRFYGNVSNDFDRGK---GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           + + +          +  D G+   G+I+G  +AR++G+ +G  +++++P GD TP+G  
Sbjct: 122 AKVLDLQEIMISGSLSALDDGRTPPGIIVGAAMARSMGLHMGSVVSVVNPLGDDTPVGRL 181

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            RS+ + V+G+F      YD+ + Y+SL   + +F L  AVSG+EV ++D     +    
Sbjct: 182 PRSEPFRVVGVFESGMYQYDSSVCYVSLAAGREFFGLGGAVSGLEVNIRDIYKAPEVAAR 241

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +   LG      DW +     F+  +
Sbjct: 242 LTEALGFEYYTRDWIRMNHTLFAALK 267


>gi|221198419|ref|ZP_03571465.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia multivorans CGD2M]
 gi|221208904|ref|ZP_03581901.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia multivorans CGD2]
 gi|221171187|gb|EEE03637.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia multivorans CGD2]
 gi|221182351|gb|EEE14752.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia multivorans CGD2M]
          Length = 417

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 87/275 (31%), Positives = 149/275 (54%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  A      P VI   P+V  QA ++      SGV++RGI  
Sbjct: 65  VLAHVEIFSPTGSMPDWQLTAQEARRNPSVIGAAPYVEAQALLT-RQDAVSGVMLRGIEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPY 174
           S    L+   S    ++  D   G+         G+++G  LA NLG+S+GDKI +++P 
Sbjct: 124 S----LEPQVS----DIGKDMKAGQLSALVPGQFGIVLGDALAGNLGVSVGDKITLVAPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G +TP GM  R K +TV+G+F     +YD+ +  + +++A+  F + +A +G+ + +KD 
Sbjct: 176 GSITPAGMMPRLKQFTVVGVFESGHYEYDSTLAMIDIRDAEALFRM-SAPTGVRLRLKDM 234

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    +   L   + + DW Q+ + +FS  +
Sbjct: 235 QKAPQVALELSHTLSGSLYIRDWTQQNKTWFSAVQ 269


>gi|157964849|ref|YP_001499673.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Rickettsia massiliae MTU5]
 gi|157844625|gb|ABV85126.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Rickettsia massiliae MTU5]
          Length = 451

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 98/259 (37%), Positives = 143/259 (55%), Gaps = 5/259 (1%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A+RY  + +   F+SI S  S +GVMIGV ALIVVMSVMNGF  ++ K ++G+NG +VI
Sbjct: 46  IAFRYFRAKKNEKFVSIISAFSLVGVMIGVAALIVVMSVMNGFHIELTKNIIGLNGDIVI 105

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVS-GQAFVSGLSSGGSGVLVRGISNSDFSYL 129
            ++   + +Y+ I  +L    D +K + F++ GQA   G  S  SGVLV+G+   D S  
Sbjct: 106 NRQGGSIDNYEEIKAKL-LKQDYVKHVTFIAHGQALALG-KSNNSGVLVKGMKLKDLSVR 163

Query: 130 QNSFSRFYGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKS 188
              F        ++F  GK VI +G+ LA NLGI++GDKI ++SP    T  G   RSK 
Sbjct: 164 NEIFKNVNFGSFDNF-HGKNVIALGEQLASNLGITVGDKIRLISPNAVSTAFGSMPRSKE 222

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL 248
           + V+ +F     DYD   + M L  AQ + +L + ++ IE+   DPD        I  +L
Sbjct: 223 FKVIAIFNSGMYDYDLTTILMPLTAAQNFLSLGDDINLIEINSLDPDKALAYSYKIQSLL 282

Query: 249 GNGVVVIDWQQRYQIFFSC 267
           G  + V +WQ     F S 
Sbjct: 283 GPTLYVFNWQTLNSQFLSA 301


>gi|99081687|ref|YP_613841.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Ruegeria sp. TM1040]
 gi|99037967|gb|ABF64579.1| Lipoprotein releasing system transmembrane protein LolC/E family
           [Ruegeria sp. TM1040]
          Length = 427

 Score =  149 bits (376), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 90/277 (32%), Positives = 137/277 (49%), Gaps = 15/277 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSRFE ++AWRYL + R    +S+ ++IS IG+ + V ALI  ++V +GFR + +  +LG
Sbjct: 7   FSRFEWMIAWRYLRARRSEGGVSVMTWISLIGITLAVFALIATLAVRSGFRSEFVGTILG 66

Query: 64  INGHVVIQQKYY---------PLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N H  +               + DY  +A  +  +P V++  P + GQ   S      +
Sbjct: 67  ANAHATVYAHGTVTAAGTLDRRITDYAALAEAVGQVPGVLQAAPLIKGQVMAS-RGDRNA 125

Query: 115 GVLVRGISNSDFSYLQNSFSR--FYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           GV V GI   D + +         YG++   FD   G+ +G  +AR LG+ IGDK+ ++S
Sbjct: 126 GVQVYGIHAEDLAKIPGVAQSDVAYGDLGR-FD--DGIALGSGVARTLGLGIGDKVKLIS 182

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R  +Y V+ +F     D DN   Y+   EAQ YFN E     IEV V 
Sbjct: 183 PNGVKTAFGTSPRVNAYEVVYVFTAGRYDIDNTRAYLPFAEAQSYFNREGVADEIEVMVA 242

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           DP+A+++    +++  G G  V  W+     F    E
Sbjct: 243 DPEAVDQYVLPLLQAAGQGYGVWSWRDSSGGFLRALE 279


>gi|238651015|ref|YP_002916871.1| lipoprotein releasing system transmembrane protein [Rickettsia
           peacockii str. Rustic]
 gi|238625113|gb|ACR47819.1| lipoprotein releasing system transmembrane protein [Rickettsia
           peacockii str. Rustic]
          Length = 451

 Score =  149 bits (376), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 97/259 (37%), Positives = 141/259 (54%), Gaps = 5/259 (1%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A+RY  + +   F+SI S  S +GVMIGV  LIVVMSVMNGF  ++ K ++G+NG +VI
Sbjct: 46  IAFRYFRAKKNEKFVSIISAFSLVGVMIGVATLIVVMSVMNGFHIELTKNIIGLNGDIVI 105

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVS-GQAFVSGLSSGGSGVLVRGISNSDFSYL 129
            ++   +  Y+ I  +L    D +K + F++ GQA   G  S  SGVLV+G+   D S  
Sbjct: 106 NRQGGSIDHYEEIKAKL-LKQDYVKHVTFIAHGQALALG-KSNNSGVLVKGMKLKDLSVR 163

Query: 130 QNSFSRFYGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKS 188
              F        ++F  GK VI +G+ LA NLG+++GDKI ++SP    T  G   RSK 
Sbjct: 164 NEIFKNVNFGSFDNF-HGKNVIALGEQLASNLGVTVGDKIRLISPNSVSTTFGSMPRSKE 222

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL 248
           + V+ +F     DYD   + M L  AQ + +L N ++ IE+   DPD        I  +L
Sbjct: 223 FKVIAIFNSGMYDYDLTTILMPLTAAQNFLSLGNDINLIEINSLDPDKALTYSHKIQSLL 282

Query: 249 GNGVVVIDWQQRYQIFFSC 267
           G  + V +WQ     F S 
Sbjct: 283 GPTLYVFNWQTLNSQFLSA 301


>gi|264676980|ref|YP_003276886.1| Lipoprotein-releasing systemtransmembrane protein lolC [Comamonas
           testosteroni CNB-2]
 gi|299531552|ref|ZP_07044958.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Comamonas testosteroni S44]
 gi|262207492|gb|ACY31590.1| Lipoprotein-releasing systemtransmembrane protein lolC [Comamonas
           testosteroni CNB-2]
 gi|298720515|gb|EFI61466.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Comamonas testosteroni S44]
          Length = 417

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 92/268 (34%), Positives = 145/268 (54%), Gaps = 8/268 (2%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ V WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YELAVGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVI-QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  HV I   +  PL D +         PDV+   PFV+ QA ++       G LVRGI 
Sbjct: 65  VVSHVEIYAPQGAPLPDVERTMREARANPDVVGAAPFVAAQALLAR-GEDMKGALVRGID 123

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +    + +  +   G V      G+  V++G +LARNLG+S GD I +++P G VTP G
Sbjct: 124 PAREGEVTD-LAATSGEVLKRLVPGEFKVVLGIELARNLGVSEGDVITLIAPSGQVTPAG 182

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R K  TV G F     +YD+ +V M  ++AQ  F LE   +GI + +KD     +  
Sbjct: 183 VLPRMKQMTVAGTFDSGHYEYDSALVMMHYEDAQRIFRLEGP-TGIRLKLKDLHEAPRVA 241

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +   L + + + DW Q+ + +F+  +
Sbjct: 242 HELADTLTDRLFIRDWTQQNKTWFAAVQ 269


>gi|301057956|ref|ZP_07199013.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [delta proteobacterium NaphS2]
 gi|300447923|gb|EFK11631.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [delta proteobacterium NaphS2]
          Length = 407

 Score =  149 bits (375), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 153/269 (56%), Gaps = 9/269 (3%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ +  RYL + RK  FIS+ + IS IGVM+GVMAL+VV+SVMNGFR D++ ++LG+N 
Sbjct: 2   FELFLGIRYLKAKRKQRFISVITIISVIGVMVGVMALVVVLSVMNGFRSDLMNKILGVNS 61

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG-SGVLVRGISNSD 125
           HV++         Y+ +A ++  I  V+ V PF+  Q  ++  SSG  SG ++RG+    
Sbjct: 62  HVLVLNLSGTFSGYKQVAEKVKKIEGVVAVTPFIYTQVMLN--SSGRVSGAVLRGVDPDS 119

Query: 126 FSYLQNSFSRFYGNVS----NDFDRG-KGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
              + N F +   N S    N  + G   +IIG +LA+ +G + G  + ++SP G +TP+
Sbjct: 120 AGQVVN-FDKMIKNGSLSSLNKTENGIPAIIIGSELAKQIGAATGSLVTVISPEGKLTPL 178

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G    +K + V G+F     +YD  MVY+SL+EAQ +  L   V+G+E+ VK+    +  
Sbjct: 179 GRTPNTKKFRVTGVFDSGMYEYDASMVYISLEEAQRFLALGENVTGLELKVKEVYQSDVV 238

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + I + LG      DW+   +  FS  +
Sbjct: 239 AKRIQKELGYPYWTKDWKLMNRSLFSALK 267


>gi|76811050|ref|YP_334104.1| lipoprotein releasing system transmembrane protein [Burkholderia
           pseudomallei 1710b]
 gi|254261199|ref|ZP_04952253.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 1710a]
 gi|76580503|gb|ABA49978.1| lipoprotein releasing system transmembrane protein, putative
           [Burkholderia pseudomallei 1710b]
 gi|254219888|gb|EET09272.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 1710a]
          Length = 417

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 142/267 (53%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  +F+S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIAFVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  A        VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEIFSPTGSMPDWQLTAKEARLNRSVIGAAPYVDAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    + +               G+ G+++G  LA NLG+ +GDK+ +++P G +TP GM
Sbjct: 124 SLEPQVSDIGKDMKAGALTALAPGQFGIVLGNALAGNLGVGVGDKVTLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  + +Q+AQ  F L  A +G+ + + D     +   
Sbjct: 184 MPRLKQFTVVGIFESGHYEYDSTLAMIDIQDAQALFRLP-APTGVRLRLTDMQKAPQVAR 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   L   + + DW Q+ + +FS  +
Sbjct: 243 ELAHTLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|161524331|ref|YP_001579343.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia multivorans ATCC 17616]
 gi|189350913|ref|YP_001946541.1| ABC-type transporter permease [Burkholderia multivorans ATCC 17616]
 gi|221214765|ref|ZP_03587734.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia multivorans CGD1]
 gi|160341760|gb|ABX14846.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia multivorans ATCC 17616]
 gi|189334935|dbj|BAG44005.1| ABC-type transport system permease component [Burkholderia
           multivorans ATCC 17616]
 gi|221165304|gb|EED97781.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia multivorans CGD1]
          Length = 417

 Score =  148 bits (374), Expect = 7e-34,   Method: Compositional matrix adjust.
 Identities = 86/275 (31%), Positives = 149/275 (54%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  A      P VI   P+V  QA ++      SGV++RGI  
Sbjct: 65  VLAHVEIFSPTGSMPDWQLTAQEARRNPSVIGAAPYVEAQALLT-RQDAVSGVMLRGIEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPY 174
           S    L+   S    ++  D   G+         G+++G  LA NLG+++GDKI +++P 
Sbjct: 124 S----LEPQVS----DIGKDMKAGQLSALVPGQFGIVLGDALAGNLGVTVGDKITLVAPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G +TP GM  R K +TV+G+F     +YD+ +  + +++A+  F + +A +G+ + +KD 
Sbjct: 176 GSITPAGMMPRLKQFTVVGVFESGHYEYDSTLAMIDIRDAEALFRM-SAPTGVRLRLKDM 234

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    +   L   + + DW Q+ + +FS  +
Sbjct: 235 QKAPQVALELSHTLSGSLYIRDWTQQNKTWFSAVQ 269


>gi|298529245|ref|ZP_07016648.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298510681|gb|EFI34584.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 409

 Score =  148 bits (373), Expect = 8e-34,   Method: Compositional matrix adjust.
 Identities = 93/274 (33%), Positives = 144/274 (52%), Gaps = 16/274 (5%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RFE +VA RYL + R+ AFIS+ S +S +GV +GV ALI+V+ VMNGF E++  ++LG+N
Sbjct: 2   RFEFLVALRYLRAKREQAFISVISLLSVLGVALGVAALIIVLGVMNGFSENLRDKILGLN 61

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS- 124
            H+V+      + DYQ +A  L+ I  V    PF+  +  +S   SG  GV++RGI    
Sbjct: 62  AHIVVGSHTGTIADYQDMAGDLEEIAGVRGATPFIYSEVMLS-TPSGVKGVVLRGIDPQG 120

Query: 125 -------DFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
                  D   +Q         +  DF    G+IIG++LA NL    GD +N+++P G+ 
Sbjct: 121 AKQVLGLDQEMVQGGVLDL--EIEKDF---PGLIIGQELAANLRAGTGDTVNVMAPSGEG 175

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPDA 236
           T  G      ++ V G+FR    +YD    Y ++ +AQ       + VSG+E+ V D D 
Sbjct: 176 TSAGFTPSITTFDVRGVFRTGMYEYDTSFAYTTINDAQELMGFTRDVVSGMELRVHDADR 235

Query: 237 IEKTHENIVRILGN-GVVVIDWQQRYQIFFSCYE 269
             +  E +   LG     V +W++  +  F+  E
Sbjct: 236 ARELSERVSEKLGGYPYYVRNWKEMNENLFAALE 269


>gi|323698048|ref|ZP_08109960.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio sp. ND132]
 gi|323457980|gb|EGB13845.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio desulfuricans ND132]
          Length = 409

 Score =  148 bits (373), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 97/269 (36%), Positives = 150/269 (55%), Gaps = 6/269 (2%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RFE  VA RYLF+ RK +FIS+ S  +  GV IGV ALIVV+ VMNGF  D+  ++LG+N
Sbjct: 2   RFETFVALRYLFALRKQSFISVISLFAVCGVAIGVGALIVVIGVMNGFSTDLRDKILGVN 61

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
            H++I      + DY+ +A+    +P V  V PFV  +  +S   +G  GV++RGI  S 
Sbjct: 62  AHILITSLRGGISDYEELADEAKKVPGVTGVTPFVYSEVMLS-TRTGVKGVVLRGIDPST 120

Query: 126 FSYLQNSFSRFY-GNVSNDFDRG--KGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
            S + +       G+VS   D G   G+IIG +LA+ LG++ G  +N+LSP G  +  G 
Sbjct: 121 SSSVLSLSKDMISGSVSRLNDNGDFPGIIIGSELAKRLGLTEGSLVNLLSPSGRTSAAGF 180

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEKTH 241
             +   + V G+FR    +YD+ M Y+S+  A+     + + VSG+E+ V D   ++K  
Sbjct: 181 TPKVSRFAVAGIFRTGMFEYDSSMGYVSIPAARQLLGFKGDLVSGLEISVDDVYNVKKIS 240

Query: 242 ENIV-RILGNGVVVIDWQQRYQIFFSCYE 269
            ++  ++    V V +WQ+     F+  E
Sbjct: 241 NDLRDKVASFTVYVRNWQEMNANLFAALE 269


>gi|91776447|ref|YP_546203.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Methylobacillus flagellatus KT]
 gi|91710434|gb|ABE50362.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylobacillus flagellatus KT]
          Length = 421

 Score =  148 bits (373), Expect = 9e-34,   Method: Compositional matrix adjust.
 Identities = 89/269 (33%), Positives = 145/269 (53%), Gaps = 10/269 (3%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ V  RY  + R+N FIS  S  S IG+ +GV ALIVV+SVMNGF+E++  R+LG+  
Sbjct: 9   FELFVGLRYTRAKRRNHFISFISLTSMIGIGLGVAALIVVLSVMNGFQEELRNRILGVAS 68

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+ I      L D++ +  ++   P V    P+V  Q  +S  S    G ++RG+     
Sbjct: 69  HLQITGPDNVLEDWRSLEQKVKGAPHVQAAAPYVMAQGMLS-FSQSVQGAIIRGVLPDAE 127

Query: 127 SYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIR 185
             +    S        D   G+ GV++G +LA++LG+ +GDK+ +++P G  TP G+  R
Sbjct: 128 DKVAELGSHMRAGRLQDLKPGEFGVVLGAELAQSLGVVLGDKVVLMAPQGQFTPTGVVPR 187

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD----PDAIEKTH 241
            K +TV+G+F +   +YD+G+  + L +A   + +   VSG+ + + D    P    +  
Sbjct: 188 IKQFTVVGVFEIGMFEYDSGLALIHLDDAARLYRMGENVSGVRLKLDDLFNAPAVARQLG 247

Query: 242 ENIVRILGNGVVVI-DWQQRYQIFFSCYE 269
           E   R++G G   I DW Q++  FF   +
Sbjct: 248 E---RLMGTGNYYISDWTQQHANFFRAIQ 273


>gi|209519982|ref|ZP_03268761.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia sp. H160]
 gi|209499579|gb|EDZ99655.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia sp. H160]
          Length = 433

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 145/271 (53%), Gaps = 14/271 (5%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 21  YEWQIGWRYTRAGKRTTGNGFISFIALVSMSGIALGVAALIVVLSVMNGFQKEVRDRMLS 80

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  AN       VI   P+V  QA ++      SGV +RGI  
Sbjct: 81  VLAHVEIFSPTGSMPDWQLTANEARQNKQVIGAAPYVEAQALLTR-QDAVSGVALRGIEP 139

Query: 124 SDFSYLQNSFSRFYGN-----VSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           +    + +      G      V+ DF    G+++G DLA NLG+ + DKI +++P G +T
Sbjct: 140 TLEPEVSDIGKEMKGGKLTALVAGDF----GIVLGADLAANLGVQLNDKITLVAPEGTIT 195

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P GM  R K +TV+G+F     +YD+ +  +++++AQ  F L  A +G+ + + D     
Sbjct: 196 PAGMLPRLKQFTVVGIFESGHYEYDSTLALINIKDAQALFRLP-APTGVRLRLTDMQRAP 254

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    + R L   + + DW Q+ + +FS  +
Sbjct: 255 EVAHQLARTLSGDLYIRDWTQQNKTWFSAVQ 285


>gi|325983512|ref|YP_004295914.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Nitrosomonas sp. AL212]
 gi|325533031|gb|ADZ27752.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Nitrosomonas sp. AL212]
          Length = 415

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 95/271 (35%), Positives = 153/271 (56%), Gaps = 11/271 (4%)

Query: 5   SRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGI 64
           S +E+ +  RY  + ++N FIS  S IS +G+ +G+ ALI VMSVMNGF++++  R+LG+
Sbjct: 2   SPYELFIGLRYTRAKKRNHFISFISLISLMGITLGMTALITVMSVMNGFQKEVRTRILGV 61

Query: 65  NGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
             HV I   +  L  +Q  A      P V    P+VS Q  +S  +    GVLVRGI   
Sbjct: 62  ASHVQIGSFHGNLSHWQQTAEEAIKHPAVEAAAPYVSAQGMLSH-NQVVQGVLVRGI--- 117

Query: 125 DFSYLQNSFSRFYGN-VSNDFDR---GK-GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
               +++  + F    VS D +    G+ G++IG +LAR +G  IGDKI ++SP G VTP
Sbjct: 118 -LPEMEDQVADFSKTMVSGDLNHLIPGEFGIVIGMELARAMGTFIGDKIVLISPQGQVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLEN-AVSGIEVFVKDPDAIE 238
            G+  R K +TV+G+F +   +YD+G++ + + +AQ  + +EN  VSGI + +KD     
Sbjct: 177 AGILPRLKQFTVVGIFEVGHFEYDSGLILIHMFDAQKLYRMENDDVSGIRLKLKDLFQAP 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           K  + +  +L     + DW +++  +F   +
Sbjct: 237 KVVQELPAMLTIDSHISDWTRQHANYFRAIQ 267


>gi|325518160|gb|EGC97938.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia sp. TJI49]
          Length = 417

 Score =  148 bits (373), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 85/275 (30%), Positives = 149/275 (54%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  A      P VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEIFSPTGSMPDWQLTAQEARRNPSVIGAAPYVEAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPY 174
           S    L+   S    ++  D   G+         G+++G  LA NLG+++GDKI +++P 
Sbjct: 124 S----LEPQVS----DIGKDMKAGQLSALVPGQFGIVLGDALAGNLGVTVGDKITLVAPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G +TP GM  R K +TV+G+F     +YD+ +  + +++A+  F + +A +G+ + +KD 
Sbjct: 176 GSITPAGMMPRLKQFTVVGVFESGHYEYDSTLAMIDIRDAEALFRM-SAPTGVRLRLKDM 234

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    +   L   + + DW Q+ + +FS  +
Sbjct: 235 QKAPQVALELSHTLSGSLYIRDWTQQNKTWFSAVQ 269


>gi|167837154|ref|ZP_02464037.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia thailandensis MSMB43]
          Length = 417

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 141/267 (52%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  A        VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEIFSPTGSMPDWQLTAKEARLNKAVIGAAPYVDAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    + +               G+ G+++G  LA NLG+ +GDK+ +++P G +TP GM
Sbjct: 124 SLEPQVSDIGKDMKAGALTALAPGQFGIVLGNALAGNLGVGVGDKVTLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  + LQ+AQ  F L  A +G+ + + D     +   
Sbjct: 184 MPRLKQFTVVGIFESGHYEYDSSLAMIDLQDAQALFRLP-APTGVRLRLADMQRAPQVAR 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   L   + + DW Q+ + +FS  +
Sbjct: 243 ELAHTLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|332185038|ref|ZP_08386787.1| liporeleasing system, transmembrane , LolC/E family protein
           [Sphingomonas sp. S17]
 gi|332014762|gb|EGI56818.1| liporeleasing system, transmembrane , LolC/E family protein
           [Sphingomonas sp. S17]
          Length = 416

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 90/268 (33%), Positives = 136/268 (50%), Gaps = 6/268 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           I SR+E ++A RYL   +  AFI + + IS + VM+GV AL++VMSVMNGFR ++  +++
Sbjct: 2   ILSRYERMIARRYLLPGKGEAFIFLVASISLVAVMLGVAALVIVMSVMNGFRAELFDKIV 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NGH V+Q     L D++ I       P V   +P +  Q  ++  +     VLVRG+ 
Sbjct: 62  GLNGHAVVQGTGGRLPDWRDIVREAKATPGVTSAVPMIE-QPLMATYNGRVEAVLVRGMR 120

Query: 123 NSDFSYLQNSFSR---FYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
             D     NS  R     GN+ +       + IG  LA  LG  +G +I+++SP G  TP
Sbjct: 121 VGDIR--GNSAIRSKVIMGNLMSVTPGSNRIAIGSRLAEALGAQVGSEISLISPQGQTTP 178

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G   R  SYTV  +F +   DYD   V M +++AQ    + + V  +EV   D D + +
Sbjct: 179 FGTVPRIVSYTVGAIFEIGVYDYDKAYVIMPIEDAQTLLLMGDTVGMVEVQTTDADRVGQ 238

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSC 267
               +   LG   V+ DW+      F  
Sbjct: 239 ILAPLADKLGGRAVIADWRTMNAQLFEA 266


>gi|312796702|ref|YP_004029624.1| lipoprotein releasing system transmembrane protein lolC
           [Burkholderia rhizoxinica HKI 454]
 gi|312168477|emb|CBW75480.1| Lipoprotein releasing system transmembrane protein lolC
           [Burkholderia rhizoxinica HKI 454]
          Length = 494

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 145/267 (54%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  +  RY  + ++   N FIS  S IS  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 82  YEWQIGLRYTRTGKRSSGNGFISFISLISMSGIALGVAALIVVLSVMNGFQKEVRDRMLS 141

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ I      +  +Q  AN     P+VI   P+V  QA ++   S  +GV +RGI  
Sbjct: 142 VLAHIEIFSPTGSMPSWQLTANEARQNPEVIGAAPYVDAQALLT-RQSAVNGVALRGIDP 200

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +    + +           D   G  G+++G DLA  +G+S+GDK+ +++P G +TP GM
Sbjct: 201 ALEPQVSDMGGEMKAGRLTDLRPGSFGIVLGVDLASAMGVSVGDKVTVVAPEGTMTPAGM 260

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     ++D+ +  +S+ +AQ  F L +A SG+ + +KD     +   
Sbjct: 261 LPRLKQFTVVGVFESGHYEFDSTLAMVSIADAQALFRL-SAPSGVRLRIKDMQRAPEVAR 319

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + R L   + + DW Q+ + +FS  +
Sbjct: 320 QLARSLSGDLYIRDWTQQNKTWFSAVQ 346


>gi|253998345|ref|YP_003050408.1| LolC/E family lipoprotein releasing system transmembrane protein
           [Methylovorus sp. SIP3-4]
 gi|253985024|gb|ACT49881.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylovorus sp. SIP3-4]
          Length = 422

 Score =  147 bits (372), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 87/268 (32%), Positives = 148/268 (55%), Gaps = 8/268 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+ V  RY  + R+N FIS  S  S IG+ +GV ALI+V+SVMNGF+E++  R+LG+  
Sbjct: 10  YEIFVGLRYTRAKRRNHFISFISMTSMIGIGLGVAALIIVLSVMNGFQEELRSRILGVAS 69

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H+ I      L D+  +A  ++  P V  V P++  Q     LS G S  G +VRG+   
Sbjct: 70  HMQISGVDNKLADWPILAKEVEHAPHVQAVAPYIMAQGM---LSYGQSVQGAIVRGVLPV 126

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           D   + +           D   G+ G+++G +LA++LG+ +GDK+ +L+P G  TP G+ 
Sbjct: 127 DEDRVADLGRHMRAGKLTDLKEGEFGIVLGAELAQSLGVILGDKVVVLAPQGQFTPTGIV 186

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK-THE 242
            R K + V+G+F++   +YD G+  + + +A   + + + VSG+ + + D  A  + T  
Sbjct: 187 PRIKQFRVVGIFQIGMYEYDAGLALIHMADAAKLYRMGSDVSGVRLKLDDLFAAPRVTTA 246

Query: 243 NIVRILGNGVVVI-DWQQRYQIFFSCYE 269
            + ++ G G   I DW +++  FF   +
Sbjct: 247 LVAQLQGKGNYYISDWTEQHANFFRAVQ 274


>gi|313200419|ref|YP_004039077.1| LolC/E family lipoprotein releasing system transmembrane protein
           [Methylovorus sp. MP688]
 gi|312439735|gb|ADQ83841.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylovorus sp. MP688]
          Length = 422

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 87/268 (32%), Positives = 148/268 (55%), Gaps = 8/268 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+ V  RY  + R+N FIS  S  S IG+ +GV ALI+V+SVMNGF+E++  R+LG+  
Sbjct: 10  YEIFVGLRYTRAKRRNHFISFISMTSMIGIGLGVAALIIVLSVMNGFQEELRSRILGVAS 69

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H+ I      L D+  +A  ++  P V  V P++  Q     LS G S  G +VRG+   
Sbjct: 70  HMQISGVDNKLADWPILAKEVEHAPHVQAVAPYIMAQGM---LSYGQSVQGAIVRGVLPV 126

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           D   + +           D   G+ G+++G +LA++LG+ +GDK+ +L+P G  TP G+ 
Sbjct: 127 DEDRVADLGRHMRAGKLTDLKEGEFGIVLGAELAQSLGVILGDKVVVLAPQGQFTPTGIV 186

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK-THE 242
            R K + V+G+F++   +YD G+  + + +A   + + + VSG+ + + D  A  + T  
Sbjct: 187 PRIKQFRVVGIFQIGMYEYDAGLALIHMADAAKLYRMGSDVSGVRLKLDDLFAAPRVTTA 246

Query: 243 NIVRILGNGVVVI-DWQQRYQIFFSCYE 269
            + ++ G G   I DW +++  FF   +
Sbjct: 247 LVAQLQGKGNYYISDWTEQHANFFRAVQ 274


>gi|170694752|ref|ZP_02885903.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia graminis C4D1M]
 gi|170140383|gb|EDT08560.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia graminis C4D1M]
          Length = 417

 Score =  147 bits (371), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 145/267 (54%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMSGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + ++Q  A       +VI   P+V  QA ++      SGV +RGI  
Sbjct: 65  VLAHVEIFSPTGSMPNWQLTAQEARQNKEVIGAAPYVEAQALLT-RQDAVSGVALRGIEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +    + +      G    D   G+ G+++G DLA NLG+++ DKI +++P G +TP GM
Sbjct: 124 ALEPQVSDIGKEMKGGKLTDLVPGEFGIVLGADLATNLGVAVNDKITLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  +++++AQ  F L  A +G+ + + D     +   
Sbjct: 184 LPRLKQFTVVGIFESGHYEYDSTLALINIKDAQALFRLP-APTGVRLRLADMQRAPEVAH 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + R L   + + DW Q+ + +FS  +
Sbjct: 243 QLARSLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|83719509|ref|YP_442417.1| lipoprotein releasing system transmembrane protein [Burkholderia
           thailandensis E264]
 gi|83653334|gb|ABC37397.1| lipoprotein releasing system transmembrane protein, putative
           [Burkholderia thailandensis E264]
          Length = 448

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 141/267 (52%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 36  YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 95

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  A        VI   P+V  QA ++      SGV++RG+  
Sbjct: 96  VLAHVEIFSPTGSMPDWQLTAKEARLNRSVIGAAPYVDAQALLT-RQDAVSGVMLRGVEP 154

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    + +               G+ G+++G  LA NLG+ +GDK+ +++P G +TP GM
Sbjct: 155 SLEPQVSDIGKDMKAGALTALAPGQFGIVLGNALAGNLGVGVGDKVTLVAPEGTITPAGM 214

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  + +Q+AQ  F L  A +G+ + + D     +   
Sbjct: 215 MPRLKQFTVVGIFESGHYEYDSTLAMIDIQDAQALFRLP-APTGVRLRLTDMQKAPQVAR 273

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   L   + + DW Q+ + +FS  +
Sbjct: 274 ELAHTLSGDLYIRDWTQQNKTWFSAVQ 300


>gi|167586756|ref|ZP_02379144.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia ubonensis Bu]
          Length = 417

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 90/280 (32%), Positives = 152/280 (54%), Gaps = 32/280 (11%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV +      + D+Q  A      P V    P+V  QA ++      SGV++RGI  
Sbjct: 65  VLAHVEVFSPTGQMPDWQLTAQEARRNPSVTGAAPYVEAQALLT-RQDAVSGVMLRGIEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPY 174
           S    L+   S     +  D   G+         G+++G  LA NLG+++GDK+ +++P 
Sbjct: 124 S----LEPQVS----EIGKDMKAGQLTALVPGQFGIVLGDALAGNLGVTVGDKVTLVAPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD- 233
           G +TP GM  R K +TV+G+F     +YD+ +  + +++A+  F L +A +G+ + VKD 
Sbjct: 176 GTITPAGMLPRLKQFTVVGVFESGHYEYDSTLAMIDIRDAEALFRL-SAPTGVRLRVKDM 234

Query: 234 ---PD-AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              PD A+E +H      L   + + DW Q+ + +FS  +
Sbjct: 235 QKAPDVAVELSHS-----LSGSLYIRDWTQQNKTWFSAVK 269


>gi|119384577|ref|YP_915633.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Paracoccus denitrificans PD1222]
 gi|119374344|gb|ABL69937.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Paracoccus denitrificans PD1222]
          Length = 433

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 90/284 (31%), Positives = 143/284 (50%), Gaps = 23/284 (8%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSR+E ++AWRYL + R    +S+ ++IS IG+ +GVMAL+  ++V  GFR + +  +LG
Sbjct: 7   FSRYEFMIAWRYLRARRAEGGVSVMTWISLIGITLGVMALVATLAVRAGFRAEFVDTILG 66

Query: 64  INGHVVI----QQKYYPLV-----------DYQFIANRLDFIPDVIKVLPFVSGQAFVSG 108
            N H  +     Q Y  L            DY  +A R+  IP V + +P V  Q     
Sbjct: 67  ANAHSTVYYAPTQVYNELTEETYVTQGRIEDYDALAARIAQIPGVTRAVPAVRAQVMAR- 125

Query: 109 LSSGGSGVL--VRGISNSDFSYLQNSFSRFYGNVS-NDFDRGKGVIIGKDLARNLGISIG 165
              G +  L  V GI+      +         + S +DFD  +G+ IG  +ARNLG+ IG
Sbjct: 126 --QGDAAALGDVHGITLDALGGMAGIADPESASGSLDDFD--QGIAIGIGMARNLGVRIG 181

Query: 166 DKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVS 225
           D++ +++P G  TP G   R +S+ V+ +F     D D   +YM L EAQ +FN E    
Sbjct: 182 DRLQLVAPDGAKTPFGTTPRVESFEVVYIFSAGRYDVDQARIYMPLAEAQSFFNREGLAD 241

Query: 226 GIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            I V+V DP+ ++     ++++LG    +  W+     F +  +
Sbjct: 242 EIGVYVADPERVDDWTMPLLQVLGERGQIWTWRDASGSFLAALD 285


>gi|134277900|ref|ZP_01764615.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 305]
 gi|134251550|gb|EBA51629.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 305]
          Length = 417

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 142/267 (53%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  A        VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEIFSPTGSMPDWQLTAKEARLNRSVIGAAPYVDAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    + +               G+ G+++G  LA NLG+ +GDK+ +++P G +TP GM
Sbjct: 124 SLEPQVSDIGKDMKAGALTALAPGQFGIVLGNALAGNLGVGVGDKVTLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  +++Q+AQ  F L  A +G+ + + D     +   
Sbjct: 184 MPRLKQFTVVGIFESGHYEYDSTLAMINIQDAQALFRLP-APTGVRLRLTDMQKAPQVAR 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   L   + + DW Q+ + +FS  +
Sbjct: 243 ELAHTLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|167739329|ref|ZP_02412103.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 14]
          Length = 417

 Score =  146 bits (369), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 141/267 (52%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  A        VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEIFSPTGSMPDWQLTAKEARLNRSVIGAAPYVDAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    + +               G+ G+++G  LA NLG+ +GDK+ +++P G +TP GM
Sbjct: 124 SLEPQVSDIGKDMKAGALTALAPGQFGIVLGNALAGNLGVGVGDKVTLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  + +Q+AQ  F L  A +G+ + + D     +   
Sbjct: 184 MPRLKQFTVVGIFESGHYEYDSTLAMIDIQDAQALFRLP-APTGVRLRLTDMQKAPQVAR 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   L   + + DW Q+ + +FS  +
Sbjct: 243 ELAHTLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|126439271|ref|YP_001059610.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia pseudomallei 668]
 gi|126453503|ref|YP_001066892.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia pseudomallei 1106a]
 gi|167720337|ref|ZP_02403573.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei DM98]
 gi|167824940|ref|ZP_02456411.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 9]
 gi|167846457|ref|ZP_02471965.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei B7210]
 gi|167895035|ref|ZP_02482437.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 7894]
 gi|167903420|ref|ZP_02490625.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei NCTC 13177]
 gi|167911670|ref|ZP_02498761.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 112]
 gi|167919671|ref|ZP_02506762.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei BCC215]
 gi|226195486|ref|ZP_03791074.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei Pakistan 9]
 gi|242317450|ref|ZP_04816466.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 1106b]
 gi|254191412|ref|ZP_04897916.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|254297043|ref|ZP_04964496.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 406e]
 gi|126218764|gb|ABN82270.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 668]
 gi|126227145|gb|ABN90685.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 1106a]
 gi|157807230|gb|EDO84400.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 406e]
 gi|157939084|gb|EDO94754.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei Pasteur 52237]
 gi|225932446|gb|EEH28445.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei Pakistan 9]
 gi|242140689|gb|EES27091.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 1106b]
          Length = 417

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 141/267 (52%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  A        VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEIFSPTGSMPDWQLTAKEARLNRSVIGAAPYVDAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    + +               G+ G+++G  LA NLG+ +GDK+ +++P G +TP GM
Sbjct: 124 SLEPQVSDIGKDMKAGALTALAPGQFGIVLGNALAGNLGVGVGDKVTLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  + +Q+AQ  F L  A +G+ + + D     +   
Sbjct: 184 MPRLKQFTVVGIFESGHYEYDSTLAMIDIQDAQALFRLP-APTGVRLRLTDMQKAPQVAR 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   L   + + DW Q+ + +FS  +
Sbjct: 243 ELAHTLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|53719887|ref|YP_108873.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia pseudomallei K96243]
 gi|53723791|ref|YP_103316.1| lipoprotein releasing system transmembrane protein [Burkholderia
           mallei ATCC 23344]
 gi|67642988|ref|ZP_00441738.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia mallei GB8 horse 4]
 gi|121600110|ref|YP_993513.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia mallei SAVP1]
 gi|124384592|ref|YP_001029058.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia mallei NCTC 10229]
 gi|126448606|ref|YP_001081021.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia mallei NCTC 10247]
 gi|167000666|ref|ZP_02266477.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia mallei PRL-20]
 gi|167816544|ref|ZP_02448224.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia pseudomallei 91]
 gi|217421146|ref|ZP_03452651.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 576]
 gi|237813004|ref|YP_002897455.1| lipoprotein releasing system, hypothetical protein, LolC/E family
           [Burkholderia pseudomallei MSHR346]
 gi|254177780|ref|ZP_04884435.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia mallei ATCC 10399]
 gi|254184378|ref|ZP_04890968.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 1655]
 gi|254195708|ref|ZP_04902134.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei S13]
 gi|254200271|ref|ZP_04906637.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia mallei FMH]
 gi|254209349|ref|ZP_04915695.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia mallei JHU]
 gi|254357980|ref|ZP_04974253.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia mallei 2002721280]
 gi|52210301|emb|CAH36280.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia pseudomallei K96243]
 gi|52427214|gb|AAU47807.1| lipoprotein releasing system transmembrane protein, putative
           [Burkholderia mallei ATCC 23344]
 gi|121228920|gb|ABM51438.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia mallei SAVP1]
 gi|124292612|gb|ABN01881.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia mallei NCTC 10229]
 gi|126241476|gb|ABO04569.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia mallei NCTC 10247]
 gi|147749867|gb|EDK56941.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia mallei FMH]
 gi|147750122|gb|EDK57193.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia mallei JHU]
 gi|148027107|gb|EDK85128.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia mallei 2002721280]
 gi|160698819|gb|EDP88789.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia mallei ATCC 10399]
 gi|169652453|gb|EDS85146.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei S13]
 gi|184214909|gb|EDU11952.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 1655]
 gi|217396558|gb|EEC36575.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei 576]
 gi|237503311|gb|ACQ95629.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia pseudomallei MSHR346]
 gi|238524221|gb|EEP87655.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia mallei GB8 horse 4]
 gi|243063473|gb|EES45659.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia mallei PRL-20]
          Length = 417

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 141/267 (52%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  A        VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEIFSPTGSMPDWQLTAKEARLNRSVIGAAPYVDAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    + +               G+ G+++G  LA NLG+ +GDK+ +++P G +TP GM
Sbjct: 124 SLEPQVSDIGKDMKAGALTALAPGQFGIVLGNALAGNLGVGVGDKVTLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  + +Q+AQ  F L  A +G+ + + D     +   
Sbjct: 184 MPRLKQFTVVGIFESGHYEYDSTLAMIDIQDAQALFRLP-APTGVRLRLTDMQKAPQVAR 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   L   + + DW Q+ + +FS  +
Sbjct: 243 ELAHTLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|186476204|ref|YP_001857674.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia phymatum STM815]
 gi|184192663|gb|ACC70628.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia phymatum STM815]
          Length = 417

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 143/267 (53%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMSGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + ++Q  A       +VI   P+V  QA ++      SGV +RG+  
Sbjct: 65  VLAHVEIFSPAGSMPNWQLTAQEAKQNKEVIGAAPYVEAQALLT-RQDAVSGVALRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    + +          ND   G+ G+++G DLA  LG++ GDKI +++P G +TP G+
Sbjct: 124 SLEPEVSDIGKEMKAGSLNDLKPGEFGIVLGADLAAALGVTTGDKITLVAPEGTMTPAGL 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K + V+G+F     +YD+ +  + +++AQ  F L  A +G+ + +KD     +   
Sbjct: 184 LPRLKQFNVVGVFESGHYEYDSTLALIDIRDAQALFRLP-APTGVRLRLKDMQRAPEVAH 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + R L   + + DW Q+ + +FS  +
Sbjct: 243 QLARTLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|163740903|ref|ZP_02148296.1| lipoprotein releasing system transmembrane protein LolE
           [Phaeobacter gallaeciensis 2.10]
 gi|161385894|gb|EDQ10270.1| lipoprotein releasing system transmembrane protein LolE
           [Phaeobacter gallaeciensis 2.10]
          Length = 430

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 94/280 (33%), Positives = 144/280 (51%), Gaps = 18/280 (6%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSRFE ++AWRYL + R    +S+ ++IS IG+ + V ALI  ++V  GFR + +  +LG
Sbjct: 7   FSRFEWLIAWRYLRARRAEGGVSVMTWISLIGIALAVFALIATLAVRTGFRSEFVGTILG 66

Query: 64  INGHVVI---------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +          Q    L +Y  +A     +P VI+  P + GQ   S L    +
Sbjct: 67  ANAHVTLYSHGTVTEQGQIDRKLTEYDALAEAAAAVPGVIRTAPLIKGQVMAS-LRQRSA 125

Query: 115 GVLVRGISNSDFSYLQN--SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           GV V GIS ++ + L          G++S  FD  +GV +G  +AR LG+S+GD+I ++S
Sbjct: 126 GVEVFGISAANIATLPGIAQSEAAIGDLSR-FD--EGVALGSGVARELGVSVGDRIKLIS 182

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R  +Y V+ +F     D D   +YM   EAQ YFN E     IEV V+
Sbjct: 183 PNGVKTAFGTSPRVNAYEVVYIFTAGRYDIDRTRLYMPFAEAQSYFNREGFADEIEVMVE 242

Query: 233 DPDAIEKTHENIVRI---LGNGVVVIDWQQRYQIFFSCYE 269
           DP+ +++    +++    + +G+ V  W+     F    E
Sbjct: 243 DPETVDRMVLPLLQAGDEVASGIGVWTWRDASGGFLRALE 282


>gi|170733468|ref|YP_001765415.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia cenocepacia MC0-3]
 gi|254247793|ref|ZP_04941114.1| ABC-type transport system, permease component [Burkholderia
           cenocepacia PC184]
 gi|124872569|gb|EAY64285.1| ABC-type transport system, permease component [Burkholderia
           cenocepacia PC184]
 gi|169816710|gb|ACA91293.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia cenocepacia MC0-3]
          Length = 417

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 83/275 (30%), Positives = 149/275 (54%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV +      + D+Q  A      P VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEVFSPTGSMPDWQLTAQEARRNPSVIGAAPYVDAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPY 174
           S    L+   S    ++  D   G+         G+++G  LA NLG+++GDK+ +++P 
Sbjct: 124 S----LEPQVS----DIGKDMKAGQLGALVPGQFGIVLGDALAGNLGVTVGDKVTLVAPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G +TP GM  R K +TV+G+F     +YD+ +  +++++A+  F + NA +G+ + + D 
Sbjct: 176 GSITPAGMMPRLKQFTVVGVFESGHYEYDSTLAMINIRDAEALFRM-NAPTGVRLRLTDM 234

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    +   L   + + DW Q+ + +FS  +
Sbjct: 235 QKAPQVAVELSHTLSGSLYIRDWTQQNKTWFSAVQ 269


>gi|91784235|ref|YP_559441.1| ABC lipoprotein efflux pump, inner membrane subunit [Burkholderia
           xenovorans LB400]
 gi|91688189|gb|ABE31389.1| ABC lipoprotein efflux pump, inner membrane subunit [Burkholderia
           xenovorans LB400]
          Length = 417

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 144/267 (53%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMSGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + ++Q  A       +VI   P+V  QA ++      SGV +RG+  
Sbjct: 65  VLAHVEIFSPTGSMPNWQLTAQEARQNKEVIGAAPYVEAQALLT-RQDAVSGVALRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    + +      G   N    G  G+++G DLA NLG+++ DKI +++P G +TP GM
Sbjct: 124 SLEPQVSDIGKEMKGGSLNALVPGDFGIVLGADLATNLGVTVNDKITLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  +++++AQ  F L  A +G+ + + D     +   
Sbjct: 184 LPRLKQFTVVGIFESGHYEYDSTLALINIKDAQALFRLP-APTGVRLRLTDMQRAPEVAH 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + R L   + + DW Q+ + +FS  +
Sbjct: 243 QLARSLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|254251977|ref|ZP_04945295.1| ABC-type transport system permease component [Burkholderia dolosa
           AUO158]
 gi|124894586|gb|EAY68466.1| ABC-type transport system permease component [Burkholderia dolosa
           AUO158]
          Length = 417

 Score =  146 bits (369), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 86/275 (31%), Positives = 148/275 (53%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV +      + D+Q  A      P VI   P+V  QA ++      SGV++RGI  
Sbjct: 65  VLAHVEVFSPTGSMPDWQLTAQEARRNPSVIGAAPYVEAQALLT-RQDAVSGVMLRGIEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPY 174
           S    L+   S    ++  D   GK         G+++G  LA NLG+++GDKI +++P 
Sbjct: 124 S----LEPQVS----DIGKDMKAGKLAALVPGQFGIVLGDALAGNLGVTVGDKIMLVAPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G +TP GM  R K +TV+G+F     +YD+ +  +++++A+  F L  A +G+ + + D 
Sbjct: 176 GTITPAGMMPRLKQFTVVGVFESGHYEYDSTLAMINIRDAEALFRLP-APTGVRLRLTDM 234

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    +   L   + + DW Q+ + +FS  +
Sbjct: 235 QKAPQVALELSHTLSGSLYIRDWTQQNKTWFSAVQ 269


>gi|78356413|ref|YP_387862.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
 gi|78218818|gb|ABB38167.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           G20]
          Length = 408

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 85/248 (34%), Positives = 136/248 (54%), Gaps = 4/248 (1%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RFE+ VA RYLF+ RK  FIS+ S IS +GV +GV +LIVV+ VMNGF  DM +++LG+N
Sbjct: 2   RFELFVALRYLFARRKQTFISVISVISVLGVALGVASLIVVLGVMNGFTVDMREKILGVN 61

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
            HV+       +  Y  +  + + +P V    PF+  +  +S    G  GV++RG+    
Sbjct: 62  AHVITLAAGGGISGYPELVRKAETVPGVKGATPFIYSEVMLS-TRYGVKGVVLRGVDPVS 120

Query: 126 FSYLQNSFSRFYGNVSNDFDR--GKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
              +     R       D +R    G++IGK+LA+ LGI++G ++N+LSP G+ T  G  
Sbjct: 121 APAVLGIAGRMVDGSLADLERSGAPGLVIGKELAKRLGITVGSRVNLLSPSGEKTSAGFT 180

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPDAIEKTHE 242
            R  S+ + G+F     +YD+ + ++SL  A+    +    VSG+E+ V D    +   +
Sbjct: 181 PRILSFKIAGIFSTGMFEYDSSLGFVSLDAARDLLGMPAGTVSGLEIVVDDIYRADTVAQ 240

Query: 243 NIVRILGN 250
            + + LG 
Sbjct: 241 AVTQALGG 248


>gi|167581343|ref|ZP_02374217.1| lipoprotein releasing system transmembrane protein, putative
           [Burkholderia thailandensis TXDOH]
 gi|167619423|ref|ZP_02388054.1| lipoprotein releasing system transmembrane protein, putative
           [Burkholderia thailandensis Bt4]
 gi|257138620|ref|ZP_05586882.1| lipoprotein releasing system transmembrane protein, putative
           [Burkholderia thailandensis E264]
          Length = 417

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 141/267 (52%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  A        VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEIFSPTGSMPDWQLTAKEARLNRSVIGAAPYVDAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    + +               G+ G+++G  LA NLG+ +GDK+ +++P G +TP GM
Sbjct: 124 SLEPQVSDIGKDMKAGALTALAPGQFGIVLGNALAGNLGVGVGDKVTLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  + +Q+AQ  F L  A +G+ + + D     +   
Sbjct: 184 MPRLKQFTVVGIFESGHYEYDSTLAMIDIQDAQALFRLP-APTGVRLRLTDMQKAPQVAR 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   L   + + DW Q+ + +FS  +
Sbjct: 243 ELAHTLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|296158322|ref|ZP_06841153.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia sp. Ch1-1]
 gi|295891266|gb|EFG71053.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia sp. Ch1-1]
          Length = 417

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 144/267 (53%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMSGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + ++Q  A       +VI   P+V  QA ++      SGV +RG+  
Sbjct: 65  VLAHVEIFSPTGSMPNWQLTAQEARQNKEVIGAAPYVEAQALLT-RQDAVSGVALRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    + +      G   N    G  G+++G DLA NLG+++ DKI +++P G +TP GM
Sbjct: 124 SLEPQVSDIGKEMKGGSLNALVPGDFGIVLGADLATNLGVAVNDKITLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  +++++AQ  F L  A +G+ + + D     +   
Sbjct: 184 LPRLKQFTVVGIFESGHYEYDSTLALINIKDAQALFRLP-APTGVRLRLTDMQRAPEVAH 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + R L   + + DW Q+ + +FS  +
Sbjct: 243 QLARSLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|237746043|ref|ZP_04576523.1| outer membrane lipoproteins ABC transporter membrane protein
           [Oxalobacter formigenes HOxBLS]
 gi|229377394|gb|EEO27485.1| outer membrane lipoproteins ABC transporter membrane protein
           [Oxalobacter formigenes HOxBLS]
          Length = 422

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 154/277 (55%), Gaps = 9/277 (3%)

Query: 1   MSIFSR--FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFRE 55
           M IFS   FE +V  RYL S ++   N FIS  S IS  G+ +GV ALI+VMSVMNGF++
Sbjct: 1   MKIFSNLPFEWLVGLRYLRSGKRSGRNRFISFISLISMTGIALGVAALIIVMSVMNGFQK 60

Query: 56  DMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSG 115
           ++  R+L +  H+ +Q  Y  L D++  A      P+V    P+V GQA V+  +    G
Sbjct: 61  EVRDRMLSVLPHIEVQDIYGSLPDWRKTAETARQNPEVTGTAPYVIGQALVTR-NDTMRG 119

Query: 116 VLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPY 174
           V+VRGI   +   +     +F      D       + IGK+LAR L I  GDK+ ++ P 
Sbjct: 120 VIVRGIEPKEEPNVSEIARQFIAGKLGDLQPDSFNIAIGKELARMLRIGPGDKLTVVIPQ 179

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD- 233
           G VTP G+  R K +TV G+F     ++D+ + ++++++A   F   NA +G+ + +KD 
Sbjct: 180 GQVTPAGVLPRLKQFTVSGIFEAGHFEFDSTLAFVNMEDAMRMFR-TNAPTGLRIQIKDM 238

Query: 234 PDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES 270
            +A +  HE  + +  + V+V DW ++ + +F+  ++
Sbjct: 239 QEAPQVAHEIGLLLSDDDVIVRDWSKQNRNWFAAVQT 275


>gi|56478739|ref|YP_160328.1| hypothetical protein ebA5819 [Aromatoleum aromaticum EbN1]
 gi|56314782|emb|CAI09427.1| conserved hypothetical protein [Aromatoleum aromaticum EbN1]
          Length = 417

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 87/268 (32%), Positives = 147/268 (54%), Gaps = 8/268 (2%)

Query: 6   RFEVIVAWRYLFSNRK----NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRV 61
           R+E++V  RY  S ++    N FIS  S +S +G  +G+ ALIVV+SVMNGF+E++  R+
Sbjct: 2   RYEILVGLRYTRSRKRAQGRNRFISFISLVSMLGTALGIAALIVVLSVMNGFQEELRTRI 61

Query: 62  LGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
           LG+  HV +      L  +Q +A++    PDV+   P++  Q  +S       G LVRG+
Sbjct: 62  LGVASHVQVSGFDGELDAWQQVADQAARHPDVVATAPYIQEQGMLS-FDQAVRGTLVRGV 120

Query: 122 SNSDFSYLQNSFSRFYGNVSND-FDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
                  + + F RF  + S D    G+ G+++G+DLA  L   +GDK+ +++P G VTP
Sbjct: 121 LPGAEDGVAD-FVRFMRSGSFDALQPGRFGIVLGRDLAFALQAQVGDKVTLIAPQGLVTP 179

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
             +  R K + V+G+F     +YD+G+  + L++AQ  + ++  VSG+ + + D  A  +
Sbjct: 180 AAVLPRVKQFEVVGIFEAGMFEYDSGLALIHLRDAQALYRMDERVSGVRLKLDDLFAAPR 239

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSC 267
               +  ++   V V DW + +  FF  
Sbjct: 240 VARELPGLIEGAVAVSDWTRSHANFFRA 267


>gi|310815330|ref|YP_003963294.1| lipoprotein releasing system transmembrane protein LolE
           [Ketogulonicigenium vulgare Y25]
 gi|308754065|gb|ADO41994.1| lipoprotein releasing system transmembrane protein LolE
           [Ketogulonicigenium vulgare Y25]
          Length = 428

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 88/275 (32%), Positives = 137/275 (49%), Gaps = 33/275 (12%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+RFE ++AWRYL + +    +S+ ++IS IGV + V AL+  +++  GFRE+ +  +LG
Sbjct: 8   FARFEWMIAWRYLRARKAEGGVSVMTWISLIGVTLAVFALVATLAIREGFREEFVDSILG 67

Query: 64  INGHVVIQQKYYP-----------LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSG 112
            N HV + Q  YP           + DYQ +A  L  +P V +  P V   A  +     
Sbjct: 68  ANAHVTMMQ--YPVMDSAGSNDRTITDYQAMAADLAAVPGVTRAAPLVRATALATA-GQY 124

Query: 113 GSGVLVRGISNSDFSYL---------QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGIS 163
            + V + GIS +D + +         Q S + F G          GV IG  +A++LG+ 
Sbjct: 125 NAPVDIYGISAADLATIPSIADPANQQGSLADFEG----------GVAIGSGVAQSLGLQ 174

Query: 164 IGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENA 223
           +GD I I SP G  TPMG+  R+ +YTV  +F     D D   +YM L +AQ + N +  
Sbjct: 175 VGDSIRITSPNGARTPMGVVPRANAYTVTMIFSAGRYDIDRVRLYMPLADAQSFLNRDGV 234

Query: 224 VSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQ 258
              IEV V DP+ ++     ++   G   +   W+
Sbjct: 235 ADEIEVMVADPENVDAIVPALMNAAGPRAMPWTWK 269


>gi|78066889|ref|YP_369658.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia sp. 383]
 gi|77967634|gb|ABB09014.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia sp. 383]
          Length = 417

 Score =  146 bits (368), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 155/280 (55%), Gaps = 32/280 (11%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV +      + D+Q  A      P VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEVFSPTGSMPDWQLTAQEARRNPSVIGAAPYVDAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPY 174
           +    L+   S    ++  D   G+         G+++G  LA NLG+++GDK+ +++P 
Sbjct: 124 T----LEPQVS----DIGKDMKAGQLGALVPGQFGIVLGDALAGNLGVTVGDKVTLVAPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD- 233
           G +TP GM  R K +TV+G+F     +YD+ +  +++++A+  F + +A +G+ + +KD 
Sbjct: 176 GSITPAGMMPRLKQFTVVGVFESGHYEYDSTLAMINIRDAEALFRM-SAPTGVRLRLKDM 234

Query: 234 ---PD-AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              PD A+E +H      L   + + DW Q+ + +FS  +
Sbjct: 235 QKAPDVAVELSHT-----LSGSLYIRDWTQQNKTWFSAVQ 269


>gi|58038567|ref|YP_190531.1| lipoprotein releasing system transmembrane protein [Gluconobacter
           oxydans 621H]
 gi|58000981|gb|AAW59875.1| Lipoprotein releasing system transmembrane protein [Gluconobacter
           oxydans 621H]
          Length = 416

 Score =  146 bits (368), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 92/267 (34%), Positives = 134/267 (50%), Gaps = 3/267 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F RFE +VA RYL + R   F SI +  S IG+ +GV  LI+VMSVMNGF+ D++ R+L
Sbjct: 1   MFGRFERMVAGRYLRARRGERFASIIAIFSLIGIALGVATLIIVMSVMNGFKADLMGRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G++G + +     P+  Y+     +  +P V  V+P   G   V       SG  ++G+S
Sbjct: 61  GLHGDLTVYGYGRPIEAYENDVAAIRQVPGVKSVIPMAQGTVLVEA-GRFSSGAEMQGVS 119

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
                      S       NDF     V IG  +A   G++IG  I +LSP G  TP G 
Sbjct: 120 QQSLRDWTALSSGIIAGSLNDFTGDNAVAIGTTMADRAGLTIGSPITLLSPDGQATPFGT 179

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPDAIEKTH 241
             R K+Y V  +F   + DY++ +V M L  AQ +  L  +AVS I+V   DP  ++ T 
Sbjct: 180 MPRVKTYHVAVIFDANWNDYNSSIVLMPLPAAQKFLMLGPSAVSLIQVSTADPSNVQPTR 239

Query: 242 ENI-VRILGNGVVVIDWQQRYQIFFSC 267
           + I  R+    + V+DW Q    F   
Sbjct: 240 KAIAARLEDPRLRVLDWTQSANGFLDA 266


>gi|163737416|ref|ZP_02144833.1| DNA topoisomerase IV subunit B [Phaeobacter gallaeciensis BS107]
 gi|161388942|gb|EDQ13294.1| DNA topoisomerase IV subunit B [Phaeobacter gallaeciensis BS107]
          Length = 430

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 94/280 (33%), Positives = 144/280 (51%), Gaps = 18/280 (6%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSRFE ++AWRYL + R    +S+ ++IS IG+ + V ALI  ++V  GFR + +  +LG
Sbjct: 7   FSRFEWLIAWRYLRARRAEGGVSVMTWISLIGIALAVFALIATLAVRTGFRSEFVGTILG 66

Query: 64  INGHVVI---------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +          Q    L +Y  +A     +P VI+  P + GQ   S L    +
Sbjct: 67  ANAHVTLYSHGTVTEQGQIDRKLTEYDALAEAAAAVPGVIRTAPLIKGQVMAS-LRQRSA 125

Query: 115 GVLVRGISNSDFSYLQN--SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           GV V GIS ++ + L          G++S  FD  +GV +G  +AR LG+S+GD+I ++S
Sbjct: 126 GVEVFGISAANIATLPGIAQSEAAIGDLSR-FD--EGVALGSGVARELGVSVGDRIKLIS 182

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R  +Y V+ +F     D D   +YM   EAQ YFN E     IEV V+
Sbjct: 183 PNGVKTAFGTSPRVNAYEVVYIFTAGRYDIDRTRLYMPFAEAQSYFNREGYADEIEVMVE 242

Query: 233 DPDAIEKTHENIVRI---LGNGVVVIDWQQRYQIFFSCYE 269
           DP+ +++    +++    + +G+ V  W+     F    E
Sbjct: 243 DPETVDRMVLPLLQAGDQVTSGIGVWTWRDASGGFLRALE 282


>gi|217970399|ref|YP_002355633.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Thauera sp. MZ1T]
 gi|217507726|gb|ACK54737.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Thauera sp. MZ1T]
          Length = 418

 Score =  145 bits (367), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 147/268 (54%), Gaps = 9/268 (3%)

Query: 7   FEVIVAWRYLFSNRK----NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +E++V  RY  S ++    N FIS  S +S  G+ +GV ALIVV+SVMNGF+E++  R+L
Sbjct: 3   YEILVGLRYTRSRKRAQGRNRFISFISLVSMFGIALGVAALIVVLSVMNGFQEELRTRIL 62

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  HV +Q     L+ +Q +A+     P V    P+V  Q  +S    G  G LVRG+ 
Sbjct: 63  GVASHVQVQSPEGGLMAWQQVADESLRNPSVRAAAPYVQEQGMLS-FDEGVRGTLVRGVI 121

Query: 123 NSDFSYLQNSFSRFYGNVSND-FDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
            S    + + F R+    S D    G+ G+++G+DLA  L + +G+K+ +++P G VTP 
Sbjct: 122 PSAEEKVAD-FGRYMQAGSFDALQAGRFGIVLGRDLAAALRVRLGEKVTLIAPQGLVTPA 180

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
            +  R K + V+G+F     +YD+ +  + + +AQ  + L +AVSG+ + + D  A  + 
Sbjct: 181 AVLPRVKQFEVVGIFEAGMYEYDSSLALVHIADAQALYRLGDAVSGVRLKLDDLFAAPRV 240

Query: 241 HENIVRILGN-GVVVIDWQQRYQIFFSC 267
              +   +   G+VV DW + +  FF  
Sbjct: 241 ARELAMTISEPGLVVADWTRSHANFFRA 268


>gi|295676929|ref|YP_003605453.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia sp. CCGE1002]
 gi|295436772|gb|ADG15942.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia sp. CCGE1002]
          Length = 417

 Score =  145 bits (367), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 84/267 (31%), Positives = 143/267 (53%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMSGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + ++Q  A        VI   P+V  QA ++      SGV +RGI  
Sbjct: 65  VLAHVEIFSPTGSMPEWQLTAKEARQNQQVIGAAPYVEAQALLTR-QDAVSGVALRGIEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +    + +      G   +D   G  G+++G DLA NLG+ + DKI +++P G +TP GM
Sbjct: 124 TLEPEVSDIGKEMKGGKLSDLVPGDFGIVLGADLAANLGVQLNDKITLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  +++++AQ  F L  A +G+ + + D     +   
Sbjct: 184 LPRLKQFTVVGIFESGHYEYDSTLALINIKDAQALFRLP-APTGVRLRLTDMQRAPEVAH 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + R L   + + DW Q+ + +FS  +
Sbjct: 243 QLARTLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|294011728|ref|YP_003545188.1| ABC-type transport system permease component [Sphingobium japonicum
           UT26S]
 gi|292675058|dbj|BAI96576.1| ABC-type transport system permease component [Sphingobium japonicum
           UT26S]
          Length = 408

 Score =  145 bits (367), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 87/259 (33%), Positives = 129/259 (49%), Gaps = 2/259 (0%)

Query: 10  IVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVV 69
           ++A RYL   +   FI + + IS + VM+GV ALI+VMSVMNGFR ++  +++G+NGH V
Sbjct: 1   MIARRYLLPGKGEGFIFLVAGISLVAVMLGVAALIIVMSVMNGFRAELFDKIVGLNGHAV 60

Query: 70  IQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYL 129
           +Q     L D++ +       P V    P +  Q  +         VLVRG++ +D    
Sbjct: 61  VQGYGGRLPDWKAVLKEAKATPGVTSATPLIE-QPLLGSFQGRVEAVLVRGMTVNDIRNN 119

Query: 130 QNSFSRFY-GNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKS 188
               ++   GN+      G  V IG  LA NLGI +GD + I++P G  TP G   R  S
Sbjct: 120 ATLKAKVVAGNLGALTPNGGKVAIGSRLAENLGIQLGDSLTIINPAGRSTPFGTVPRQVS 179

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL 248
           Y V  +F +   DYD   V M +++AQ    L + VS IEV   + D +    E +   +
Sbjct: 180 YQVAAIFEVGIYDYDKAFVVMPVEDAQTLLLLGDVVSMIEVETINADQVSAILEPLAGKV 239

Query: 249 GNGVVVIDWQQRYQIFFSC 267
               +V DW+Q     F  
Sbjct: 240 AGRAIVTDWRQMNASLFEA 258


>gi|51473878|ref|YP_067635.1| hypothetical protein RT0694 [Rickettsia typhi str. Wilmington]
 gi|51460190|gb|AAU04153.1| conserved hypothetical protein [Rickettsia typhi str. Wilmington]
          Length = 415

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 97/267 (36%), Positives = 148/267 (55%), Gaps = 5/267 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           I + F   +A RY  + +   F+SI S  S +GVMIGV ALIVVMSVMNGF  ++ K ++
Sbjct: 2   INNNFSFNIALRYFRAKKNEKFVSIISAFSLVGVMIGVAALIVVMSVMNGFHLELTKNII 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVS-GQAFVSGLSSGGSGVLVRGI 121
           G+NG ++I ++   + +Y+ I   L    + IK + +++ GQA   G  S  SGVL++GI
Sbjct: 62  GLNGDIIINRQGGNIDNYEEIKTTL-LKQNYIKHVTYIAHGQALALG-KSNNSGVLIKGI 119

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDVTPM 180
             +D S L+N   +     S D   GK VI +G+ LA NLG+++G+K+ ++SP    T  
Sbjct: 120 KLNDLS-LRNGIFKNVNFGSFDNFHGKNVIALGEQLASNLGVTVGEKLRLISPNSVSTAF 178

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G   RSK + ++ +F     DYD   + M L  AQ + +L N ++ IE+   DPD   + 
Sbjct: 179 GSIPRSKEFEIIAIFNSGMYDYDLTTILMPLTAAQNFLSLGNDINSIEINSLDPDQAIQY 238

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSC 267
              I  +LG  + V +WQ     F S 
Sbjct: 239 SYKIQSLLGPNLYVFNWQTLNSQFLSA 265


>gi|15604541|ref|NP_221059.1| hypothetical protein RP699 [Rickettsia prowazekii str. Madrid E]
 gi|3861235|emb|CAA15135.1| unknown [Rickettsia prowazekii]
 gi|292572333|gb|ADE30248.1| Lipoprotein releasing system,transmembrane protein, LolC/E family
           protein [Rickettsia prowazekii Rp22]
          Length = 415

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 97/267 (36%), Positives = 148/267 (55%), Gaps = 5/267 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           I + F   +A+RY  + +   F+SI +  S +GVMIGV ALIVVMSVMNGF  ++ K ++
Sbjct: 2   INNNFSFNIAFRYFRAKKNEKFVSIIAAFSLVGVMIGVAALIVVMSVMNGFHLELTKNII 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVS-GQAFVSGLSSGGSGVLVRGI 121
           G+NG +VI ++   + +Y+ I   L    D +K + +++ GQA   G  S  SGVLV+GI
Sbjct: 62  GLNGDIVINRQGDNIDNYEEIKTTL-LKQDYVKHVTYIAHGQALALG-KSNNSGVLVKGI 119

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDVTPM 180
             +D S L+N   +     S D   GK VI +G+ LA NLG+++G+K+ ++SP    T  
Sbjct: 120 KLNDLS-LRNGIFKNVNFGSFDNFHGKNVIALGEQLASNLGVTVGEKLRLISPNSVSTAF 178

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G   RSK + ++ +F     DYD   + M L  AQ + +L N ++ IE+   DPD     
Sbjct: 179 GSIPRSKEFQIIAIFNSGMYDYDLTTILMPLTAAQNFLSLGNDINSIEINSLDPDQAITY 238

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSC 267
              I  +LG  + V +W+     F S 
Sbjct: 239 SYKIQSLLGPNLYVFNWKTLNSQFLSA 265


>gi|124514752|gb|EAY56264.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Leptospirillum rubarum]
          Length = 412

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 97/279 (34%), Positives = 150/279 (53%), Gaps = 22/279 (7%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           I  RFE  VA RYL SNR++  +S+ + IS  GV +GV AL+  ++VM GF+  +  ++L
Sbjct: 2   IPGRFEWKVAIRYLRSNRRSRTLSLQTIISVSGVTVGVAALMATLAVMTGFQHKLRSKIL 61

Query: 63  GINGHVVIQQ-KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVR 119
           G+N H+V+   +  P+   + I   +  IP V+ V PF+ GQA    LS G   SG ++R
Sbjct: 62  GVNSHIVLTDGRGAPMDHPEEIEKEVRKIPGVLHVAPFILGQAM---LSEGKTVSGAVLR 118

Query: 120 GISNSDFSYLQNSFSRF-----YGNVSNDFDRG-----KGVIIGKDLARNLGISIGDKIN 169
           GIS SD    +N  +RF      G +S D DR       G+++G+DLA  L + IGD ++
Sbjct: 119 GISPSD----ENKVTRFERYMVRGRLS-DLDRPANAHRPGIVLGEDLADRLNVDIGDTVD 173

Query: 170 ILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIE 228
           ++SP G ++  GM  + + + V+G+FR    +YDN +  +SL E+  +  L + +VSG+E
Sbjct: 174 VISPNGTMSAFGMVPKIRHFAVVGIFRSGLYEYDNTLALLSLPESARFLGLPQGSVSGLE 233

Query: 229 VFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
           + V            I   LG       W Q  +  FS 
Sbjct: 234 IQVSHIMQASHISREIATRLGYPYWPRSWLQMNRNLFSA 272


>gi|220934538|ref|YP_002513437.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995848|gb|ACL72450.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 415

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 86/273 (31%), Positives = 144/273 (52%), Gaps = 10/273 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F   E+ +  RY  + R+N FIS  S IS  G+ +GV ALI V+SVMNGF +++ +R+L
Sbjct: 1   MFRPLELYIGLRYTRAKRRNHFISFISLISMAGIALGVTALITVLSVMNGFEKELRERIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I      L D+Q +A R++  P V+   P++  +  + G     SG L+RGI 
Sbjct: 61  GMVSHATISDFSGRLADWQTLAARIEGEPRVLGAAPYIQAEGMLQG-QGQVSGALIRGI- 118

Query: 123 NSDFSYLQNSFSRFYGNV---SNDFDRGK--GVIIGKDLARNLGISIGDKINILSPYGDV 177
                  +   SR   ++   S +  RG   GV++GK+LA +LG  +GD++ +++P   V
Sbjct: 119 ---LPEREKHVSRVAEHIKFGSMEALRGGEYGVVLGKELAASLGAGVGDRVTLVTPQATV 175

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           TP G+  R +   V+G+F +   +YD    +M L +A+  F  E+ V+G+ + + D    
Sbjct: 176 TPAGVMPRLRRLLVVGVFEVGMYEYDRSTAFMHLDDARRVFQYEDNVTGLRLKMDDMMRA 235

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYES 270
                ++   LG    V DW +++  FF    +
Sbjct: 236 PFIARDVADRLGGRYWVSDWTRQHANFFRAVRT 268


>gi|253996014|ref|YP_003048078.1| LolC/E family lipoprotein releasing system transmembrane protein
           [Methylotenera mobilis JLW8]
 gi|253982693|gb|ACT47551.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylotenera mobilis JLW8]
          Length = 422

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 87/270 (32%), Positives = 143/270 (52%), Gaps = 8/270 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+ V WRY  + RKN FIS  S  S IG+ +GV ALIVV+SVMNGF++++  R+LG+  
Sbjct: 6   YELFVGWRYTRAKRKNHFISFISLTSMIGIALGVAALIVVLSVMNGFQKELRTRILGVAS 65

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+ +      L D+Q +A      P+V    P++S QA +S    G  G +VRG+  +  
Sbjct: 66  HLEVTGGGNQLSDWQSVAAFAARQPNVQASAPYISAQAMLS-YDQGVQGAIVRGVIPNAE 124

Query: 127 SYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIR 185
             + +           D   G+ G+++G DLA+ LG  IGDK+ +++P G  TP G+  R
Sbjct: 125 DQVADLGKHMKVGRLEDLRAGEFGIVLGVDLAQALGAQIGDKVVLMAPQGQFTPTGVVPR 184

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIV 245
            K +T++G+F++   +YD G+  + + +A   + + + VSG+ + + D         NI 
Sbjct: 185 LKQFTLVGLFQIGMYEYDAGLALIHMDDAAKLYRMGDKVSGVRLKLADLFDAPAVAANIS 244

Query: 246 RILGNGV------VVIDWQQRYQIFFSCYE 269
             L           V DW +++  FF   +
Sbjct: 245 DQLNAQANRTGDYYVSDWTRQHANFFRAVQ 274


>gi|330817649|ref|YP_004361354.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Burkholderia gladioli BSR3]
 gi|327370042|gb|AEA61398.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Burkholderia gladioli BSR3]
          Length = 417

 Score =  145 bits (366), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 142/267 (53%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIAAVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  AN     P+VI   P+V  QA ++      SGVL+RG+  
Sbjct: 65  VLAHVEIFSPTGSMPDWQLTANEARRNPEVIGSAPYVEAQALLTR-QDAVSGVLLRGVDP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
                + +               G+  V++G  LA NLG+S+GDK+ +  P G VTP GM
Sbjct: 124 KLEPQVTDIAKDMKAGSLAALQPGQFDVVLGTALASNLGVSVGDKVTMFVPEGTVTPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R + +TV+G+F     +YD+ +  + +Q+AQ  F L  A +G+ + +KD     +   
Sbjct: 184 LPRVRQFTVVGIFESGHYEYDSTLAMIDIQDAQKLFRLP-APTGVRLRLKDMQRAPEVAV 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   L   + + DW Q+ + +FS  +
Sbjct: 243 QLSHSLSGDLYIRDWTQQNKTWFSAVK 269


>gi|323526604|ref|YP_004228757.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia sp. CCGE1001]
 gi|323383606|gb|ADX55697.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia sp. CCGE1001]
          Length = 417

 Score =  145 bits (365), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 145/267 (54%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMSGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + ++Q  A       +VI   P+V  QA ++      SGV +RG+  
Sbjct: 65  VLAHVEIFSPTGSMPNWQLTAQEARQNKEVIGAAPYVEAQALLTR-QDAVSGVALRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +    + +      G    +   G+ G+++G DLA NLG+++ DKI +++P G +TP GM
Sbjct: 124 TLEPQVSDIGKEMKGGKLTNLVPGEFGIVLGADLATNLGVAVNDKITLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  +++++AQ  F L  A +G+ + + D     +   
Sbjct: 184 LPRLKQFTVVGIFESGHYEYDSTLALINIKDAQALFRLP-APTGVRLRLVDMQRAPEVAH 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + R L   + + DW Q+ + +FS  +
Sbjct: 243 QLARTLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|221068827|ref|ZP_03544932.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Comamonas testosteroni KF-1]
 gi|220713850|gb|EED69218.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Comamonas testosteroni KF-1]
          Length = 417

 Score =  145 bits (365), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 91/268 (33%), Positives = 144/268 (53%), Gaps = 8/268 (2%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ V WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YELAVGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVI-QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  HV I   +  PL D           PDV+   PFV+ QA ++       G LVRGI 
Sbjct: 65  VVSHVEIYAPQGAPLPDVVRTMREARANPDVVGAAPFVAAQALLAR-GEDMKGALVRGID 123

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +    + +  +   G V      G+  V++G +LAR+LG+S GD I +++P G VTP G
Sbjct: 124 PAREGEVTD-LAATSGEVLKRLVPGEFKVVLGIELARSLGVSEGDVITLIAPSGQVTPAG 182

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R K  TV G F     +YD+ +V M  ++AQ  F LE   +GI + +KD     +  
Sbjct: 183 VLPRMKQMTVAGTFDSGHYEYDSALVMMHYEDAQRIFRLEGP-TGIRLKLKDLHEAPRVA 241

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +   L + + + DW Q+ + +F+  +
Sbjct: 242 HELADTLTDRLFIRDWTQQNKTWFAAVQ 269


>gi|126739184|ref|ZP_01754878.1| lipoprotein releasing system transmembrane protein LolE
           [Roseobacter sp. SK209-2-6]
 gi|126719801|gb|EBA16509.1| lipoprotein releasing system transmembrane protein LolE
           [Roseobacter sp. SK209-2-6]
          Length = 428

 Score =  144 bits (364), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 87/245 (35%), Positives = 132/245 (53%), Gaps = 13/245 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+RFE ++AWRYL + R    IS+ + IS +G+ + V ALI  ++V +GFR + +  +LG
Sbjct: 8   FARFEWMIAWRYLRARRAEGGISVMTVISLVGITLAVFALIATLAVRSGFRSEFVGTILG 67

Query: 64  INGHVVI---------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV I          Q    L D+  +A R+  +P V +  P +  Q   +      +
Sbjct: 68  ANAHVSIYAHGELNAAGQFERNLTDFDAMAERVAAVPGVTRAAPLIKRQVMANA-GQRNA 126

Query: 115 GVLVRGISNSDFSYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINILSP 173
           GV V GIS +    +    ++  G++  D DR  +GV IG  +AR LG+++GDKI ++SP
Sbjct: 127 GVQVFGISKTGVQTIPG-VAQSDGSI-GDLDRFEEGVAIGSGVARELGVTVGDKIKLISP 184

Query: 174 YGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
            G  TP G   R  +Y V+ +F     D D   +YM   EAQ YFN E     IEV V++
Sbjct: 185 NGVKTPFGTSPRVSAYEVVYVFTAGRYDIDKTRLYMPFAEAQSYFNREGFADEIEVMVEN 244

Query: 234 PDAIE 238
           P+A++
Sbjct: 245 PEAVD 249


>gi|256831143|ref|YP_003159871.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfomicrobium baculatum DSM 4028]
 gi|256580319|gb|ACU91455.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfomicrobium baculatum DSM 4028]
          Length = 409

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 86/249 (34%), Positives = 145/249 (58%), Gaps = 7/249 (2%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
            FE+ V+ RYL + RK AFIS+ S IS +GV IGV +LIVV+ VMNGF E++  ++LGIN
Sbjct: 2   HFELFVSLRYLLARRKQAFISVISLISVLGVAIGVASLIVVLGVMNGFSENLRDKILGIN 61

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
            H+++      + +Y  +  +   +  V+   PF+  +  +S   SG  GV++RG+S   
Sbjct: 62  SHLILGSVKQTIGNYDQLVQKSLQVDGVVAATPFIYYEVMLS-TPSGVKGVVLRGVSPQS 120

Query: 126 ----FSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
                S  ++  S    +++ + D   G++IGK+LA  LG+++G ++++L+P G  +  G
Sbjct: 121 AGTVLSVEKDLISGSLADLAGNGDT-PGIVIGKELASRLGLTLGSRLSLLAPSGKKSAAG 179

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEKT 240
              +   + V+G+F     +YD+ + ++S+ EAQ     E + V+GIE  V D D ++K 
Sbjct: 180 FSPKIVFFNVVGIFSSGMFEYDSSLAFVSIPEAQKILGFEGDFVTGIEYKVSDIDGVQKI 239

Query: 241 HENIVRILG 249
            E +VR LG
Sbjct: 240 GEALVRALG 248


>gi|107028706|ref|YP_625801.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia cenocepacia AU 1054]
 gi|116690135|ref|YP_835758.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia cenocepacia HI2424]
 gi|206560548|ref|YP_002231313.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia cenocepacia J2315]
 gi|105897870|gb|ABF80828.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia cenocepacia AU 1054]
 gi|116648224|gb|ABK08865.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia cenocepacia HI2424]
 gi|198036590|emb|CAR52487.1| putative lipoprotein releasing system transmembrane protein
           [Burkholderia cenocepacia J2315]
          Length = 417

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 149/275 (54%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV +      + D+Q  A      P VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEVFSPTGSMPDWQLTAQEARRNPSVIGAAPYVDAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPY 174
           S    L+   S    ++  D   G+         G+++G  LA NLG+++GDK+ +++P 
Sbjct: 124 S----LEPQVS----DIGKDMKAGQLGALVPGQFGIVLGDALAGNLGVTVGDKVTLVAPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G +TP GM  R K +TV+G+F     +YD+ +  +++++A+  F + +A +G+ + + D 
Sbjct: 176 GSITPAGMMPRLKQFTVVGVFESGHYEYDSTLAMINIRDAEALFRM-SAPTGVRLRLTDM 234

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    +   L   + + DW Q+ + +FS  +
Sbjct: 235 QKAPQVAVELSHTLSGSLYIRDWTQQNKTWFSAVQ 269


>gi|307729223|ref|YP_003906447.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia sp. CCGE1003]
 gi|307583758|gb|ADN57156.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia sp. CCGE1003]
          Length = 417

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 145/267 (54%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMSGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + ++Q  A       +VI   P+V  QA ++      SGV +RGI  
Sbjct: 65  VLAHVEIFSPTGSMPNWQLTAQEARQNKEVIGAAPYVEAQALLTR-QDAVSGVALRGIEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +    + +      G    +   G+ G+++G DLA NLG+++ D+I +++P G +TP GM
Sbjct: 124 TLEPQVSDIGKEMKGGKLTNLVPGEFGIVLGADLATNLGVTVNDRITLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  +++++AQ  F L  A +G+ + + D     +   
Sbjct: 184 LPRLKQFTVVGIFESGHYEYDSTLALINIKDAQALFRLP-APTGVRLRLADMQRAPEVAH 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + R L   + + DW Q+ + +FS  +
Sbjct: 243 QLARSLSGDLYIRDWTQQNKTWFSAVQ 269


>gi|294084091|ref|YP_003550849.1| ABC transporter permease [Candidatus Puniceispirillum marinum
           IMCC1322]
 gi|292663664|gb|ADE38765.1| ABC-type transport system, permease component [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 418

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 135/265 (50%), Gaps = 2/265 (0%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS  E ++A RY+ + R   FIS+ ++ S  G+ +GV  LI+VMSVMNGFR +++ R+LG
Sbjct: 5   FSPVERMLALRYMRARRAEGFISVIAWFSLAGITLGVATLIIVMSVMNGFRAELVDRILG 64

Query: 64  INGHVVI-QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +NGHV I   +   + +Y  +A  +  +P VI V P + GQ   +  ++   G ++RG+ 
Sbjct: 65  LNGHVAIYSTEGNGIKNYDDLALSITDMPGVIAVTPQIEGQVMATK-NAVSLGAVIRGVR 123

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
            SD +  +  +          F    GV+IGK +A   GI  G  I + +  G  T  G 
Sbjct: 124 WSDLAARKPLWDSLDDKAIASFRDDGGVLIGKTMAFKTGIVPGGTITLTTARGKATAFGT 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
               +S+ V G+F +   +YD   ++M L  A  +  L  +VSG+E++V DP  I     
Sbjct: 184 LPTRRSFKVAGIFDVGMHEYDTSFIFMPLDVAGEFLGLPTSVSGLEIYVDDPQNIAFYRA 243

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSC 267
            I   L   +   DW  R + F + 
Sbjct: 244 TIASTLTKNLRAFDWLDRNKSFLNA 268


>gi|300691903|ref|YP_003752898.1| outer membrane-specific lipoprotein transporter subunit ; membrane
           component of ABC superfamily [Ralstonia solanacearum
           PSI07]
 gi|299078963|emb|CBJ51623.1| outer membrane-specific lipoprotein transporter subunit ; membrane
           component of ABC superfamily [Ralstonia solanacearum
           PSI07]
          Length = 416

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/268 (30%), Positives = 149/268 (55%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  ++++   N+FIS  S IS +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRASKRASRNSFISFISLISMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ I      L D+Q  AN      +V+   P+V  QA ++       GVL+RG+S 
Sbjct: 65  VLSHIEIMAPAS-LPDWQRTANEAMQNKEVVGAAPYVGAQAMITR-DEAVRGVLLRGVSP 122

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +D   + +    F     +D   G+ G+++G +LAR LG+  GDK+ +++P G +TP G+
Sbjct: 123 ADEPKVSDIAKDFKSGSIDDLKPGEFGIVLGSELARGLGVRQGDKVTLVAPQGTITPAGV 182

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV G F     ++D+ +  + + +A+  F L+   +G+ + + D     +  E
Sbjct: 183 LPRMKQFTVTGTFESGHYEFDSSLALIHIDDAERLFRLDGP-TGVRLKLVDMQRAPQVAE 241

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYES 270
            + R L   + + DW ++ + +F+  ++
Sbjct: 242 ALSRTLTGELYIRDWSRQNKNWFAAVQT 269


>gi|117924340|ref|YP_864957.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Magnetococcus sp. MC-1]
 gi|117608096|gb|ABK43551.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Magnetococcus sp. MC-1]
          Length = 413

 Score =  144 bits (364), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 144/268 (53%), Gaps = 8/268 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +FS FE  V  RYL + R   FIS  + +S  G+ +GV ALIVV++VM GF+ ++ +++L
Sbjct: 1   MFSSFEWRVGLRYLRAKRSQRFISAITALSVAGIALGVAALIVVLAVMTGFQGELQRQIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  HVV+Q     + D + +  ++   P+V    PFV   A +    +GG   G+ +RG
Sbjct: 61  GVVSHVVVQSYGGSMEDVEGVLRKVQSRPNVTGAAPFVLANALIY---NGGQAYGIALRG 117

Query: 121 ISNSDFSYLQN-SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +       + N   +   G+V+     G GV++G+ LARNLG+ + D+I ++ P G+VTP
Sbjct: 118 VDPEREKGVSNLHVNMVRGDVAAM--AGFGVVLGESLARNLGVGLNDRITLMVPKGNVTP 175

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G   R K + V G+F     +YD  + Y+ + +AQ    L  +V+GIEV    PD    
Sbjct: 176 AGTVPRVKRFRVAGIFDSGMHEYDTNLAYIHINDAQKLLRLGESVTGIEVKTPHPDLAMG 235

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSC 267
             +++ + L     + DW Q  + FF+ 
Sbjct: 236 VRQDLEKQLSGHFWIRDWMQMNRNFFNA 263


>gi|149184690|ref|ZP_01863008.1| ABC-type transport system [Erythrobacter sp. SD-21]
 gi|148832010|gb|EDL50443.1| ABC-type transport system [Erythrobacter sp. SD-21]
          Length = 413

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 85/267 (31%), Positives = 132/267 (49%), Gaps = 3/267 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           + S FE  +A RYL   R  AFI++ + IS   VM+ V  L++VMSVMNGFR +++ +++
Sbjct: 2   LLSPFERTIAKRYLLPGRSEAFIALVAGISITVVMLSVAMLVIVMSVMNGFRAELLDKIV 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NGH ++Q     L D++ +   +   P V++  P +  Q  ++  +     +L+RG +
Sbjct: 62  GLNGHAIVQAYGGRLDDWENVLEEVRQTPGVVEASPLIE-QPLLTTFNGRVEAILLRGNT 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
            +D   L        GN+         V IG  LA N+G  +GD I I++P G  TP G 
Sbjct: 121 QADIRELGEKV--VSGNMDALQPGASKVAIGVRLAENIGARVGDTITIINPQGRSTPFGT 178

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R   Y V  +F +   DYD   V M +Q+AQ      + +  IEV V DPD + +   
Sbjct: 179 VPRQVGYEVAAIFEVGVYDYDGAFVVMPMQDAQTLLLSGDRIGMIEVQVTDPDEVGEILA 238

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   L    VV DW+      F   +
Sbjct: 239 PVQESLAGRAVVRDWKTINATLFEALQ 265


>gi|329114695|ref|ZP_08243454.1| Lipoprotein-releasing system transmembrane protein LolC
           [Acetobacter pomorum DM001]
 gi|326696175|gb|EGE47857.1| Lipoprotein-releasing system transmembrane protein LolC
           [Acetobacter pomorum DM001]
          Length = 415

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 83/270 (30%), Positives = 142/270 (52%), Gaps = 6/270 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F  FE  VA RYL + R   F+S+ +  S +G+ +GV  LI+VM+VMNGF+ D++ R+L
Sbjct: 1   MFGPFERAVAGRYLRARRGERFVSVIAIFSLVGIALGVATLIIVMAVMNGFQADLMGRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRG 120
           G+NG + I  +   +  Y+ I +++  +P V+  +P V GQ     LS+G   SG +V G
Sbjct: 61  GLNGDLTIYGQGRTISQYEDITHKVRSVPGVVSAIPLVEGQVL---LSAGAYNSGGMVHG 117

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           ++      L+   S       +DF     +++G  +A   G+ IG  + ++SP G  T  
Sbjct: 118 LTPQGLRDLKAVSSSIIAGSLDDFGPDDSIVVGVTMAERAGLGIGSGLTLVSPDGAATAF 177

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G   R + Y V+ +F     DY++ +V++ +  AQ+YF + N  + I+V  KD + +   
Sbjct: 178 GTVPRVRRYRVVAIFDAGVNDYNSSVVFLPMHAAQIYFQMPNKATQIQVMTKDAEHVRPV 237

Query: 241 HENIVRILGN-GVVVIDWQQRYQIFFSCYE 269
              I   +G+ G+ V+DW       F   +
Sbjct: 238 TLAIENAVGDPGLRVLDWTNANNALFGAVQ 267


>gi|58616806|ref|YP_196005.1| lipoprotein releasing system transmembrane protein lolC [Ehrlichia
           ruminantium str. Gardel]
 gi|58416418|emb|CAI27531.1| Lipoprotein releasing system transmembrane protein lolC [Ehrlichia
           ruminantium str. Gardel]
          Length = 411

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 98/271 (36%), Positives = 146/271 (53%), Gaps = 18/271 (6%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           +FE+++A RYL SNR     S+ + +SFIG+ +GV  LI+VMSVMNGF E ++  ++G+N
Sbjct: 4   KFELMLALRYLQSNRSQFLCSMITMLSFIGITLGVATLIIVMSVMNGFGEKLLNCIVGVN 63

Query: 66  GHVVIQ-QKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
           G V I         +Y  +A  +  IP VI  +P    QA      S  SG++VRGIS  
Sbjct: 64  GQVAIYFNNNEKDTNYHDVAKLIKDIPGVIDAIPITENQAMAKSEQS-VSGIIVRGISKQ 122

Query: 125 DF---SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
           D    + + ++  R  GN+S   D   G++IG  LA  L ++ GDKI ILS     T +G
Sbjct: 123 DLLRKNIIADNIVR--GNIS---DLDNGIVIGIKLAEILNVNYGDKITILSSDSIPTVIG 177

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD---PDAIE 238
              R KSY V+ +F +   +YD+ +VYM L  +QL+F+  N V  IEV + D      I 
Sbjct: 178 SIPRMKSYKVIAVFDLGMYEYDSTLVYMPLHSSQLFFHYGNRVHNIEVSIDDINRSSEIL 237

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           K  E+   + G      DW+ +   +F+  +
Sbjct: 238 KLIEDKTSMKGE-----DWKMQQGSYFNALK 263


>gi|237748452|ref|ZP_04578932.1| outer membrane lipoproteins ABC transporter membrane protein
           [Oxalobacter formigenes OXCC13]
 gi|229379814|gb|EEO29905.1| outer membrane lipoproteins ABC transporter membrane protein
           [Oxalobacter formigenes OXCC13]
          Length = 422

 Score =  144 bits (363), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 96/277 (34%), Positives = 156/277 (56%), Gaps = 9/277 (3%)

Query: 1   MSIFSR--FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFRE 55
           M+IFS   FE +V  RY+ S ++   N FIS  S IS  G+ +GV ALI+VMSVMNGF++
Sbjct: 1   MNIFSNLPFEWLVGLRYIRSGKRSGRNRFISFISLISMSGIALGVAALIIVMSVMNGFQK 60

Query: 56  DMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSG 115
           ++  R+L +  H+ IQ  Y  L D+Q  A  +   P+V    P+V GQA V+  +    G
Sbjct: 61  EVRDRMLSVIPHIEIQDMYGSLPDWQKTAAEVKKNPEVTGAAPYVVGQAMVT-RNDMVRG 119

Query: 116 VLVRGISNSDFSYLQNSFSRF-YGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPY 174
           V+VRGI   + + + +   +F  G + N       + IG +LARNL I  GDK+ ++ P 
Sbjct: 120 VIVRGIDPKEEAGVSDIARQFKAGKLGNLEPDSFNIAIGSELARNLRIGPGDKLTVIIPQ 179

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G VTP G+  R K +TV G+F     ++D+   ++++ +A   F   +A SG+ V ++D 
Sbjct: 180 GQVTPAGVLPRLKQFTVGGIFEAGHFEFDSTFAFINMNDAMRLFR-TDAPSGLRVQIRDM 238

Query: 235 DAIEKTHENIVRILGN-GVVVIDWQQRYQIFFSCYES 270
               +  + +  +L N  V+V DW ++ + +F+  ++
Sbjct: 239 QEAPEVAQQLSMMLQNDDVIVRDWSKQNRNWFAAVKT 275


>gi|134296295|ref|YP_001120030.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia vietnamiensis G4]
 gi|134139452|gb|ABO55195.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia vietnamiensis G4]
          Length = 417

 Score =  144 bits (362), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 148/275 (53%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV +      + D+Q  A      P VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEVFSPTGSMPDWQLTAQEARRNPSVIGAAPYVDAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPY 174
           S    L+   S    ++  D   G+         G+++G  LA NLG+++GDK+ +++P 
Sbjct: 124 S----LEPQVS----DIGKDMKAGRLDALVPGQFGIVLGDALAGNLGVTVGDKVTLVAPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G +TP GM  R K +TV+G+F     +YD+ +  + +++A+  F + +A +G+ + + D 
Sbjct: 176 GTITPAGMMPRLKQFTVVGVFESGHYEYDSTLAMIDIRDAEALFRM-SAPTGVRLRLSDM 234

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    +   L   + + DW Q+ + +FS  +
Sbjct: 235 QKAPQVAIELSHTLSGSLYIRDWTQQNKTWFSAVQ 269


>gi|329903720|ref|ZP_08273596.1| Lipoprotein releasing system transmembrane protein LolC
           [Oxalobacteraceae bacterium IMCC9480]
 gi|327548241|gb|EGF32940.1| Lipoprotein releasing system transmembrane protein LolC
           [Oxalobacteraceae bacterium IMCC9480]
          Length = 421

 Score =  144 bits (362), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 89/278 (32%), Positives = 154/278 (55%), Gaps = 12/278 (4%)

Query: 1   MSIFSR--FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFRE 55
           MSI     FE +V  RY  + R+   N+FIS  S IS  G+ +GV ALIVV+SVMNGF++
Sbjct: 1   MSILKNLPFEWLVGIRYTRAGRRSGRNSFISFISLISMAGIALGVAALIVVLSVMNGFQK 60

Query: 56  DMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG-- 113
           ++  R+L +  H+ +      L D++  A       +V    P+V+GQA    ++  G  
Sbjct: 61  EVRDRMLSVLPHIEVFDPVNGLTDWKATAKEAFLDKEVKGAAPYVAGQAM---MTRDGVL 117

Query: 114 SGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILS 172
            GV+VRG+  S+ S +    ++       D   G+  +++G +LAR L   IGD++ ++S
Sbjct: 118 RGVIVRGVLPSEESNVSEVAAQVRQGKFTDLRPGEFNIVLGGELARALSAGIGDRVTLVS 177

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G VTP G+  R K++TV+G+F     +YD+ + +M + +A+  F L NA +G+ + + 
Sbjct: 178 PEGQVTPAGVVPRYKAFTVVGIFEAGHYEYDSTLAFMHIDDAEKMFRL-NAPTGVRLRID 236

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES 270
           D         ++ RI+   V++ DW ++ + +F+  ++
Sbjct: 237 DMQRAPLVARDLSRIMTGNVLISDWSKQNKTWFAAVQT 274


>gi|74317779|ref|YP_315519.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Thiobacillus denitrificans ATCC 25259]
 gi|74057274|gb|AAZ97714.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Thiobacillus denitrificans ATCC 25259]
          Length = 414

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 145/268 (54%), Gaps = 14/268 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E++V  RY  + R+N FIS  S +S  G+ +GVMALIVV+SVMNGF+E++  R+LG+  
Sbjct: 4   LELLVGLRYTHAKRRNHFISFISVVSMGGIALGVMALIVVLSVMNGFQEELRARILGVAA 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGISNS 124
           H+ I      L D++ +  +     DV+   P+V+ Q     L++G    G ++RGI   
Sbjct: 64  HLEISGPGDRLADWRSVLAQAQRNKDVVSGAPYVNAQGM---LANGDMVRGAIIRGIVPG 120

Query: 125 DFSYLQNSFSRFYGNVS----NDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
               ++N+ + F  ++      D   G+ G+I+G +LAR L +  GDK+ +L+P G++TP
Sbjct: 121 ----MENAVADFSRHMKAGRLTDLKPGEFGIILGGELARALNVFPGDKLVLLTPQGNITP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G+  R K +TV G+F     +YD+G+  + LQ+AQ    L   VSG+ + + +      
Sbjct: 177 AGVMPRVKQFTVTGIFEAGMFEYDSGLALIHLQDAQKLLRLGQDVSGVRLKLDELFRAPF 236

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSC 267
               + + L     + DW Q +  FF  
Sbjct: 237 VTRELAQTLTGDYYLTDWTQSHANFFRA 264


>gi|254465760|ref|ZP_05079171.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodobacterales bacterium Y4I]
 gi|206686668|gb|EDZ47150.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodobacterales bacterium Y4I]
          Length = 428

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 136/277 (49%), Gaps = 15/277 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSRFE I+AWRYL + +    +S+ ++IS IG+ + V ALI  ++V +GFR + +  +LG
Sbjct: 8   FSRFEWIIAWRYLRARKAEGGVSVMTWISLIGITLAVFALIATLAVRSGFRSEFVGTILG 67

Query: 64  INGHVVIQQKY---------YPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +               L DY+ +A  +  +P V +  P V GQ  ++ L    +
Sbjct: 68  ANAHVTVYSYGEVNEAGVLDRSLKDYEALAETVAAVPGVTRAAPLVKGQ-VMANLRQRNA 126

Query: 115 GVLVRGISNSDFSYLQN--SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           GV V GIS  D   +          G+++   D   G+ IG  +AR LG+S+GDKI ++S
Sbjct: 127 GVEVFGISAKDIQGIPGVAQSEESVGDLARFED---GIAIGSGVARELGVSVGDKIKLIS 183

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R  +Y V+ +F     D D   VY+   EAQ +FN E     IEV V 
Sbjct: 184 PNGVKTAFGTSPRVNAYEVVYVFTAGRWDIDRTRVYLPFAEAQAFFNREGVADEIEVMVG 243

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +P+  +    +I +  G    V  W+     F    E
Sbjct: 244 NPENADALALDIQQAAGGTAGVWTWRDASGGFLRALE 280


>gi|111073630|emb|CAL29492.1| hypothetical protein OW2-F [Wolbachia endosymbiont of Onchocerca
           volvulus]
          Length = 409

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 94/266 (35%), Positives = 147/266 (55%), Gaps = 10/266 (3%)

Query: 7   FEVIVAWRYLFSNRKNA-FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           FEV +A RYL    KNA F SI +  S +G+ +GV  LIVVMSVMNGF+  ++  +LGI+
Sbjct: 5   FEVTMAIRYL--QAKNAKFCSITTLFSIVGIALGVATLIVVMSVMNGFKVKLLDLILGID 62

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
           GH+ +        DY+ ++  ++ IP V+K +P  + Q  V+      S + VR +S  D
Sbjct: 63  GHINVYFDRNVNSDYRAVSKSIEKIPGVLKAIPMTNDQVIVAANDRIASSI-VRSMSTKD 121

Query: 126 FSYLQN-SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGI 184
             Y    + +   GNV  +FD  KGVI+G  L   L I+ GDKI ++SP G     G+  
Sbjct: 122 LFYNTTITDNIIVGNV-REFD--KGVIVGARLVEALNINYGDKIVLISPEGFDALFGVMP 178

Query: 185 RSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENI 244
           + K Y V+ +F M   +YD+ ++YM ++ AQ +FN +++V  IEVFV D   + +    I
Sbjct: 179 KVKEYEVVAIFDMGMFEYDSTLIYMPIKSAQAFFNYKDSVRNIEVFVDDTAGVSELASAI 238

Query: 245 VRILGNGVVVIDWQQRYQIFFSCYES 270
            +    G+    WQ ++  +F   ++
Sbjct: 239 EK--KTGMKAESWQLQHSNYFHALKT 262


>gi|57238817|ref|YP_179953.1| lipoprotein releasing system transmembrane protein lolC [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58578746|ref|YP_196958.1| lipoprotein releasing system transmembrane protein lolC [Ehrlichia
           ruminantium str. Welgevonden]
 gi|57160896|emb|CAH57801.1| putative lipoprotein releasing system transmembrane protein LolE
           [Ehrlichia ruminantium str. Welgevonden]
 gi|58417372|emb|CAI26576.1| Lipoprotein releasing system transmembrane protein lolC [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 411

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 98/271 (36%), Positives = 145/271 (53%), Gaps = 18/271 (6%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           +FE+++A RYL SNR     S+ + +SFIG+ +GV  LI+VMSVMNGF E ++  ++G+N
Sbjct: 4   KFELMLALRYLQSNRSQFLCSMITMLSFIGITLGVATLIIVMSVMNGFGEKLLNCIVGVN 63

Query: 66  GHVVIQ-QKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
           G V I         +Y  +A  +  IP VI  +P    QA      S  SG++VRGIS  
Sbjct: 64  GQVAIYFNNNEKDTNYHDVAKLIKDIPGVIDAIPITENQAMAKSEQS-VSGIIVRGISKQ 122

Query: 125 DF---SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
           D    + + ++  R  GN+S   D   G++IG  LA  L ++ GDKI ILS     T +G
Sbjct: 123 DLLRKNIIADNIVR--GNIS---DLDNGIVIGIKLAEILNVNYGDKITILSSDSIPTVIG 177

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD---PDAIE 238
              R KSY V+ +F +   +YD+ +VYM L  +QL F+  N V  IEV + D      I 
Sbjct: 178 SIPRMKSYKVIAVFDLGMYEYDSTLVYMPLHSSQLLFHYGNRVHNIEVSIDDINRSSEIL 237

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           K  E+   + G      DW+ +   +F+  +
Sbjct: 238 KLIEDKTSMKGE-----DWKMQQGSYFNALK 263


>gi|149201763|ref|ZP_01878737.1| lipoprotein releasing system transmembrane protein LolE
           [Roseovarius sp. TM1035]
 gi|149144811|gb|EDM32840.1| lipoprotein releasing system transmembrane protein LolE
           [Roseovarius sp. TM1035]
          Length = 428

 Score =  143 bits (361), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 84/276 (30%), Positives = 136/276 (49%), Gaps = 13/276 (4%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++AWRYL + R    +S+ ++IS IG+ + V ALI  ++V +GFR + +  +LG
Sbjct: 8   FAAFEWLIAWRYLRAKRAEGGVSVMTWISLIGITLAVFALIATLAVRSGFRAEFVDTILG 67

Query: 64  INGHVVIQQKYY---------PLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +               L DY  +A+R+  +P V +V P V GQ   +      +
Sbjct: 68  ANAHVTVYNSGAVDATGRVDRSLEDYAAMADRVRAVPGVTRVAPLVKGQVMANARDRN-A 126

Query: 115 GVLVRGISNSDFSYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINILSP 173
           GV V GI+  D + +        G    D  R  +G+ IG  +A+ LG+++GD+I ++SP
Sbjct: 127 GVQVYGITAQDLATIPRVADPETG--VGDIARFDQGIAIGSGVAQELGVTVGDRIKLISP 184

Query: 174 YGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
            G  TP+G   R  +Y V+ +F     D D    Y+   EAQ +FN +     +EV V +
Sbjct: 185 NGVKTPLGTSPRVNAYEVVYIFTAGRYDIDRVRAYLPFAEAQSFFNRDGRADELEVMVAE 244

Query: 234 PDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           P+ +      ++   G   ++  WQ     F    E
Sbjct: 245 PERVYDLTVPLLEAAGERALLWTWQDASGSFLRALE 280


>gi|283853282|ref|ZP_06370532.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio sp. FW1012B]
 gi|283571322|gb|EFC19332.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio sp. FW1012B]
          Length = 409

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 86/257 (33%), Positives = 143/257 (55%), Gaps = 8/257 (3%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ +A RYL + +K AFIS+ S IS +GV +GV +LIVV+ VMNGF  ++  ++LGIN 
Sbjct: 3   FELYIAKRYLLARQKQAFISVISLISILGVGLGVASLIVVVGVMNGFSLELRDKILGINA 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+V       L DY+    + + +P V+   PFV  +  +S    G  GV++RG+  +  
Sbjct: 63  HMVASVAGGALHDYREDMKKAEAVPGVLGATPFVYTEVMLSS-PRGVKGVVLRGVDPASA 121

Query: 127 SYLQNSFSRFYGNVSNDFDRG---KGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
             +    +        D        G+I+G++LA  LG+++GD +N++SP G  +  G  
Sbjct: 122 GKVLALPAEMTAGKLEDLTAPGLFPGIIVGRELADRLGLALGDTLNLMSPAGKESAAGFS 181

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEKTHE 242
            + K++T+ G+F+    +YD+ + Y+S+  AQ     + + V+G+E+ V D DA++ T  
Sbjct: 182 PKVKTFTICGLFKTGMYEYDSTLAYVSIPAAQELLGFKRDIVTGLELKVADVDAVD-TLA 240

Query: 243 NIVRIL--GNGVVVIDW 257
            +VR    G  V V  W
Sbjct: 241 PLVRTAMGGPPVYVRTW 257


>gi|172061069|ref|YP_001808721.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia ambifaria MC40-6]
 gi|171993586|gb|ACB64505.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia ambifaria MC40-6]
          Length = 417

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 148/275 (53%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV +      + D+Q  A      P V    P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEVFSPTGSMPDWQLTAQEARRNPSVTGAAPYVDAQALLT-RQDAVSGVMLRGVEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPY 174
           S    L+   S    ++  D   G+         G+++G  LA NLG+++GDKI +++P 
Sbjct: 124 S----LEPQVS----DIGKDMKAGQLTALVPGQFGIVLGDALAGNLGVTVGDKITLVAPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G +TP GM  R K +TV+G+F     +YD+ +  +++++A+  F + +A +G+ + + D 
Sbjct: 176 GTITPAGMMPRLKQFTVVGVFESGHYEYDSTLAMVNIRDAEALFRM-SAPTGVRLRLTDM 234

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    +   L   + + DW Q+ + +FS  +
Sbjct: 235 QKAPQVAVELSHTLSGSLYIRDWTQQNKTWFSAVQ 269


>gi|17545836|ref|NP_519238.1| lipoprotein releasing system transmembrane [Ralstonia solanacearum
           GMI1000]
 gi|17428130|emb|CAD14819.1| probable lipoprotein releasing system transmembrane [Ralstonia
           solanacearum GMI1000]
          Length = 416

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 150/268 (55%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  ++++   N+FIS  S IS +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRASKRASRNSFISFISLISMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ I      L D+Q  AN      +V+   P+V  QA ++       GVL+RG+S 
Sbjct: 65  VLSHIEIMAPGS-LPDWQRTANEAMQNKEVVGAAPYVGAQAMIT-RDDAVRGVLLRGVSP 122

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +D   + +    F     +D   G+ G+ +G ++AR LG+  GDK+ +++P G +TP G+
Sbjct: 123 ADEPKVSDIAKDFKSGTIDDLRPGEFGIALGAEMARGLGVRQGDKVTLVAPQGTITPAGV 182

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G F     ++D+ +  +++++A+  F L    +G+ + + D     +  E
Sbjct: 183 LPRLKQFTVIGTFESGHYEFDSSLALINMEDAERLFRLTGP-TGVRLKLVDMQRAPQVAE 241

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYES 270
            + R L   + + DW ++ + +F+  ++
Sbjct: 242 ALSRTLTGELYIRDWSRQNKNWFAAVQT 269


>gi|187928053|ref|YP_001898540.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ralstonia pickettii 12J]
 gi|187724943|gb|ACD26108.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ralstonia pickettii 12J]
          Length = 416

 Score =  143 bits (360), Expect = 3e-32,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 150/268 (55%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  ++++   N+FIS  S IS +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRASKRASRNSFISFISLISMLGIALGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ +      L D+Q  AN      +VI   P+V  QA ++       GVL+RG+S 
Sbjct: 65  VLAHIEVMAPNS-LPDWQRTANEAMQNKEVIGAAPYVGAQAMITR-DEAVRGVLLRGVSP 122

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +D   + +    F     +D   G+ G+ +G  LA  LG+  GDK+ +++P G +TP G+
Sbjct: 123 ADEPKVSDIAKDFKSGSIDDLKPGEFGIALGSQLANGLGVHQGDKVTLVAPQGTITPAGV 182

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV G+F     ++D+ +  +++++A+  F L+   +G+ + + D D   +  E
Sbjct: 183 LPRLKQFTVTGIFESGHYEFDSSLALVNMEDAERLFRLDGP-TGVRLKLVDMDRAPQVAE 241

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYES 270
            + R L   + + DW ++ + +F+  ++
Sbjct: 242 ALSRTLSGELYIRDWSRQNRNWFAAVKT 269


>gi|241662660|ref|YP_002981020.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ralstonia pickettii 12D]
 gi|240864687|gb|ACS62348.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ralstonia pickettii 12D]
          Length = 416

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 149/268 (55%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  ++++   N+FIS  S IS +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRASKRASRNSFISFISLISMLGIALGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ +      L D+Q  AN      +VI   P+V  QA ++       GVL+RG+S 
Sbjct: 65  VLAHIEVMAPNS-LPDWQRTANEAMQNKEVIGAAPYVGAQAMITR-DEAVRGVLLRGVSP 122

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +D   + +    F     +D   G+ G+ +G  LA  LG+  GDK+ +++P G +TP G+
Sbjct: 123 ADEPKVSDIAKDFKSGTIDDLKPGEFGIALGSQLANGLGVHQGDKVTLVAPQGTITPAGV 182

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV G+F     ++D+ +  +++ +A+  F L+   +G+ + + D D   +  E
Sbjct: 183 LPRLKQFTVTGIFESGHYEFDSSLALVNMDDAERLFRLDGP-TGVRLKLVDMDRAPQVAE 241

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYES 270
            + R L   + + DW ++ + +F+  ++
Sbjct: 242 ALSRTLSGELYIRDWSRQNRNWFAAVKT 269


>gi|206602453|gb|EDZ38934.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Leptospirillum sp. Group II '5-way CG']
          Length = 412

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 95/279 (34%), Positives = 150/279 (53%), Gaps = 22/279 (7%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           I  RFE  VA RYL SNR++  +S+ + IS  GV +GV AL+  ++VM GF+  +  ++L
Sbjct: 2   IPGRFEWKVAIRYLRSNRRSRTLSLQTIISVSGVTVGVAALMATLAVMTGFQHKLRSKIL 61

Query: 63  GINGHVVIQQ-KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVR 119
           G+N H+V+   +  P+   + I   +  IP V+ V PF+ GQA    LS G   SG ++R
Sbjct: 62  GVNSHIVLTDGRGAPMDHPEDIEKEVRKIPGVLHVAPFILGQAM---LSEGKTVSGAVLR 118

Query: 120 GISNSDFSYLQNSFSRF-----YGNVSNDFDRG-----KGVIIGKDLARNLGISIGDKIN 169
           GIS S     +N  +RF      G +S D DR       G+++G+DLA  L + IGD ++
Sbjct: 119 GISPSS----ENKVTRFERYMVRGRLS-DLDRPANAHRPGIVLGEDLADRLNVDIGDTVD 173

Query: 170 ILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIE 228
           ++SP G ++  GM  + + + V+G+FR    +YDN +  +SL E+  +  L + +V+G+E
Sbjct: 174 VISPNGTMSAFGMVPKIRHFAVVGIFRSGLYEYDNTLALLSLPESARFLGLPQGSVTGLE 233

Query: 229 VFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
           + V       +    I   LG       W Q  +  FS 
Sbjct: 234 IQVSHIMQASRISREIATRLGYPYWPRSWLQMNRNLFSA 272


>gi|309781216|ref|ZP_07675953.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ralstonia sp. 5_7_47FAA]
 gi|308920037|gb|EFP65697.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ralstonia sp. 5_7_47FAA]
          Length = 416

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 149/268 (55%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  ++++   N+FIS  S IS +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRASKRASRNSFISFISLISMLGIALGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ +      L D+Q  AN      +VI   P+V  QA ++       GVL+RG+S 
Sbjct: 65  VLAHIEVMAPNS-LPDWQRTANEAMQNKEVIGAAPYVGAQAMITR-DEAVRGVLLRGVSP 122

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +D   + +    F     +D   G+ G+ +G  LA  LG+  GDK+ +++P G +TP G+
Sbjct: 123 ADEPKVSDIAKDFKSGTIDDLKPGEFGIALGSQLANGLGVHQGDKVTLVAPQGTITPAGV 182

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV G+F     ++D+ +  +++ +A+  F L+   +G+ + + D D   +  E
Sbjct: 183 LPRLKQFTVTGIFESGHYEFDSSLALVNMDDAERLFRLDGP-TGVRLKLVDMDRAPQVAE 241

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYES 270
            + R L   + + DW ++ + +F+  ++
Sbjct: 242 ALSRTLSGELYIRDWSRQNRNWFAAVKT 269


>gi|258542705|ref|YP_003188138.1| lipoprotein releasing system transmembrane protein LolC/E
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256633783|dbj|BAH99758.1| lipoprotein releasing system transmembrane protein LolC/E
           [Acetobacter pasteurianus IFO 3283-01]
 gi|256636842|dbj|BAI02811.1| lipoprotein releasing system transmembrane protein LolC/E
           [Acetobacter pasteurianus IFO 3283-03]
 gi|256639895|dbj|BAI05857.1| lipoprotein releasing system transmembrane protein LolC/E
           [Acetobacter pasteurianus IFO 3283-07]
 gi|256642951|dbj|BAI08906.1| lipoprotein releasing system transmembrane protein LolC/E
           [Acetobacter pasteurianus IFO 3283-22]
 gi|256646006|dbj|BAI11954.1| lipoprotein releasing system transmembrane protein LolC/E
           [Acetobacter pasteurianus IFO 3283-26]
 gi|256649059|dbj|BAI15000.1| lipoprotein releasing system transmembrane protein LolC/E
           [Acetobacter pasteurianus IFO 3283-32]
 gi|256652046|dbj|BAI17980.1| lipoprotein releasing system transmembrane protein LolC/E
           [Acetobacter pasteurianus IFO 3283-01-42C]
 gi|256655103|dbj|BAI21030.1| lipoprotein releasing system transmembrane protein LolC/E
           [Acetobacter pasteurianus IFO 3283-12]
          Length = 415

 Score =  142 bits (359), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 82/270 (30%), Positives = 140/270 (51%), Gaps = 6/270 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F  FE  VA RYL + R   F+S+ +  S +G+ +GV  LI+VM+VMNGF+ D++ R+L
Sbjct: 1   MFGPFERAVAGRYLRARRGERFVSVIAIFSLVGIALGVATLIIVMAVMNGFQADLMGRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRG 120
           G+NG + I  +   +  Y+ +  ++  +P V+   P V GQ     LS+G   SG +V G
Sbjct: 61  GLNGDLTIYGQGRTISQYEDVTRKVRSVPGVVSATPLVEGQVL---LSAGAYNSGGMVHG 117

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           ++      L+   S       +DF     +++G  +A   G+ IG  + ++SP G  T  
Sbjct: 118 LTPQGLKDLKAVSSSIIAGSLDDFGPDDSIVVGVTMAERAGLGIGSGLTLVSPDGAATAF 177

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G   R + Y V+ +F     DY++ +V++ +  AQ+YF + N  + I+V  KD + +   
Sbjct: 178 GTVPRVRRYRVVAIFDAGVNDYNSSVVFLPMHAAQIYFQMPNKATQIQVMTKDAEHVRPV 237

Query: 241 HENIVRILGN-GVVVIDWQQRYQIFFSCYE 269
              I   +G+ G+ V+DW       F   +
Sbjct: 238 TLAIEDAVGDPGLRVLDWTNANNALFGAVQ 267


>gi|238028009|ref|YP_002912240.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Burkholderia glumae BGR1]
 gi|237877203|gb|ACR29536.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Burkholderia glumae BGR1]
          Length = 417

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 146/267 (54%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF+  +  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIAAVSMLGIALGVAALIVVLSVMNGFQTQVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D+Q  A+     P+VI   P+V  QA ++      SGV++RG+  
Sbjct: 65  VLAHVEIFSPTGSMPDWQRTASEARRNPEVIGSAPYVEAQALLT-RQDAVSGVMLRGVDP 123

Query: 124 SDFSYLQNSFSRF-YGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +    + +       G+++     G G+++G  LA NLG+++GDK+ +++P G +TP GM
Sbjct: 124 TLEPQVSDVGKDMRAGSLAALQPGGFGIVLGTALASNLGVTVGDKVTLVAPEGTITPAGM 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ +  + + +AQ  F L  A +G+ + +KD     +   
Sbjct: 184 LPRLKQFTVVGVFESGHYEYDSTLAMIDIHDAQTLFRLP-APTGVRLRLKDMQRAPQVAV 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   L   + + DW Q+ + +FS  +
Sbjct: 243 ELSHSLSGELYIRDWTQQNKTWFSAVK 269


>gi|299067168|emb|CBJ38364.1| outer membrane-specific lipoprotein transporter subunit ; membrane
           component of ABC superfamily [Ralstonia solanacearum
           CMR15]
          Length = 416

 Score =  142 bits (358), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 150/268 (55%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  ++++   N+FIS  S IS +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRASKRASRNSFISFISLISMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ I      L D+Q  AN      +V+   P+V  QA ++       GVL+RG+S 
Sbjct: 65  VLSHIEIMAPGS-LPDWQRTANEAMQNKEVVGAAPYVGAQAMIT-RDDAVRGVLLRGVSP 122

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +D   + +    F     +D   G+ G+ +G ++AR LG+  GDK+ +++P G +TP G+
Sbjct: 123 ADEPKVSDIAKDFKSGAIDDLRPGEFGIALGAEMARGLGVRQGDKVTLVAPQGTITPAGV 182

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G F     ++D+ +  +++++A+  F L    +G+ + + D     +  E
Sbjct: 183 LPRLKQFTVIGTFESGHYEFDSSLALINMEDAERLFRLTGP-TGVRLKLVDMQRAPQVAE 241

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYES 270
            + R L   + + DW ++ + +F+  ++
Sbjct: 242 ALSRTLTGELYIRDWSRQNKNWFAAVKT 269


>gi|257092665|ref|YP_003166306.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
 gi|257045189|gb|ACV34377.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Candidatus Accumulibacter phosphatis clade IIA str.
           UW-1]
          Length = 415

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 145/268 (54%), Gaps = 10/268 (3%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+++  RY  + + N FIS  S IS +G+ +GV ALIVV+SVMNGF+ ++  R+L +  
Sbjct: 5   YELLIGLRYTRAKKHNHFISFISLISMLGIALGVAALIVVLSVMNGFQTELRARILAVVS 64

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           HV I      +  +Q +A++      V+   PFV  Q  ++       G +VRGI     
Sbjct: 65  HVQITGASGEMSAWQGVASQAAGHEHVVAAAPFVQAQGMLA-FGQAVRGAVVRGILPDQ- 122

Query: 127 SYLQNSFSRFYGNVSN-DFDRGK----GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
              ++  + F  ++ N + D  +     +I+G +LAR LG+ +GD++ ++SP G VTP G
Sbjct: 123 ---EDKVADFRPHMKNGELDALQPDSFTIILGSELARALGVFVGDRVTLISPQGVVTPAG 179

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R K++TV G+F +   +YD+G+  + L +AQ  + +++ VSG+ + + D     +  
Sbjct: 180 VVPRLKTFTVAGLFEVGMYEYDSGLALIHLADAQRLYRMDDRVSGVRLKLDDLFVAPRVA 239

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            ++   L     + DW + +  FF   +
Sbjct: 240 RSLASTLDTEAFISDWTRSHANFFRAVQ 267


>gi|40063595|gb|AAR38384.1| ABC transporter, permease protein [uncultured marine bacterium 582]
          Length = 415

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 91/268 (33%), Positives = 129/268 (48%), Gaps = 13/268 (4%)

Query: 10  IVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVV 69
           ++AWRYL S R    +S+ ++IS IG+ + V ALI  +SV +GFR + +  +LG N H  
Sbjct: 1   MIAWRYLRSKRAEGGVSVMTWISLIGITLAVFALIATLSVRSGFRAEFVDTILGANAHAT 60

Query: 70  IQQKYY---------PLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           + Q             + +Y  IA RL  +P V +V P + GQ   + L    +GV V G
Sbjct: 61  VYQGATVNENGQMDRSISEYDTIAARLRQVPGVSRVAPLIKGQVMATRLGRN-AGVEVFG 119

Query: 121 ISNSDFSYLQN-SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           IS  +   L   +    Y    N F    GV IG  +AR LG+ +GDKI ++SP G  T 
Sbjct: 120 ISFENLLTLPRIARPESYAGDINRFQ--SGVAIGSGVARELGVIVGDKIKLMSPDGVKTA 177

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G   R KSY V  +F     D D   +YM    AQ +FN E      EV V DP+A++ 
Sbjct: 178 FGTSPRIKSYVVGYIFTAGRYDIDRTRIYMPFAAAQSFFNSEGTADEFEVMVADPEAVDV 237

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSC 267
               +    G+  +V  W+Q    F   
Sbjct: 238 LLPALQAAAGDNALVWTWRQASSSFLKA 265


>gi|91205015|ref|YP_537370.1| lipoprotein releasing system, transmembrane protein [Rickettsia
           bellii RML369-C]
 gi|91068559|gb|ABE04281.1| Lipoprotein releasing system, transmembrane protein [Rickettsia
           bellii RML369-C]
          Length = 415

 Score =  142 bits (358), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 94/266 (35%), Positives = 141/266 (53%), Gaps = 3/266 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           I + F   VA+RY  + +   F+SI S  S +GVMIGV ALIVVMSVMNGF  ++ K ++
Sbjct: 2   INNNFIFTVAFRYFKAKKNEKFVSIISGFSLLGVMIGVAALIVVMSVMNGFHTELTKNII 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NG +VI  +   + +Y+ I  +L     V  V    +GQA   G  +  SG +++GI 
Sbjct: 62  GLNGDIVISPQTSSIDNYEEIKAKLLQQNYVKHVNIIANGQALALG-KNNNSGAIIKGID 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +D   L+N   +     S D   GK VI +G+ LA NLG+++ DK+ ++SP    T  G
Sbjct: 121 LNDLK-LKNEIFKNVNFGSFDNFHGKNVIALGQGLAANLGVTVNDKVKLISPNSISTAFG 179

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              RSK + V+ +F     DYD+  + M L+ AQ + +L N ++ IEV    PD      
Sbjct: 180 SVPRSKEFKVIAIFNSGMYDYDSATILMPLEAAQNFLSLGNNINLIEVNTLHPDKALAYS 239

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
             +  +LG  + +  WQ     F S 
Sbjct: 240 YKVQLLLGTNLQIFSWQTLNSQFLSA 265


>gi|207722853|ref|YP_002253287.1| lipoprotein releasing system protein [Ralstonia solanacearum MolK2]
 gi|207743544|ref|YP_002259936.1| lipoprotein releasing system protein [Ralstonia solanacearum
           IPO1609]
 gi|300704513|ref|YP_003746116.1| outer membrane-specific lipoprotein transporter subunit; membrane
           component of ABC superfamily [Ralstonia solanacearum
           CFBP2957]
 gi|206588037|emb|CAQ18617.1| lipoprotein releasing system protein [Ralstonia solanacearum MolK2]
 gi|206594942|emb|CAQ61869.1| lipoprotein releasing system protein [Ralstonia solanacearum
           IPO1609]
 gi|299072177|emb|CBJ43509.1| outer membrane-specific lipoprotein transporter subunit ; membrane
           component of ABC superfamily [Ralstonia solanacearum
           CFBP2957]
          Length = 416

 Score =  142 bits (357), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 82/268 (30%), Positives = 148/268 (55%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N+FIS  S IS +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRATRNSFISFISLISMLGIALGVTALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ I      L D+Q  AN      +V+   P+V  QA ++       GVL+RG+S 
Sbjct: 65  VLSHIEIMAPGS-LPDWQRTANEALQNKEVVGAAPYVGAQAMIT-RDDAVRGVLLRGVSP 122

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +D   + +    F     +D   G+ G+ +G +LAR LG+  GDK+ +++P G +TP G+
Sbjct: 123 ADEPKVSDIAKDFKSGGIDDLKPGEFGIALGSELARGLGVRQGDKVTLVAPQGTITPAGV 182

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G F     ++D+ +  + + +A+  F L+   +G+ + + D     +  E
Sbjct: 183 LPRMKQFTVIGTFESGHYEFDSSLALIHIDDAERLFRLDGP-TGVRLKLVDMQRAPQVAE 241

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYES 270
            + R L   + + DW ++ + +F+  ++
Sbjct: 242 ALSRTLTGELYIRDWSRQNKNWFAAVQT 269


>gi|254461775|ref|ZP_05075191.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodobacterales bacterium HTCC2083]
 gi|206678364|gb|EDZ42851.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodobacteraceae bacterium HTCC2083]
          Length = 423

 Score =  142 bits (357), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 78/275 (28%), Positives = 141/275 (51%), Gaps = 29/275 (10%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+RFE ++AWRYL + R    +S+ ++IS IG+ + V AL+  +++  G R + ++ +LG
Sbjct: 3   FARFEWMIAWRYLRAKRAEGGVSVMTWISLIGITLAVFALVATLAIRTGLRAETLRTILG 62

Query: 64  INGHVVIQQKYYP------------LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSS 111
           ++ H    + YYP            + DY+ +  RL  IP V   +P V  +  ++  + 
Sbjct: 63  VSAHA---ELYYPRTVQANGAQDAIIRDYETLTERLRAIPGVQDAVPVVKAR-IIANRAR 118

Query: 112 GGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRG------KGVIIGKDLARNLGISIG 165
             + + + GI   D +       RF     ++  +G      KG+ +G+ LAR L ++IG
Sbjct: 119 QNAPIELFGIRPEDLA-------RFPAVAESEQAQGDLANLPKGIALGQSLARTLDVTIG 171

Query: 166 DKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVS 225
           D++ I+SP G  T  G+  R K++ V+ +FR      DN   Y+SL EAQ + N E  V 
Sbjct: 172 DRVKIISPNGTRTAFGVSPRVKTWEVVYIFRTGQGFVDNSRAYLSLAEAQPFLNREAGVD 231

Query: 226 GIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQR 260
            I++ + DP+ +++    + +       +  W++R
Sbjct: 232 QIDIVLDDPEMVDQMETQLAQSSTGPAYIWSWRER 266


>gi|300113158|ref|YP_003759733.1| lipoprotein releasing system transmembrane protein [Nitrosococcus
           watsonii C-113]
 gi|299539095|gb|ADJ27412.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Nitrosococcus watsonii C-113]
          Length = 415

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 140/269 (52%), Gaps = 2/269 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S  S +GV +GV ALI V+SVMNGF +++  R+L
Sbjct: 1   MFKPLPLYIGLRYTRAKRRNYFISFISLTSMLGVALGVAALITVLSVMNGFEKELRTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  HV++      L  +Q +  +L+    +  + PF+ GQ  V+   +   G LVRGI 
Sbjct: 61  GMVAHVIVTGPDGTLEHWQALKTQLEKNAKIAGIAPFIEGQGMVTH-RNQVQGTLVRGIL 119

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
                 + +   +      +    G   +++G DLAR LG+ IGDKI +++P+   TP G
Sbjct: 120 PQQEHQVLDIHDKMVAGSLDALRPGSFQIVLGMDLARTLGVFIGDKITLVTPHATTTPAG 179

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R K  TV G+F++   +YD+ +  M+L++A + F +   VSG+ + + +  +  +  
Sbjct: 180 IIPRLKRLTVAGVFQVGMYEYDSALAIMNLEDAAVLFRIPGKVSGLRLKLDNLFSAPRLA 239

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYES 270
             +   L +     DW  ++  FF   ++
Sbjct: 240 HELRETLPSNYRTADWTYQHANFFRALKT 268


>gi|241761005|ref|ZP_04759094.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
 gi|241374624|gb|EER64085.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Zymomonas mobilis subsp. mobilis ATCC 10988]
          Length = 416

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 91/266 (34%), Positives = 135/266 (50%), Gaps = 2/266 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           I S +E I+A RYL   +  AFI + + IS + V +GV ALI+VMSVMNGFR ++  +++
Sbjct: 2   ILSAYERIIARRYLLPGKGEAFIFLVASISLLAVTLGVAALIIVMSVMNGFRAELFDKIV 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           GINGH VIQ     L +++ I       P V   +P +  Q  ++  +    GVL+RG++
Sbjct: 62  GINGHAVIQGYNGELANWRPILEATRKTPGVTSAIPLIE-QPLMATHAGRVEGVLLRGMA 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +D +      S       N+   G   VIIG  LA  LGI  GD I+++SP G  TP G
Sbjct: 121 LNDVNNNNLIRSNIREGHLNELKAGSNNVIIGIRLAEQLGIHAGDDISLISPAGQTTPFG 180

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R  SY V  +F +   DYD   V M L +AQ    + + V  IE+   + D + +  
Sbjct: 181 TVPRIVSYRVAAIFEVGVYDYDKAFVIMPLSDAQTLLMMNDTVGIIEIKTNNADRVGQIL 240

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
           + +   + N  V+ DW+      F  
Sbjct: 241 DPLKDRVANVGVLQDWRNMNASLFQA 266


>gi|115352202|ref|YP_774041.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia ambifaria AMMD]
 gi|115282190|gb|ABI87707.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia ambifaria AMMD]
          Length = 417

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 148/275 (53%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV +      + ++Q  A      P V    P+V  QA ++      SGV++RGI  
Sbjct: 65  VLAHVEVFSPTGSMPNWQLTAQEARRNPSVTGAAPYVDAQALLT-RQDAVSGVMLRGIEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPY 174
           S    L+   S    ++  D   G+         G+++G  LA NLG+++GDKI +++P 
Sbjct: 124 S----LEPQVS----DIGKDMKAGQLTALVPGQFGIVLGDALAGNLGVTVGDKITLVAPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G +TP GM  R K +TV+G+F     +YD+ +  +++++A+  F + +A +G+ + + D 
Sbjct: 176 GTITPAGMMPRLKQFTVVGVFESGHYEYDSTLAMVNIRDAEALFRM-SAPTGVRLRLTDM 234

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    +   L   + + DW Q+ + +FS  +
Sbjct: 235 QKAPQVAVELSHTLSGSLYIRDWTQQNKTWFSAVQ 269


>gi|148555261|ref|YP_001262843.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Sphingomonas wittichii RW1]
 gi|148500451|gb|ABQ68705.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Sphingomonas wittichii RW1]
          Length = 416

 Score =  141 bits (356), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 86/238 (36%), Positives = 127/238 (53%), Gaps = 6/238 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           + +R+E ++A RYL   R  AFI + + IS + V +GV ALIVVMSVMNGFR ++  +++
Sbjct: 2   LLNRYERMIAKRYLLPGRGEAFIFLVASISLVAVALGVAALIVVMSVMNGFRAELFDKIV 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NGH V+Q     L D++ IA     +P V+   P +  Q  ++       GVLVRG++
Sbjct: 62  GLNGHAVVQGYDGKLGDWRRIAADARKLPGVVSATPLIE-QPLMASFGGRVEGVLVRGMT 120

Query: 123 NSDF---SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
             D      +Q    R  G++         V IG  LA  LG  +G +I+++SP G  TP
Sbjct: 121 LEDIRRNPVIQGKVVR--GSLDALTPGSDRVAIGARLAEQLGADLGSQISLISPQGQTTP 178

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
            G   R  SY V  +F +   DYD   V M + +AQ    L++AV  IE+   D D +
Sbjct: 179 FGTVPRIVSYQVAAIFEVGVYDYDKAFVVMPMSDAQTLLMLDDAVGMIEIQTVDADRV 236


>gi|34498419|ref|NP_902634.1| lipoprotein releasing system trasmembrane protein [Chromobacterium
           violaceum ATCC 12472]
 gi|34104273|gb|AAQ60632.1| lipoprotein releasing system trasmembrane protein [Chromobacterium
           violaceum ATCC 12472]
          Length = 412

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 88/266 (33%), Positives = 146/266 (54%), Gaps = 7/266 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE  +  RYL + R+N FIS  S IS +G+ +GV ALI+V+SVMNGF++++  R+L +  
Sbjct: 3   FEAFIGLRYLRAKRRNGFISFISLISIVGIALGVAALIIVLSVMNGFQKEIRGRILSVAS 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQA-FVS-GLSSGGSGVLVRGISNS 124
           H+ +      L  ++     L   P V    PFVS Q  FV+ G   GG   LVRGI  +
Sbjct: 63  HLEVSGYDGRLSGWRDAQAMLAKQPHVQAAAPFVSSQGLFVAYGNVRGG---LVRGIDPA 119

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
             + + +           D   G  G+ +G +LAR LG+ +GDK+ +++P G++TP GM 
Sbjct: 120 LENKVVDVGRHMVAGKLEDLKPGGFGMALGVELARQLGVGVGDKVTLMTPQGNITPAGMV 179

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            RSK +TV+G+F++   ++D  +  ++L++AQ+   + +AVSG+ + + DP    +    
Sbjct: 180 PRSKQFTVVGIFKVDMFEFDASLAMVNLRDAQVLERMGDAVSGVRLRLDDPMLAPQLKAE 239

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +   L   ++V DW      +F   +
Sbjct: 240 LRPRLPQ-LLVTDWTDTNANYFRAVQ 264


>gi|255264792|ref|ZP_05344134.1| lipoprotein releasing system transmembrane protein LolE
           [Thalassiobium sp. R2A62]
 gi|255107127|gb|EET49801.1| lipoprotein releasing system transmembrane protein LolE
           [Thalassiobium sp. R2A62]
          Length = 429

 Score =  141 bits (356), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 141/279 (50%), Gaps = 19/279 (6%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+RFE ++AWRY+ + R    +SI ++IS +G+ + V ALI  ++V +GFR + +  +LG
Sbjct: 9   FARFEWMIAWRYIRAKRAEGGVSIMTWISLVGITLAVFALIATLAVRSGFRAEFVDTILG 68

Query: 64  INGHVVIQQKY---------YPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +  +            + +Y  +A  +  +P V +V P + GQ   + LS+   
Sbjct: 69  ANAHVTVYNRLEVSETGASSRTIANYDELAAAVAAVPGVTRVAPLIKGQVMANNLSNN-V 127

Query: 115 GVLVRGISNSDFSYL----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINI 170
           GV V GI+  +   +    Q   +R  GN+   +D   GV IG  +AR LG+++GD+I I
Sbjct: 128 GVEVFGITLDNLKTIPRIVQPEEAR--GNIDRFYD---GVAIGSGVARELGVTVGDRIKI 182

Query: 171 LSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVF 230
           +SP G  T  G   R  +Y V+ +F     D D   VY+   EAQ +FN       +EV 
Sbjct: 183 ISPNGVRTAFGTSPRVNAYEVVYVFTAGRYDIDRTRVYLPFSEAQNFFNRNGVADELEVM 242

Query: 231 VKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           V+DPD +      ++   G+  ++  WQ     F    E
Sbjct: 243 VEDPDWVSDLTLPLLNAAGDRALIWTWQDASGGFLRALE 281


>gi|319764015|ref|YP_004127952.1| lipoprotein releasing system, transmembrane protein, lolc/e family
           [Alicycliphilus denitrificans BC]
 gi|330823721|ref|YP_004387024.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Alicycliphilus denitrificans K601]
 gi|317118576|gb|ADV01065.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Alicycliphilus denitrificans BC]
 gi|329309093|gb|AEB83508.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Alicycliphilus denitrificans K601]
          Length = 417

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 144/270 (53%), Gaps = 12/270 (4%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ + WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YELALGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYP----LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVR 119
           +  H+ I   + P    L D Q         P+VI   PFV+ QA ++       GVLVR
Sbjct: 65  VVSHIEI---FAPGGAALPDPQRTLAEARANPNVIGAAPFVAAQALLAR-GEDMKGVLVR 120

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           GI  +    + +  +     +      G  V++G +LAR LG+  GD + +++P G VTP
Sbjct: 121 GIDPAREPEVTDLAAESVQGLQALAPGGFRVVLGSELARQLGVQAGDVVTLIAPSGQVTP 180

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G+  R K  TV G F     +YD+ +V M  ++A+  F LE   +G+ + ++D  A  +
Sbjct: 181 AGVVPRLKQMTVAGTFNSGHYEYDSALVLMHHEDAERIFRLEGP-TGVRLKLEDLHAAPE 239

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             + +   L   +++ DW Q+ + +F+  +
Sbjct: 240 VAQQLAHSLSGDLLIRDWTQQNKTWFAAVQ 269


>gi|171321903|ref|ZP_02910796.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia ambifaria MEX-5]
 gi|171092800|gb|EDT38070.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia ambifaria MEX-5]
          Length = 417

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 148/275 (53%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV +      + ++Q  A      P V    P+V  QA ++      SGV++RGI  
Sbjct: 65  VLAHVEVFSPTGSMPNWQLTAQEARRNPSVTGAAPYVDAQALLT-RQDAVSGVMLRGIEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPY 174
           S    L+   S    ++  D   G+         G+++G  LA NLG+++GDKI +++P 
Sbjct: 124 S----LEPQVS----DIGKDMKAGQLAALVPGQFGIVLGDALAGNLGVTVGDKITLVAPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G +TP GM  R K +TV+G+F     +YD+ +  +++++A+  F + +A +G+ + + D 
Sbjct: 176 GTITPAGMMPRLKQFTVVGVFESGHYEYDSTLAMVNIRDAEALFRM-SAPTGVRLRLTDM 234

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    +   L   + + DW Q+ + +FS  +
Sbjct: 235 QKAPQVAIELSHTLSGSLYIRDWTQQNKTWFSAVQ 269


>gi|77166127|ref|YP_344652.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Nitrosococcus oceani ATCC 19707]
 gi|254435900|ref|ZP_05049407.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Nitrosococcus oceani AFC27]
 gi|76884441|gb|ABA59122.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Nitrosococcus oceani ATCC 19707]
 gi|207089011|gb|EDZ66283.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Nitrosococcus oceani AFC27]
          Length = 415

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 138/269 (51%), Gaps = 2/269 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S  S +GV +GV ALI V+SVMNGF +++  R+L
Sbjct: 1   MFKPLPLYIGLRYTRAKRRNYFISFISLTSMLGVALGVAALITVLSVMNGFEKELRTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  HV++      L  +Q +  +L+    +  + PF+ GQ   +   +   G LVRGI 
Sbjct: 61  GMVAHVIVTGPDGTLEHWQALKTQLEENAKIAGIAPFIEGQGMATH-RNQVQGTLVRGIL 119

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
                 + +   +      +    G   +++G DLAR LG+ IGDKI +++P+   TP G
Sbjct: 120 PQQEDQVLDIHGKMVAGSLDALRPGSFQIVLGMDLARTLGVFIGDKITLVTPHATTTPAG 179

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R K  TV G+F++   +YD+ +  M+L++A + F +   VSG+ + + D  +  +  
Sbjct: 180 IIPRLKRVTVAGVFQVGMYEYDSALAIMNLEDAAVLFRIPGKVSGLRLKLDDLFSAPRLA 239

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYES 270
             +   L       DW  ++  FF   ++
Sbjct: 240 RELRETLPGNYRTADWTYQHANFFRALKT 268


>gi|126735145|ref|ZP_01750891.1| lipoprotein releasing system transmembrane protein LolE
           [Roseobacter sp. CCS2]
 gi|126715700|gb|EBA12565.1| lipoprotein releasing system transmembrane protein LolE
           [Roseobacter sp. CCS2]
          Length = 421

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 132/265 (49%), Gaps = 4/265 (1%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F++FE ++AWRY+ + R    +S+ ++IS IGV + V ALI  ++V +GFR + I  + G
Sbjct: 10  FAKFEWMIAWRYIRAKRAEGGVSVMTWISLIGVTLAVFALIATLAVRSGFRAEFIDTIAG 69

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVL-VRGIS 122
            N HV +      + D++ +A+R+  +  V  V P V GQA  SG  SG  G+  + GI 
Sbjct: 70  ANAHVSVVMPRAVIQDFEDVADRVRAVEGVQSVAPLVRGQAMASG--SGRIGLADIYGIR 127

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
             D     ++  +    + N  D   G+ IG  LA NLG++IGD+I I +  G  TPMG 
Sbjct: 128 LEDLKA-SDAIVQSERTIGNIDDLPNGIAIGSALANNLGLTIGDRIEITTRSGAATPMGQ 186

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R  +Y V+ +F       D    Y+    AQL FN +     +E+ + D +  E   +
Sbjct: 187 ATRRNAYEVVFIFSTGRFQIDEVRAYLPFDVAQLVFNRDGVADELEIRLDDLNQSEVLKQ 246

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSC 267
           +I    G G     WQ R   F   
Sbjct: 247 DIANAAGPGFWAYSWQDRVGRFLRA 271


>gi|83949528|ref|ZP_00958261.1| lipoprotein releasing system transmembrane protein LolE
           [Roseovarius nubinhibens ISM]
 gi|83837427|gb|EAP76723.1| lipoprotein releasing system transmembrane protein LolE
           [Roseovarius nubinhibens ISM]
          Length = 416

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 85/272 (31%), Positives = 138/272 (50%), Gaps = 16/272 (5%)

Query: 10  IVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVV 69
           ++AWRYL + R    +S+ ++IS IG+ + V ALIV ++V +GFR + +  +LG N HV 
Sbjct: 1   MIAWRYLRAKRAEGGVSVMTWISLIGITLAVFALIVTLAVRSGFRAEFVDTILGSNAHVT 60

Query: 70  IQQK----------YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVR 119
           I                L DY+ +A R+  +P V +V P V GQ  ++ + +  +GV V 
Sbjct: 61  IYSAGEVDAVTGRIDRTLQDYEEMAARVREVPGVTRVAPLVRGQ-LLANVQNRNAGVEVF 119

Query: 120 GISNSDFSYLQN--SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
           GI+  +   +    +     G +   FD  +G+ IG  +AR LG+++GDK+ I+ P G  
Sbjct: 120 GITKENLKTIPRIANPETSLGEIEA-FD--QGIAIGSGVARELGVTVGDKVKIILPGGVK 176

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           T  G   R K+Y V  +F     D D   VY+   EAQ +FN E     +EV V +PD +
Sbjct: 177 TAFGSSPRVKAYDVTYVFSAGRYDIDRTRVYLPFAEAQEFFNREGVADELEVMVAEPDHV 236

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +   E ++   G   ++  W+   + F    +
Sbjct: 237 DAMTEALIAAAGERALLWTWRDASKSFLDALD 268


>gi|119897800|ref|YP_933013.1| putative lipoprotein transporter, permease [Azoarcus sp. BH72]
 gi|119670213|emb|CAL94126.1| putative lipoprotein transporter, permease protein [Azoarcus sp.
           BH72]
          Length = 418

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 144/269 (53%), Gaps = 9/269 (3%)

Query: 6   RFEVIVAWRYLFSNRK----NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRV 61
            +E++V  RY  S ++    N FIS  S +S +G+ +GV ALIVV+SVMNGF+E++  R+
Sbjct: 2   HYELLVGLRYTRSRKRAQGRNRFISFISLVSMLGIALGVAALIVVLSVMNGFQEELRTRI 61

Query: 62  LGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
           LG+  HV++Q     L  +Q +A      P V    PFV  Q  +S       G LVRG+
Sbjct: 62  LGVASHVLVQGVEGELASWQQVAEDAARHPAVKAAAPFVQEQGMLS-FDEVVRGTLVRGV 120

Query: 122 SNSDFSYLQNSFSRFY-GNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
             +    + + F R+           G+ G+++G+DLA +L + +GDK+ +++P G VTP
Sbjct: 121 IPATEDKVAD-FGRYMKAGALEALAPGRFGIVLGRDLALSLRVQLGDKVTLIAPQGLVTP 179

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
             +  R K + V+G+F     +YD+G+  + + +AQ  + + +AV+G+ + + D  A  +
Sbjct: 180 AAVLPRVKQFEVVGIFEAGMYEYDSGLALVHIADAQALYRMGDAVTGVRLKLDDLFAAPR 239

Query: 240 THENIVRIL-GNGVVVIDWQQRYQIFFSC 267
               +  +L      V DW + +  FF  
Sbjct: 240 VARELAGMLEAPNAFVTDWTRSHANFFRA 268


>gi|103486663|ref|YP_616224.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Sphingopyxis alaskensis RB2256]
 gi|98976740|gb|ABF52891.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Sphingopyxis alaskensis RB2256]
          Length = 416

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 85/266 (31%), Positives = 129/266 (48%), Gaps = 2/266 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           I   +E  +  RY+   R   FI +A+  SF+ V +GV AL+VVMSVMNG R D+  +++
Sbjct: 2   ILRPYERTIFKRYMLPQRGEGFIFVAAAFSFVAVTLGVAALVVVMSVMNGVRSDLFDKIV 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NGH V+Q     L D++ +  +    P V    P +  Q  ++        VLVRG++
Sbjct: 62  GLNGHAVVQGFGGRLDDWRDVLKQAKATPGVTSATPLIE-QPLLTTFGGRVEAVLVRGMT 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKG-VIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
             D         +      N    G G V IG +LARNLG ++G  I I++P G  TP G
Sbjct: 121 VPDIRSNAVLGGKVLQGSLNSLTAGSGNVAIGSELARNLGATVGSNITIINPQGRSTPFG 180

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R   Y V  +F +   D+D   V M +++AQL     + +  IE+  +DPD + +  
Sbjct: 181 TVPREIGYRVSAVFEIGVYDFDKAYVVMPMEDAQLLLLSGDQIGMIEIKTEDPDRVGEIL 240

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
           + +   L    VV DW+      F  
Sbjct: 241 QPLAEKLAAQAVVSDWRSMNASLFEA 266


>gi|163745978|ref|ZP_02153337.1| lipoprotein releasing system transmembrane protein, putative
           [Oceanibulbus indolifex HEL-45]
 gi|161380723|gb|EDQ05133.1| lipoprotein releasing system transmembrane protein, putative
           [Oceanibulbus indolifex HEL-45]
          Length = 431

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 85/277 (30%), Positives = 142/277 (51%), Gaps = 15/277 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++AWRYL + R    +S+ ++IS IG+ + V ALI  +SV +GFR + +  +LG
Sbjct: 11  FAAFEWMIAWRYLRARRAEGGVSVMTWISLIGITLAVFALIATLSVRSGFRAEFVDTILG 70

Query: 64  INGHVVI---------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +          Q    + +Y  +A  +  +P V +V P V  Q   +   S  +
Sbjct: 71  ANAHVTVYTMGEVQETGQIDRTIANYTEMAAEVAKVPGVTRVAPLVRQQVMANRRQSN-A 129

Query: 115 GVLVRGISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           GV V GI++ D   +       R +G++   F+  +G+ IG  +A++LG+ +GD I ++S
Sbjct: 130 GVEVFGIASDDLMTIPGIQPSERSFGDIGR-FE--EGIAIGSGVAQSLGVQVGDTIKLIS 186

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R   Y V+ +F     D D   VY+ + EAQ +FN E     +EV V+
Sbjct: 187 PNGVKTAFGTSPRVNGYEVVYIFSAGRYDIDKTRVYLPIAEAQSFFNREGVADELEVMVE 246

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           DP++++     +++  G+   V  W+     F S  +
Sbjct: 247 DPESVDTMARALMQAAGDRTQVWTWRDASGSFLSALD 283


>gi|300312089|ref|YP_003776181.1| lipoprotein release ABC transporter permease [Herbaspirillum
           seropedicae SmR1]
 gi|300074874|gb|ADJ64273.1| ABC-type lipoprotein release transport system, permease component
           protein [Herbaspirillum seropedicae SmR1]
          Length = 421

 Score =  140 bits (354), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 151/268 (56%), Gaps = 6/268 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FE +V  RY  + ++   N+FIS  S IS  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 9   FEWLVGIRYTRAGKRSGRNSFISFISLISMAGIALGVAALIVVLSVMNGFQKEVRDRMLS 68

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ +      + D+Q +A +    P+V+   P+V+ QA ++   S   GVLVRG+  
Sbjct: 69  VLAHIEVFDASGSMKDWQAVAKQTFQNPEVLGAAPYVAAQAMMTRDDS-VRGVLVRGVLP 127

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
            +   + +   +      +    G+  ++IG +LAR L + +GDK+ +++P G VTP G+
Sbjct: 128 QEEPKVSDVAKQVKQGSFDSLKPGEFNIVIGGELARGLRVGLGDKVTLIAPQGQVTPAGV 187

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV G+F     ++D+ + ++ LQ+A+  F + +A +G+ + ++D     +  +
Sbjct: 188 LPRLKQFTVTGIFEAGHYEFDSSLAFIDLQDAETLFRM-DAPTGVRLRIRDMLQAPQVTQ 246

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYES 270
            + R L   + + DW Q+   +F+  ++
Sbjct: 247 ELARTLTGDLYLRDWSQQNSNWFAAVKT 274


>gi|56551355|ref|YP_162194.1| LolC/E family lipoprotein releasing system transmembrane protein
           [Zymomonas mobilis subsp. mobilis ZM4]
 gi|56542929|gb|AAV89083.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Zymomonas mobilis subsp. mobilis ZM4]
          Length = 416

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 91/266 (34%), Positives = 134/266 (50%), Gaps = 2/266 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           I S +E I+A RYL   +  AFI + + IS   V +GV ALI+VMSVMNGFR ++  +++
Sbjct: 2   ILSAYERIIARRYLLPGKGEAFIFLVASISLFAVTLGVAALIIVMSVMNGFRAELFDKIV 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           GINGH VIQ     L +++ I       P V   +P +  Q  ++  +    GVL+RG++
Sbjct: 62  GINGHAVIQGYNGELANWRPILEATRKTPGVTSAIPLIE-QPLMATHAGRVEGVLLRGMA 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +D +      S       N+   G   VIIG  LA  LGI  GD I+++SP G  TP G
Sbjct: 121 LNDVNNNNLIRSNIREGHLNELKAGSNNVIIGIRLAEQLGIHAGDDISLISPAGQTTPFG 180

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R  SY V  +F +   DYD   V M L +AQ    + + V  IE+   + D + +  
Sbjct: 181 TVPRIVSYRVAAIFEVGVYDYDKAFVIMPLSDAQTLLMMNDTVGIIEIKTNNADRVGQIL 240

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
           + +   + N  V+ DW+      F  
Sbjct: 241 DPLKDRVANVGVLQDWRNMNASLFQA 266


>gi|89902001|ref|YP_524472.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Rhodoferax ferrireducens T118]
 gi|89346738|gb|ABD70941.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodoferax ferrireducens T118]
          Length = 418

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/278 (31%), Positives = 155/278 (55%), Gaps = 27/278 (9%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+I+ WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YELILGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYP----LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVR 119
           +  H+ I   + P    L D     +++   P V+   PF++ QA ++       G +VR
Sbjct: 65  VVSHIEI---FAPNGAALPDAALTLSQVRAHPQVVGAAPFIATQALLAR-GEDMKGTMVR 120

Query: 120 GISN------SDFSY-LQNS-FSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINIL 171
           GI        +D +  L+N+  SR    +  +F    GV++G +LAR+LG+  GDK+ ++
Sbjct: 121 GIDPAREPEVTDLAIDLKNTGLSRL---IPGEF----GVVLGGELARSLGVRQGDKVTLV 173

Query: 172 SPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFV 231
           +P G VTP G+  R K  TV+G F     +YD+ +V M +++A   F LE   +G+ V +
Sbjct: 174 APSGQVTPAGIVPRLKQMTVVGTFDSGHFEYDSALVLMHIEDAARIFRLEGP-TGVRVKL 232

Query: 232 KDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +D     +   ++ + L   +++ DW ++ + +F+  +
Sbjct: 233 RDLHQAREVAADLAKTLTGELLIRDWTRQNRTWFAAVQ 270


>gi|110679328|ref|YP_682335.1| lipoprotein releasing system transmembrane protein, putative
           [Roseobacter denitrificans OCh 114]
 gi|109455444|gb|ABG31649.1| lipoprotein releasing system transmembrane protein, putative
           [Roseobacter denitrificans OCh 114]
          Length = 428

 Score =  140 bits (353), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 87/278 (31%), Positives = 136/278 (48%), Gaps = 17/278 (6%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++AWRYL + R    +S+ ++IS IG+ + V ALI  +SV +GFR + +  +LG
Sbjct: 8   FAGFEWMIAWRYLRARRSEGGVSVMTWISLIGITLAVFALIATLSVRSGFRAEFVDTILG 67

Query: 64  INGHVVI---------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +          Q    + D+  IA  L  +P V +V P V GQ   +      +
Sbjct: 68  ANAHVTVYALASVTENGQMDRTIPDFDAIAAELAVVPGVTRVAPLVRGQVMAAHRGRN-A 126

Query: 115 GVLVRGISNSDFSYLQNSFSRFYGNVSN--DFDR-GKGVIIGKDLARNLGISIGDKINIL 171
           GV V G++  +      S  R     ++  D  R G+G+ +G  +AR LG+ IGD+I ++
Sbjct: 127 GVEVFGVAPENL----RSLPRIADPATSRGDIARFGEGIALGSGVARELGVGIGDRIRLI 182

Query: 172 SPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFV 231
           SP G  T  G   R  +Y V  +F     D D    Y+  +EAQ +FN +     IEV V
Sbjct: 183 SPDGVKTAFGTSPRVNAYEVTYIFTAGRYDIDRTRAYLPFKEAQSFFNRQGVADEIEVMV 242

Query: 232 KDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           ++P+ I+     +++  G    +  WQ     F    E
Sbjct: 243 QEPERIDLMRMELLKAAGERGQLWTWQDASGGFLRALE 280


>gi|283138921|gb|ADB12524.1| permease protein LolE [uncultured bacterium 9F08]
          Length = 415

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 82/270 (30%), Positives = 141/270 (52%), Gaps = 4/270 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           ++   ++ +  RY  + R+N FIS  S  S +G+ +GV ALI V+SVMNGF  ++ +R+L
Sbjct: 1   MYRPLQLFIGLRYTRAKRRNHFISFISLTSMLGIALGVTALITVLSVMNGFETELRQRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQA-FVSGLSSGGSGVLVRGI 121
           G+  H  I     PL  +Q +++  D  P+V+   P++  +   V G    GS  ++RGI
Sbjct: 61  GMTSHATISGYGQPLTRWQGLSDIADTHPEVLGSAPYIQKEGMLVHGQEVNGS--ILRGI 118

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
                  + +          +D   G+  +I+G DLAR LG+  GDK+ +++P  +VTP 
Sbjct: 119 LPQQEPKVSSVGEDMLHGSLDDLQAGEFRIILGVDLARILGVMPGDKVTLVTPSANVTPA 178

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G+  R K +TV G+F +   +YD+ M  + L +A+  F +++AV+G+ + + D       
Sbjct: 179 GVMPRMKRFTVSGIFEVGMYEYDSAMALIHLDDARRLFRMDDAVTGLRLKLDDMFRAPLV 238

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYES 270
              +   L     V DW Q +  FF   ++
Sbjct: 239 SRELAERLPGIYQVRDWTQYHANFFRAIKT 268


>gi|260753029|ref|YP_003225922.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Zymomonas mobilis subsp. mobilis NCIMB 11163]
 gi|258552392|gb|ACV75338.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Zymomonas mobilis subsp. mobilis NCIMB 11163]
          Length = 416

 Score =  140 bits (352), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 91/266 (34%), Positives = 135/266 (50%), Gaps = 2/266 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           I S +E I+A RYL   +  AFI + + IS + V +GV ALI+VMSVMNGFR ++  +++
Sbjct: 2   ILSAYERIIARRYLLPGKGEAFIFLVASISLLAVTLGVAALIIVMSVMNGFRAELFDKIV 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           GINGH VIQ     L +++ I       P V   +P +  Q  ++  +    GVL+RG++
Sbjct: 62  GINGHAVIQGYNGELANWRPILEATRKTPGVTSAIPLIE-QPLMATHAGRVEGVLLRGMA 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +D +      S       N+   G   VIIG  LA  LGI  GD I+++SP G  TP G
Sbjct: 121 LNDVNNNNLIRSNIREGHLNELKAGSNNVIIGIRLAEQLGIHAGDDISLISPAGQTTPFG 180

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R  SY V  +F +   DYD   V M L +AQ    + + V  IE+   + D + +  
Sbjct: 181 TVPRIVSYRVAAIFEVGVYDYDKAFVIMPLSDAQTLLMMNDTVGIIEIKTNNADRVGQIL 240

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
           + +   + N  V+ DW+      F  
Sbjct: 241 DPLKDRVVNVGVLQDWRNMNASLFQA 266


>gi|170703292|ref|ZP_02894087.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia ambifaria IOP40-10]
 gi|170131802|gb|EDT00335.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia ambifaria IOP40-10]
          Length = 417

 Score =  140 bits (352), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 147/275 (53%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N FIS  + +S +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRAGKRTTGNGFISFIALVSMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV +      + ++Q  A      P V    P+V  QA ++      SGV++RGI  
Sbjct: 65  VLAHVEVFSPTGSMPNWQLTAQEARRNPLVTGAAPYVDAQALLT-RQDAVSGVMLRGIEP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPY 174
           S    L+   S    ++  D   G+         G+++G  LA NLG+++GDKI +++P 
Sbjct: 124 S----LEPQVS----DIGKDMKAGQLTALVPGQFGIVLGDALAGNLGVTVGDKITLVAPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G +TP GM  R K +TV+G+F     +YD+ +  + +++A+  F + +A +G+ + + D 
Sbjct: 176 GTITPAGMMPRLKQFTVVGVFESGHYEYDSTLAMVDIRDAEALFRM-SAPTGVRLRLTDM 234

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    +   L   + + DW Q+ + +FS  +
Sbjct: 235 QKAPQVAVELSHTLSGSLYIRDWTQQNKTWFSAVQ 269


>gi|260223258|emb|CBA33640.1| Lipoprotein-releasing system transmembrane protein lolC
           [Curvibacter putative symbiont of Hydra magnipapillata]
          Length = 418

 Score =  139 bits (351), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 150/277 (54%), Gaps = 25/277 (9%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FE+ + WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+LG
Sbjct: 5   FELTIGWRYTRAGRATRRNGFISFISGVSMLGISLGVAALIIVLSVMNGFQKEVRDRMLG 64

Query: 64  INGHVVI---QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           +  H+ +     +  P V       + +  P VI   PF++ QA ++       G +VRG
Sbjct: 65  VVSHIEVYAADGQALPNVATTMAQAKEN--PQVIGAAPFIAAQALIA-RGEEMKGAMVRG 121

Query: 121 ISN------SDFSY--LQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           I        SDF+    Q + +     V  +F    GV++G +LAR++G+ +GDK+ +++
Sbjct: 122 IDPALEPQVSDFATGAQQEALAWL---VPGEF----GVVLGGELARSMGVRVGDKVTLVA 174

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G VTP G+  R K  TV+G F     +YD+ +  +  ++A   F LE   SG+ + +K
Sbjct: 175 PNGQVTPAGVVPRLKQMTVVGTFDSGHYEYDSALALLHWEDAARIFRLEGP-SGVRLKLK 233

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           D     +  + + R L   +V+ DW ++ + +F+  +
Sbjct: 234 DLHQAREVADQLARSLSGDLVLRDWTRQNRSWFAAVQ 270


>gi|326318409|ref|YP_004236081.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidovorax avenae subsp. avenae ATCC 19860]
 gi|323375245|gb|ADX47514.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidovorax avenae subsp. avenae ATCC 19860]
          Length = 417

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 83/267 (31%), Positives = 141/267 (52%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ + WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YELALGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVI-QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  HV I   +   L D           P+V+   PFV  QA ++       G LVRGI 
Sbjct: 65  VVSHVEIFAPQGAALPDPALTMAEARKNPEVVGAAPFVGSQALIAR-GEDMKGALVRGID 123

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
            +    + +  ++    V         V++G +LAR LG+ +GD + +++P G VTP G+
Sbjct: 124 PAREGEVTDLAAKNADAVQTLTPGSFHVVLGVELARALGVRVGDPVTLIAPGGQVTPAGV 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K  TV G+F     +YD+ +V M   +A+  F LE   +GI + ++D     +  +
Sbjct: 184 VPRLKQMTVSGLFESGHYEYDSALVLMHHADAERIFRLEGP-TGIRLKLRDLHQAPEVTQ 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + R L   +++ DW Q+ + +F+  +
Sbjct: 243 ELARSLSGDLLIRDWTQQNRTWFAAVQ 269


>gi|190571458|ref|YP_001975816.1| lipoprotein releasing system transmembrane protein lolc [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213018859|ref|ZP_03334667.1| lipoprotein releasing system transmembrane protein lolc [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|190357730|emb|CAQ55180.1| lipoprotein releasing system transmembrane protein lolc [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212995810|gb|EEB56450.1| lipoprotein releasing system transmembrane protein lolc [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 409

 Score =  139 bits (350), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 96/257 (37%), Positives = 137/257 (53%), Gaps = 12/257 (4%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE  +A RYL + + + F SI +  S IG+ +GV  LIVVMSVMNGFR  ++  VLGING
Sbjct: 5   FEFTMAIRYLRA-KNSRFCSIMALFSIIGIALGVATLIVVMSVMNGFRAKLLDSVLGING 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+ +        DY  +   ++ IP V+K     + Q  V+  +SG  G +VRG+S  D 
Sbjct: 64  HINVYFDRSINSDYHAVLKSIEKIPGVLKATSMTNDQVIVAA-NSGIVGSVVRGVSTKDL 122

Query: 127 SYLQNSFSR---FYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
             L N+  +     GNV   FD  +G+IIG  LA  L I  GD I ++SP G     G  
Sbjct: 123 --LNNTIVKNNVIMGNVEK-FD--EGIIIGARLAEALNIDYGDNIMLISPEGFDALSGEI 177

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            + K Y V+ +F M   +YDN ++YM ++ A+ +FN ++ V  IEVFV D     K    
Sbjct: 178 PKMKEYKVVAIFDMGMFEYDNTLMYMPIKSAKAFFNYKDNVRNIEVFVDDIAMANKLANA 237

Query: 244 IVRILGNGVVVIDWQQR 260
           I +    G+    WQ +
Sbjct: 238 IAK--ETGMRAESWQSQ 252


>gi|303248491|ref|ZP_07334749.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio fructosovorans JJ]
 gi|302490111|gb|EFL50031.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio fructosovorans JJ]
          Length = 409

 Score =  139 bits (350), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 132/237 (55%), Gaps = 5/237 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE  +A RYL + +K AFIS+ S IS +GV +GV +LIVV+ VMNGF  ++  ++LGIN 
Sbjct: 3   FEYFIAKRYLLARQKQAFISVISLISILGVGLGVASLIVVVGVMNGFSSELRDKILGINA 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+V       L  Y+    +++ +P V+   PFV  +  +S    G  GV++RG+     
Sbjct: 63  HMVAAVAGGALHHYREDMKKVEAVPGVLGATPFVYTEVMLSS-PRGVKGVVLRGVDPVSA 121

Query: 127 SYLQNSFSRFYGNVSNDFDRG---KGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
             +             D D      G+I+G++LA  LG+S+GD IN++SP G  +  G  
Sbjct: 122 GKVLALPQEMVAGKLADLDTPGLFPGIIVGRELADRLGLSLGDTINLMSPAGKESAAGFS 181

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAV-SGIEVFVKDPDAIEK 239
            + K++T+ G+F+    +YD+ + Y+++  AQ     +  + +G+E+ V D DA+ +
Sbjct: 182 PKVKTFTIRGLFKTGMYEYDSTLAYVTIPAAQELLGFKRDIATGLELKVADVDAVTR 238


>gi|120601937|ref|YP_966337.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Desulfovibrio vulgaris DP4]
 gi|120562166|gb|ABM27910.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio vulgaris DP4]
          Length = 411

 Score =  138 bits (348), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 89/250 (35%), Positives = 135/250 (54%), Gaps = 7/250 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ VA RYLF+ RK AFIS+ S +S IGV +GV +LIVV+ VMNGF  D+  ++LG N 
Sbjct: 3   FELFVAGRYLFARRKQAFISVISAMSIIGVGLGVASLIVVLGVMNGFTTDLRDKILGANA 62

Query: 67  HVVI-QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
           HV++   K   + D   +  R+  +  V    PF+  +  +S    G  G+++RGI    
Sbjct: 63  HVIVMSSKPAAMRDVGELMGRVQGVRGVKGATPFIYSETMLS-TPHGVKGLVLRGIDPQT 121

Query: 126 FSYLQNSFSRFYGNVSNDF----DRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
              + +  SR       D     D   G+IIG++LA  LGI+ G ++N+LSP G  T  G
Sbjct: 122 APGVLSILSRMTRGGLRDLPAGPDGAHGIIIGQELANRLGITTGSRVNLLSPDGQKTTTG 181

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPDAIEKT 240
              R + + V G+F     +YD+ + +++L  A+    L E  VSGIEV V D    +  
Sbjct: 182 FAPRIRPFRVAGIFTTGMYEYDSSLGFVTLDAARDILGLPEGQVSGIEVVVDDVYKADVI 241

Query: 241 HENIVRILGN 250
            E++++  G 
Sbjct: 242 GEDVLKASGG 251


>gi|162956012|gb|ABY25370.1| lipoprotein releasing system transmembrane protein [Bartonella
           durdenii]
          Length = 166

 Score =  138 bits (348), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 69/166 (41%), Positives = 103/166 (62%)

Query: 8   EVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGH 67
           E ++A+RY+  N+K+   S+ S IS IG+M+GV ALIVVM+VMNGFR +++ R+LG+NGH
Sbjct: 1   EWMIAFRYMIPNKKHVVASVISIISLIGIMLGVFALIVVMAVMNGFRTELLNRILGMNGH 60

Query: 68  VVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFS 127
           +++Q  +    DY+ + + L+ +  V   LP V GQA V G   GGSG LVRG+   D  
Sbjct: 61  LIVQAVHSGFSDYKTLISSLESVNGVKFSLPVVEGQALVQGELEGGSGALVRGMRKQDLE 120

Query: 128 YLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSP 173
            L+             FD+ +GV IG  LA  LG+++G  + I++P
Sbjct: 121 KLKTVSQNIKLGSLAQFDKEEGVAIGSGLATKLGLTVGRDLRIITP 166


>gi|46580780|ref|YP_011588.1| lipoprotein releasing system, permease [Desulfovibrio vulgaris str.
           Hildenborough]
 gi|46450200|gb|AAS96848.1| lipoprotein releasing system, permease protein [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|311234488|gb|ADP87342.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio vulgaris RCH1]
          Length = 411

 Score =  138 bits (348), Expect = 7e-31,   Method: Compositional matrix adjust.
 Identities = 89/250 (35%), Positives = 135/250 (54%), Gaps = 7/250 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ VA RYLF+ RK AFIS+ S +S IGV +GV +LIVV+ VMNGF  D+  ++LG N 
Sbjct: 3   FELFVAGRYLFARRKQAFISVISAMSIIGVGLGVASLIVVLGVMNGFTTDLRDKILGANA 62

Query: 67  HVVI-QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
           HV++   K   + D   +  R+  +  V    PF+  +  +S    G  G+++RGI    
Sbjct: 63  HVIVMSSKPAAMRDVGELMGRVQDVRGVKGATPFIYSETMLS-TPHGVKGLVLRGIDPQT 121

Query: 126 FSYLQNSFSRFYGNVSNDF----DRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
              + +  SR       D     D   G+IIG++LA  LGI+ G ++N+LSP G  T  G
Sbjct: 122 APGVLSILSRMTRGGLRDLPAGPDGAHGIIIGQELANRLGITTGSRVNLLSPDGQKTTTG 181

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPDAIEKT 240
              R + + V G+F     +YD+ + +++L  A+    L E  VSGIEV V D    +  
Sbjct: 182 FAPRIRPFRVAGIFTTGMYEYDSSLGFVTLDAARDILGLPEGQVSGIEVVVDDVYKADVI 241

Query: 241 HENIVRILGN 250
            E++++  G 
Sbjct: 242 GEDVLKASGG 251


>gi|254488102|ref|ZP_05101307.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Roseobacter sp. GAI101]
 gi|214044971|gb|EEB85609.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Roseobacter sp. GAI101]
          Length = 448

 Score =  138 bits (348), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 82/277 (29%), Positives = 142/277 (51%), Gaps = 15/277 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++AWRYL + R    +S+ ++IS IG+ + V ALI  ++V +GFR + +  +LG
Sbjct: 28  FAPFEWMIAWRYLRARRAEGGVSVMTWISLIGITLAVFALIATLAVRSGFRAEFVGTILG 87

Query: 64  INGHVVIQQ---------KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV I               + DY  +A R+  +P V    P V GQ  ++      +
Sbjct: 88  ANAHVTIYNAATVDDNGGTQTGIADYTQMAERVAAVPGVTHAAPLVRGQ-VMANKGQANA 146

Query: 115 GVLVRGISNSDFSYLQN--SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           G+ + GI  +D + +    +     G+++N FD  +G+ IG  +A++L + +GD+I I+S
Sbjct: 147 GIEIYGIDGADLANIPRIANPETAVGDLAN-FD--QGIAIGSGVAQSLRVGVGDRIKIIS 203

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R  +Y V+ +F     D D    Y+ L EAQ +F+ E     +EV V+
Sbjct: 204 PNGVKTAFGTSPRVNAYDVVYVFSAGRYDIDRTRAYLPLAEAQSFFDREGLADELEVMVE 263

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           DPD +++  + ++   G+  +   W+     F +  +
Sbjct: 264 DPDRVDELTDALLLAAGDRGMAWTWRDASGSFLNALD 300


>gi|332039127|gb|EGI75549.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Hylemonella gracilis ATCC 19624]
          Length = 427

 Score =  138 bits (348), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 88/277 (31%), Positives = 148/277 (53%), Gaps = 16/277 (5%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ + WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+LG
Sbjct: 5   YELSLGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLG 64

Query: 64  INGHVVI-QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  H+ I       L D       +   P V+   PF++ QA ++       G ++RGI 
Sbjct: 65  VVSHIEIYSADGLALPDAGRTLELVRQHPQVVGAAPFIAAQALLA-RGEDMKGAVLRGIV 123

Query: 123 NSDFSYLQNSFSRFYGNVSND--FDR---GK-GVIIGKDLARNLGISIGDKINILSPYGD 176
                 + +      G   N    +R   G+ G+++G++LAR LG+ +GD + +++P G 
Sbjct: 124 PGLEGQVTDLAEGLQGEAGNARVLERLVPGEFGIVLGRELARQLGVRVGDPVTLIAPSGQ 183

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
           VTP G+  R K  TV+G+F     +YD G+  M + +A   F LE A +GI V +KD   
Sbjct: 184 VTPAGVLPRMKQMTVVGLFHSGHYEYDAGLALMHVADAARIFRLEGA-TGIRVKLKDLHQ 242

Query: 237 IEKTHENIV----RILGNGVVVIDWQQRYQIFFSCYE 269
             +   ++V    R   + +VV DW Q+ + +F+  +
Sbjct: 243 AREVASDLVISLTRQQNHDLVVRDWTQQNRTWFAAVQ 279


>gi|121610122|ref|YP_997929.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Verminephrobacter eiseniae EF01-2]
 gi|121554762|gb|ABM58911.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Verminephrobacter eiseniae EF01-2]
          Length = 420

 Score =  138 bits (348), Expect = 8e-31,   Method: Compositional matrix adjust.
 Identities = 87/271 (32%), Positives = 143/271 (52%), Gaps = 14/271 (5%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ + WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++D+  R+L 
Sbjct: 8   YELALGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKDVRDRMLS 67

Query: 64  INGHVVI-QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  H+ I   +   L D      +     +VI   PFVS QA ++       G LVRGI 
Sbjct: 68  VVSHIEIFAPRGAALADPALTLAQARQNVNVIGAAPFVSAQALLAR-GEDMKGALVRGID 126

Query: 123 NS---DFSYLQNSFSRFYGN-VSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
            +     + L  S +R  G  V   F     V++G  LAR+LG+ +GD + +++P G +T
Sbjct: 127 PALEGAVTDLAASNARLLGRLVPGQFR----VVLGSVLARDLGVGVGDAVTLIAPAGQLT 182

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K  TV GMF     +YD+ +V +  Q+AQ    LE   +G+ + ++D     
Sbjct: 183 PAGVVPRLKQMTVAGMFDSGHYEYDSALVLLHHQDAQRILRLEGP-TGVRLKLRDLHRAH 241

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
                + + L   +++ DW Q+ + +F+  +
Sbjct: 242 AVAGELAQTLSGALLIRDWTQQNRTWFAAVQ 272


>gi|332107764|gb|EGJ08988.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Rubrivivax benzoatilyticus JA2]
          Length = 418

 Score =  138 bits (347), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 138/268 (51%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLFSNR---KNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  V WRY  + R   +N FIS  S IS +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YEWHVGWRYTRAGRAGRRNGFISFISAISVLGITLGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYY-PLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +   V I +     L D+Q  A      P+V+   PFV+ Q  V G      G +VRGI 
Sbjct: 65  VISAVEIHEAGGGALPDWQATAAAARARPEVVGAAPFVAAQTLV-GRGDVLRGAVVRGIE 123

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +  + +     R           G+   +IG +LAR LG+ +GD I I +P G  TP G
Sbjct: 124 PAAEAEITELAQRLRDRELAALQPGQWHAVIGAELARLLGVRVGDTITIAAPGGQFTPAG 183

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R K +TV G F     +YD+G+V ++L +A   F      +G+++ + D     +  
Sbjct: 184 VVPRLKQFTVSGTFEAGHYEYDSGLVLIALDDAARLFQ-TGGPTGVQLKLADVHQARRVG 242

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           + + + LG  VVV DW Q  + +F   +
Sbjct: 243 DELAQALGPAVVVRDWTQTNRNWFDAVQ 270


>gi|124267933|ref|YP_001021937.1| putative lipoprotein releasing system transmembrane [Methylibium
           petroleiphilum PM1]
 gi|124260708|gb|ABM95702.1| putative lipoprotein releasing system transmembrane [Methylibium
           petroleiphilum PM1]
          Length = 418

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 144/268 (53%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLF---SNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ + WRY     S R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YELTIGWRYTRAGRSGRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVI-QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  HV I +     L D++  A      P+V+   PF++ QA ++       G +VRGI 
Sbjct: 65  VIAHVEIFEAGGNALPDWRATAAAARGNPEVLGAAPFIATQALIA-RGEDMRGAVVRGID 123

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            ++ + +    ++           G  G+++G +LAR LG+ +GD + +++P G VTP G
Sbjct: 124 PAEEANVTPLAAQSRDGAFAGLKPGAWGIVLGGELARTLGVKVGDPVTLVTPNGQVTPAG 183

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R K  TV+G F     +YD+G+  M + +A   F ++   +G+++ ++D     +  
Sbjct: 184 VVPRLKQMTVVGTFNAGHYEYDSGLALMHIDDAARLFRVDGP-TGVQLRLRDQQQARRVG 242

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +   LG  V V DW +  + +F   +
Sbjct: 243 FELAEQLGPTVSVRDWTRTNRNWFDAVQ 270


>gi|83748273|ref|ZP_00945299.1| LolC [Ralstonia solanacearum UW551]
 gi|83725114|gb|EAP72266.1| LolC [Ralstonia solanacearum UW551]
          Length = 823

 Score =  137 bits (346), Expect = 1e-30,   Method: Composition-based stats.
 Identities = 82/268 (30%), Positives = 148/268 (55%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  + ++   N+FIS  S IS +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 412 YEWQIGWRYTRAGKRATRNSFISFISLISMLGIALGVTALIVVLSVMNGFQKEVRDRMLS 471

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ I      L D+Q  AN      +V+   P+V  QA ++       GVL+RG+S 
Sbjct: 472 VLSHIEIMAPG-SLPDWQRTANEALQNKEVVGAAPYVGAQAMIT-RDDAVRGVLLRGVSP 529

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           +D   + +    F     +D   G+ G+ +G +LAR LG+  GDK+ +++P G +TP G+
Sbjct: 530 ADEPKVSDIAKDFKSGGIDDLKPGEFGIALGSELARGLGVRQGDKVTLVAPQGTITPAGV 589

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G F     ++D+ +  + + +A+  F L+   +G+ + + D     +  E
Sbjct: 590 LPRMKQFTVIGTFESGHYEFDSSLALIHIDDAERLFRLDGP-TGVRLKLVDMQRAPQVAE 648

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYES 270
            + R L   + + DW ++ + +F+  ++
Sbjct: 649 ALSRTLTGELYIRDWSRQNKNWFAAVQT 676


>gi|120612344|ref|YP_972022.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Acidovorax citrulli AAC00-1]
 gi|120590808|gb|ABM34248.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidovorax citrulli AAC00-1]
          Length = 417

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 82/267 (30%), Positives = 140/267 (52%), Gaps = 6/267 (2%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ + WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YELALGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVI-QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  H+ I   +   L D           P+V+   PFV  QA ++       G LVRGI 
Sbjct: 65  VVSHIEIFAPQGAALPDPALTMAETRKNPEVVGAAPFVGSQALIAR-GEDMKGALVRGID 123

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
                 + +  +R    V         V++G +LAR LG+ +GD + +++P G VTP G+
Sbjct: 124 PDREGEVTDLAARNADAVRTLTPGSFHVVLGVELARALGVRVGDPVTLIAPGGQVTPAGV 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K  TV G+F     +YD+ +V +   +A+  F LE   +GI + ++D     +  +
Sbjct: 184 VPRLKQMTVSGIFESGHYEYDSALVLLHHADAERIFRLEGP-TGIRLKLRDLHQAPEVTQ 242

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + R L   +++ DW Q+ + +F+  +
Sbjct: 243 ELARSLSGDLLIRDWTQQNRTWFAAVQ 269


>gi|307824113|ref|ZP_07654340.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylobacter tundripaludum SV96]
 gi|307734897|gb|EFO05747.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylobacter tundripaludum SV96]
          Length = 415

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/261 (31%), Positives = 137/261 (52%), Gaps = 2/261 (0%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +  RY  + R+  FIS  +  S +G+ +GV ALI V+SVMNGF  ++ +R+LG+  H   
Sbjct: 9   IGLRYTRAKRRTQFISFITLTSVLGIALGVTALIAVLSVMNGFEAELRERILGMTSHATA 68

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQ 130
             KY  L ++Q +  +L   P V    PF++GQ  ++      SG ++ GI     S + 
Sbjct: 69  TGKYGQLDNWQDLERKLKNYPHVEGTAPFINGQVMINA-DRRVSGTMLTGILPEYESRVS 127

Query: 131 NSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSY 189
               +      +D   G+ G+I+G +LA  LG+ +GDKI ++SP  + TP G+  R + +
Sbjct: 128 EVADKMKEGKLSDLVPGEYGIILGVELANYLGVFMGDKITVISPQINSTPAGIVPRMRRF 187

Query: 190 TVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILG 249
           TV+G+F++   +YD  M  + L +A   F L++AVSG+ + + D     K    +   L 
Sbjct: 188 TVVGIFKVGMYEYDRNMAMIHLDDAAKLFRLDDAVSGLRIKLDDLFNAPKITRALSNALY 247

Query: 250 NGVVVIDWQQRYQIFFSCYES 270
           +   V DW   +  FF   ++
Sbjct: 248 DDYQVSDWTLAHNNFFRAIQT 268


>gi|254509482|ref|ZP_05121549.1| lipoprotein releasing system transmembrane protein LolE
           [Rhodobacteraceae bacterium KLH11]
 gi|221533193|gb|EEE36181.1| lipoprotein releasing system transmembrane protein LolE
           [Rhodobacteraceae bacterium KLH11]
          Length = 487

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 135/277 (48%), Gaps = 15/277 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE  +AWRYL + R    +S+ ++IS IG+ + V ALI  ++V +GFR + +  +LG
Sbjct: 67  FAPFEWKIAWRYLRARRAEGGVSVMTWISLIGITLAVFALIATLAVRSGFRSEFVGTILG 126

Query: 64  INGHVVI--------QQKY-YPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +        Q +    + D+  +A R+  +P V +  P V GQ  ++  +   +
Sbjct: 127 ANAHVSVYSAGDLNAQGRLDRTIADFDAMAERVAQVPGVERAAPLVKGQVLITN-ADRST 185

Query: 115 GVLVRGISNSDFSYLQN--SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           GV V GI   D + L       + YG++S   D   G+ IG  +AR +G ++GD++ + S
Sbjct: 186 GVQVFGIRPDDLNDLPGIAESEQAYGDLSRFPD---GIAIGSGVARAIGATVGDRVKLTS 242

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R  +Y V+ +F     D D   VYM   EAQ +FN E     IEV V+
Sbjct: 243 PNGVKTAFGTSPRVNAYEVVYVFSAGRFDIDRTRVYMPFTEAQSFFNREGVADEIEVMVE 302

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            P+ +      I+   G    +  WQ     F    E
Sbjct: 303 RPEELSPILIPILEAAGERSQIWTWQDASGGFLRALE 339


>gi|88810799|ref|ZP_01126056.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Nitrococcus mobilis Nb-231]
 gi|88792429|gb|EAR23539.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Nitrococcus mobilis Nb-231]
          Length = 415

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 133/269 (49%), Gaps = 2/269 (0%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F   ++ +  RY  + R+N F+S  S  S +G+ +GV ALI V+SVMNGF  ++ +R+L
Sbjct: 1   MFRPLQLYIGLRYTKAKRRNHFVSFISLTSMLGIAVGVTALITVLSVMNGFEHELRERIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  +     PL  +Q +   L   P V    P+VSG+  ++   S  +G LVRGI 
Sbjct: 61  GMVAHATVASFAGPLDHWQALTRDLREQPYVEGAAPYVSGEVMLTR-GSAVTGALVRGIL 119

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            ++   +     +      +D   G  G+I+G  LAR LG+ +GD I +++P   ++  G
Sbjct: 120 PAEEPSVSQVLDKVVAGRVSDLKPGTFGIILGGGLARALGVEVGDDITVVTPEARISVAG 179

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R + + V+ +F +    YD  +  M L +A+L F     V+GI +   D  A  +  
Sbjct: 180 ILPRIRRFHVVALFEVDMSQYDRSLALMHLDDARLLFRTGKGVTGIRLRFDDLLAAPRLA 239

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYES 270
                 L     V DW ++ + FF    +
Sbjct: 240 RKAAAHLPGFYRVSDWTEQNRNFFRAVST 268


>gi|171059079|ref|YP_001791428.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Leptothrix cholodnii SP-6]
 gi|170776524|gb|ACB34663.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Leptothrix cholodnii SP-6]
          Length = 418

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 88/268 (32%), Positives = 138/268 (51%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLFSNRKNA---FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ + WRY  + R      FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YEMRIGWRYTRAGRGGRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHV-VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  HV V      PL D+Q +A +L   P V    PFV+ QA ++       GVLVRGI 
Sbjct: 65  VIAHVEVYGNGGEPLADWQALAAQLQRHPQVKATAPFVAAQALIA-RGDDMRGVLVRGID 123

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            ++ + +    ++    V      G  GV++G  LAR+LG+  GD I +++P G  TP G
Sbjct: 124 PAEEADVTALGAQLKDGVLKRLQPGSWGVVLGAQLARSLGVQEGDSITLVTPSGQTTPAG 183

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R K  TV G+F     +YD+GM  M + +A   F       G+++ + D        
Sbjct: 184 VVPRLKQVTVAGVFNAGHYEYDSGMALMHIDDAARLFR-TGGPQGVQLRLADLHQARTVA 242

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            ++V  LG    V DW +    +F   +
Sbjct: 243 ADLVGGLGPAYQVRDWTRTNATWFDAVQ 270


>gi|254448002|ref|ZP_05061466.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [gamma proteobacterium HTCC5015]
 gi|198262428|gb|EDY86709.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [gamma proteobacterium HTCC5015]
          Length = 416

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 83/275 (30%), Positives = 142/275 (51%), Gaps = 13/275 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F  FE+ +  RY  + R+N FIS  S IS +G+ +GV ALI V+SVMNGF  ++ +R+L
Sbjct: 1   MFQPFELFIGLRYTRAKRRNHFISFISLISILGIALGVWALITVISVMNGFESELRERIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I      + D+  +  + +  P+VI   P+V  Q     L  GG   G + RG
Sbjct: 61  GMTSHATISAYNGAMRDWDSVIQQAETHPEVIGAAPYVESQLM---LLKGGEVNGAIARG 117

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGKG----VIIGKDLARNLGISIGDKINILSPYGD 176
           +       + +   +    V   FD  K     +++G +LAR L + + DK+ ++SP  +
Sbjct: 118 VLPQQERKVADVEDKM---VVGSFDSLKAGEWNIVLGSELARALRLRLFDKVTVVSPQTN 174

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEA-QLYFNLENAVSGIEVFVKDPD 235
           +T  G   R K++T+ G+F +   +YD+G+V++   +A +L    E  V+G+ + + D  
Sbjct: 175 ITAAGFIPRLKTFTLTGVFELGMNEYDSGLVFLHAADAGKLMRMPEGGVTGVRLKLTDMF 234

Query: 236 AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES 270
              +  E +   +G    V DW QR+  FF   ++
Sbjct: 235 EAGRIGEEVANEVGEQYWVSDWTQRHANFFKAIKT 269


>gi|225630889|ref|YP_002727680.1| lipoprotein releasing system transmembrane protein lolc [Wolbachia
           sp. wRi]
 gi|225592870|gb|ACN95889.1| lipoprotein releasing system transmembrane protein lolc [Wolbachia
           sp. wRi]
          Length = 409

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 93/269 (34%), Positives = 147/269 (54%), Gaps = 16/269 (5%)

Query: 7   FEVIVAWRYLFSNRKNA-FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           FE+ +A  YL    KNA F SI +  S IG+ +GV  LIVVMSVMNGFR  ++  +LGI+
Sbjct: 5   FEITMAACYL--RAKNARFCSIMTLFSIIGIALGVATLIVVMSVMNGFRAKLLDSILGID 62

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG-SGVLVRGISNS 124
           GH+ +        DY  ++  ++ IP ++K  P  + Q  +  +++G  +G +VRG+S  
Sbjct: 63  GHINVYFDRNINSDYYAVSKSIERIPGILKATPMTNDQVII--VANGKIAGSVVRGVSTK 120

Query: 125 DF---SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
           D    + + N+     G+V   FD  +G+IIG  LA  L +  GD+I  +S       +G
Sbjct: 121 DLLDSTAVTNNV--IIGDVKK-FD--EGIIIGARLAEALNVDYGDEITFISSEEFDALLG 175

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R K Y V+ +F M   +YDN ++YM L+ AQ +FN +N++  IEV V D    +K  
Sbjct: 176 EMPRMKKYKVIAIFDMGMFEYDNTLIYMPLKSAQAFFNYKNSIKNIEVLVDDVTRADKLA 235

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYES 270
           + I + +  G+    WQ +   +FS  ++
Sbjct: 236 DAIEKEI--GMEAESWQSQQSHYFSALKT 262


>gi|218779632|ref|YP_002430950.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfatibacillum alkenivorans AK-01]
 gi|218761016|gb|ACL03482.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfatibacillum alkenivorans AK-01]
          Length = 415

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 144/274 (52%), Gaps = 12/274 (4%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ +  RYL + R+ AF S+ + +S  GV +GV ALIVV++VM G    + +R+LG   
Sbjct: 3   FELFIGGRYLRAKRREAFASLITVLSLCGVGLGVTALIVVIAVMTGAEAHIKERILGSTP 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDF--IPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI--- 121
           HV++          +++  R +   +P V+   PF+  QA +     G SG L+RG+   
Sbjct: 63  HVIVMPGGMAQGMGEYMEARKEILQVPGVLGAAPFIQSQAMIRS-RRGASGALLRGVNPA 121

Query: 122 -SNSDFSYLQN-----SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYG 175
            SN  F          ++ R   + +++ +   G+I+GK++A NL +  GD I+I+SP G
Sbjct: 122 LSNEIFDLKDKVEPPGAWDRLVPDEASNPEGRPGIILGKEMASNLNVIPGDVISIISPSG 181

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPD 235
            ++P+GM    +   V+G+F     +YD+ + +M +++AQ +  + + VSG+EV VKD  
Sbjct: 182 TLSPVGMMPTMQRLEVVGVFSGGMYEYDSTLAWMDMKQAQKFLRMGDTVSGMEVRVKDIY 241

Query: 236 AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             ++    I   LG      DW +  +  F   +
Sbjct: 242 KADRIASEITGALGPMFWATDWMRMNKNLFEALK 275


>gi|163733472|ref|ZP_02140915.1| lipoprotein releasing system transmembrane protein, putative
           [Roseobacter litoralis Och 149]
 gi|161393260|gb|EDQ17586.1| lipoprotein releasing system transmembrane protein, putative
           [Roseobacter litoralis Och 149]
          Length = 415

 Score =  136 bits (342), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 84/273 (30%), Positives = 136/273 (49%), Gaps = 19/273 (6%)

Query: 10  IVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVV 69
           ++AWRYL + R    +S+ ++IS IG+ + V ALI  +SV +GFR + +  +LG N HV 
Sbjct: 1   MIAWRYLRARRSEGGVSVMTWISLIGITLAVFALIATLSVRSGFRAEFVDTILGANAHVT 60

Query: 70  I---------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           I          Q    + D+  IA +   +P V +V P + GQ  ++      +GV V G
Sbjct: 61  IYALGSVTENGQMDRTMTDFDAIAAQAATVPGVTRVAPLIRGQ-VMAAHQGRNAGVEVFG 119

Query: 121 ISNSDFSYLQN----SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           ++  +   L      + SR  G+++  FD  +G+ +G  +AR LG+ IGD+I ++SP G 
Sbjct: 120 VAPENLRSLPRIADPATSR--GDIAR-FD--EGIALGSGVARELGVGIGDRIRLISPDGV 174

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
            T  G   R  +Y V  +F     D D    Y+   +AQ +FN E     IEV V++P+ 
Sbjct: 175 KTAFGTSPRVNAYEVTYIFTAGRYDIDRTRAYLPFSDAQTFFNREGVADEIEVMVQEPER 234

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +E    ++++  G    +  WQ     F    E
Sbjct: 235 LETVRMDLLKAAGERGQIWTWQDASGGFLRALE 267


>gi|225677321|ref|ZP_03788298.1| lipoprotein releasing system transmembrane protein lolc [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
 gi|225590648|gb|EEH11898.1| lipoprotein releasing system transmembrane protein lolc [Wolbachia
           endosymbiont of Muscidifurax uniraptor]
          Length = 409

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 92/268 (34%), Positives = 146/268 (54%), Gaps = 14/268 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ +A  YL + R   F SI +  S IG+ +GV  LIVVMSVMNGFR  ++  +LGI+G
Sbjct: 5   FEITMAACYLRA-RNARFCSIMTLFSIIGIALGVATLIVVMSVMNGFRAKLLDSILGIDG 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG-SGVLVRGISNSD 125
           H+ +        DY  ++  ++ IP ++K  P  + Q  +  +++G  +G +VRG+S  D
Sbjct: 64  HINVYFDRNINSDYYAVSKSIERIPGILKATPMTNDQVII--VANGKIAGSVVRGVSTKD 121

Query: 126 F---SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
               + + N+     G+V   FD  +G+IIG  LA  L I  GD+I  +S       +G 
Sbjct: 122 LLDSTAVTNNV--IIGDVKK-FD--EGIIIGARLAEVLNIDYGDEITFISSEEFDALLGE 176

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K Y V+ +F M   +YDN ++YM L+ AQ +FN +N++  IEV V D    +K  +
Sbjct: 177 MPRMKKYKVIAIFDMGMFEYDNTLIYMPLKSAQAFFNYKNSIKNIEVLVDDVTRADKLAD 236

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYES 270
            I + +  G+    WQ +   +FS  ++
Sbjct: 237 AIEKEI--GMEAESWQSQQSHYFSALKT 262


>gi|121606146|ref|YP_983475.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Polaromonas naphthalenivorans CJ2]
 gi|120595115|gb|ABM38554.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Polaromonas naphthalenivorans CJ2]
          Length = 418

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 86/278 (30%), Positives = 148/278 (53%), Gaps = 27/278 (9%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+I+ WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+LG
Sbjct: 5   YELILGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLG 64

Query: 64  INGHVVIQQKYYP----LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVR 119
           +  H+   + + P    L D Q     +   P+V+    F++ QA ++       G +VR
Sbjct: 65  VISHI---EVFAPGGGALADPQKTLAEIRANPNVVGAATFIAAQALLAR-GEDMKGTMVR 120

Query: 120 GI--------SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINIL 171
           GI        ++      + SF +    VS  F    GV++G +LAR +G+  GD + ++
Sbjct: 121 GIDPALEGQVTDLAVELEKTSFPKL---VSGQF----GVVLGGELARAMGVREGDTVTLI 173

Query: 172 SPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFV 231
           +P G VTP G+  R K+ TV+G F     +YD+ +V M   +A   F LE   +GI + +
Sbjct: 174 APSGQVTPAGVVPRLKTMTVVGTFDSGHFEYDSALVMMHQDDAAKIFRLEGP-TGIRIKL 232

Query: 232 KDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           KD     +    + + L   +++ DW ++ + +F+  E
Sbjct: 233 KDLHQARQVALELSQTLSGDLLIRDWTRQNKTWFAAVE 270


>gi|239814217|ref|YP_002943127.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Variovorax paradoxus S110]
 gi|239800794|gb|ACS17861.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Variovorax paradoxus S110]
          Length = 418

 Score =  135 bits (339), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 148/270 (54%), Gaps = 11/270 (4%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ + WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+LG
Sbjct: 5   YELKLGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLG 64

Query: 64  INGHVVIQQK---YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           +  H+ I  +     P +D    A R +  P+V+   PF++ QA ++       G LVRG
Sbjct: 65  VVSHIEILSRDGQALPDIDAITAAARKN--PEVVGAAPFIATQALIA-RGEDMKGTLVRG 121

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           I       + +  +       +    G+ G+++G +LAR+L +  GD++ +++P G VTP
Sbjct: 122 IVPRLEPEVTDIATTAQKGTLDKLVPGEFGIVLGGELARSLFVQPGDQVTLVAPGGQVTP 181

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G+  R K +TV+G F     +YD+ +  +  ++AQ  F LE   +GI + +KD +   +
Sbjct: 182 AGVVPRLKQFTVVGTFDSGHYEYDSALAMIHAEDAQRVFRLEGP-TGIRIKLKDLNEARE 240

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             + +   L    ++ DW ++ + +F+  +
Sbjct: 241 VADQMAVTLPGQFLIRDWTRQNKTWFAAVQ 270


>gi|292490665|ref|YP_003526104.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Nitrosococcus halophilus Nc4]
 gi|291579260|gb|ADE13717.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Nitrosococcus halophilus Nc4]
          Length = 415

 Score =  135 bits (339), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 140/273 (51%), Gaps = 10/273 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RY  + R++ FIS  S  S +GV +GV ALI V+SVMNGF +++  R+L
Sbjct: 1   MFKPLPFYIGLRYTRAKRRSHFISFISLTSMLGVSLGVAALITVLSVMNGFEKELRTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  HV++      L ++Q +  +L+    ++ + PFV GQ  ++   S   G LVRGI 
Sbjct: 61  GMVSHVIVTGPDGTLGNWQALKAQLEKDSRLVGIAPFVEGQGMLTH-RSQVRGTLVRGIL 119

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
                 + +  S+      +    G   +++G DLAR LG+ +GDKI +++P+   TP G
Sbjct: 120 PQQEDQVADIRSKMVVGSLDVLHPGSFQIVLGMDLARALGVFVGDKITLVTPHATTTPAG 179

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEV----FVKDPDAI 237
           +  R K  TV G+F++   +YD+ +  M+L++A L F +   +SG+ +      K P   
Sbjct: 180 VIPRLKRLTVAGVFQVGMYEYDSALAVMNLEDAALLFRIPGKISGLRLKLDNLFKAPYVA 239

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYES 270
            +  E     L       DW  ++  FF   ++
Sbjct: 240 RELRET----LPGSYRTADWTYQHANFFRALKT 268


>gi|84683511|ref|ZP_01011414.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Maritimibacter alkaliphilus HTCC2654]
 gi|84668254|gb|EAQ14721.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Rhodobacterales bacterium HTCC2654]
          Length = 415

 Score =  135 bits (339), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 90/273 (32%), Positives = 131/273 (47%), Gaps = 19/273 (6%)

Query: 10  IVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVV 69
           ++AWRYL + R    +S  ++IS IG+ + V ALI+ ++V  GFR + +  +LG N HV 
Sbjct: 1   MIAWRYLRARRAEGGVSTMTWISLIGITLAVAALIITLAVRTGFRAEFVDTILGANAHVT 60

Query: 70  IQQKYY---------PLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           +               L DY   A+R+  +  V +  P V GQ   +       GV + G
Sbjct: 61  VYTAGEVTAQGNLDRTLKDYDAWADRIAGVEGVTRAAPLVKGQVMANNQDRN-IGVQIFG 119

Query: 121 ISNSDFSYL----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           I   D   +     N  S   GN+ +DF    GV IG  +AR LG+ +GDKI ++SP G 
Sbjct: 120 IRADDLKTIPGIVNNETST--GNI-DDFQ--DGVAIGLGVARELGLGLGDKIRLISPNGV 174

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
            T  G   R   Y V  +F     D D   VY+  +EAQ YFN E +   IEV V+DP+ 
Sbjct: 175 KTAFGTSPRVNVYDVKYIFSAGRYDIDATRVYLPFEEAQSYFNKEGSADEIEVMVEDPEE 234

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           I +    ++   G+G +V  W+     F    E
Sbjct: 235 INRYVGAVLAAAGDGSLVWTWEDSAGSFLRALE 267


>gi|114320596|ref|YP_742279.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Alkalilimnicola ehrlichii MLHE-1]
 gi|114226990|gb|ABI56789.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Alkalilimnicola ehrlichii MLHE-1]
          Length = 415

 Score =  135 bits (339), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 142/271 (52%), Gaps = 6/271 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F   E  +  RY  + R+N FIS  S  S IG+M+GV ALIVV+SVMNGF  ++ +R+L
Sbjct: 1   MFKPLECWIGLRYTGARRRNHFISFISLSSIIGIMLGVTALIVVLSVMNGFERELRERIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRG 120
           G+  H  +     P+ D+Q +   +   P V    PFV G+A +   + GG  SGVLV+G
Sbjct: 61  GMISHATVSAWGEPMEDWQAVREAVLSHPRVEGAAPFVEGEAMI---TRGGEVSGVLVQG 117

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +  +    +     +      +D   G+ G+++G +LAR LG+  GD++ I++P   V+ 
Sbjct: 118 VVPALEGEVSEVAHQLVEGRLDDLRPGEFGIVLGSELARTLGVRGGDRVTIVAPEARVSV 177

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G+  R + +TV+G+F +    YD G+  + +++A   F      SGI V   +  A  +
Sbjct: 178 AGITPRLRRFTVVGVFEVGMYQYDKGIALVHMEDAARLFRAGEGASGIRVRFDELLAAPR 237

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYES 270
               +  +L     V DW + ++ FF   ++
Sbjct: 238 LATEVAEMLPGVYSVRDWTRHHENFFRAVQT 268


>gi|120554667|ref|YP_959018.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Marinobacter aquaeolei VT8]
 gi|120324516|gb|ABM18831.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Marinobacter aquaeolei VT8]
          Length = 414

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 142/271 (52%), Gaps = 13/271 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RY  + R+N FIS  S  S IG+M+GV  LI+V+SVMNGF  ++ +R+L
Sbjct: 1   MFRPLSFYIGLRYTAAKRRNHFISFISLTSMIGLMLGVAVLIIVLSVMNGFDRELKQRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  IQ    PL ++Q I  +++  P V+   PF+ GQ  V+G   GG+  GV++ G
Sbjct: 61  GMVPHATIQGASGPLENWQEIDQKVEAYPRVLAAAPFIQGQGMVTG---GGNVRGVMLNG 117

Query: 121 I---SNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGD 176
           +     +  S ++N F    G++ ++   G+ G+IIG+ +A +L + +GDK+ ++ P   
Sbjct: 118 VLPEQEASVSIIENHF--IEGSL-DELRSGEFGIIIGRLMANSLRLGVGDKLTVVLPEAS 174

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
           VTP G+  R K +TV G+F +   + D     + + +A           GI + + D  A
Sbjct: 175 VTPAGVLPRLKRFTVKGIFSVG-AELDGNYALIHMDDAARLMRTGGRAEGIRLLMDDLFA 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
             +   ++ R LG    V DW + +   F  
Sbjct: 234 APRVVNDVARTLGGRYYVSDWTRTHGNLFQA 264


>gi|260575890|ref|ZP_05843885.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodobacter sp. SW2]
 gi|259021816|gb|EEW25117.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhodobacter sp. SW2]
          Length = 469

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 83/248 (33%), Positives = 128/248 (51%), Gaps = 19/248 (7%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE ++AWRYL + R    +S+ ++IS +G+ + V ALI  +SV  GFR + +  +LG
Sbjct: 49  FAGFEWMIAWRYLRARRAEGGVSVMTWISLVGITLAVFALIATLSVRAGFRAEFVDTILG 108

Query: 64  INGHVVI-----------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSG 112
            N HV +            Q+ +   D+  +A R+  IP V +  P + GQ   +  +  
Sbjct: 109 ANAHVTVYSAARVDDAGVTQRGF--ADFDAVAARVREIPGVTRAAPIIKGQVMATA-NGV 165

Query: 113 GSGVLVRGISNSDFSYLQNSF--SRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINI 170
             GV V G+   D   +      +  YG++ N +D   G+ IG  +AR LG+ +GDK+ +
Sbjct: 166 NLGVEVYGMRLEDVKTIPRVGIGADAYGDLGN-YD--HGIAIGSGIARELGLMVGDKLRL 222

Query: 171 LSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVF 230
           +SP G  T  G   R  +Y V+ +F     D D   +YM L EAQ YFN E     IEV 
Sbjct: 223 ISPNGVKTAFGTSPRVNAYEVVYVFTAGRYDIDRTRIYMPLAEAQSYFNREGMADEIEVM 282

Query: 231 VKDPDAIE 238
           + DP+A +
Sbjct: 283 LTDPEAAD 290


>gi|91786914|ref|YP_547866.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Polaromonas sp. JS666]
 gi|91696139|gb|ABE42968.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Polaromonas sp. JS666]
          Length = 418

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 87/273 (31%), Positives = 146/273 (53%), Gaps = 17/273 (6%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+I+ WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+LG
Sbjct: 5   YELILGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLG 64

Query: 64  INGHV-VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  H+ V       L D Q     +   P V+    F++ QA ++       G LVRGI 
Sbjct: 65  VISHIEVFAPNGAALPDPQKTLAEIKANPQVVGAATFIAAQALLAR-GEDMKGTLVRGID 123

Query: 123 N------SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
                  +D + +Q   + F   VS  F    GV++G +LAR++G+  GD + +++P G 
Sbjct: 124 PALEGQVTDLA-VQLKDTAFPKLVSGGF----GVVLGGELARSMGVREGDTVTLIAPSGQ 178

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
           VTP G+  R K  TV+G F     +YD+ +V +   +A   F LE   +GI + +KD   
Sbjct: 179 VTPAGVVPRLKQMTVVGTFDSGHFEYDSALVMLHQDDAARIFRLEGP-TGIRIKLKDLHQ 237

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    + R L   +++ DW ++ + +F+  +
Sbjct: 238 AREVALELSRSLTGDLLIRDWTRQNKTWFAAVQ 270


>gi|254440668|ref|ZP_05054161.1| efflux ABC transporter, permease protein [Octadecabacter
           antarcticus 307]
 gi|198250746|gb|EDY75061.1| efflux ABC transporter, permease protein [Octadecabacter
           antarcticus 307]
          Length = 438

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 140/274 (51%), Gaps = 21/274 (7%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSRFE ++AWRY+ + R    +SI ++IS IGV + V ALI V++V +GFR D +  ++G
Sbjct: 8   FSRFEWMIAWRYIRAKRAEGGVSIMTWISLIGVTLAVFALIAVLAVRSGFRADFVDTIVG 67

Query: 64  INGHVVIQQKYYPLVDYQ-------------------FIANRLDFIPDVIKVLPFVSGQA 104
            N H+ ++Q +   V                       +A +L  I  V +  P + G+ 
Sbjct: 68  ANAHLTVRQNFTETVTVTQGDQSVDVTRRVDTIANGDALAAQLREIDGVTRAAPIIRGEG 127

Query: 105 FVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISI 164
             + + +  S V V GI+  D   +    +    + S D D G GV +G  +A NLG+S+
Sbjct: 128 LAT-VGAQSSFVQVYGITPDDLRDIPLVLNPQRASGSID-DFGDGVALGSGVANNLGVSV 185

Query: 165 GDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAV 224
           GD+IN+LS  G  T  G   R  ++ V+ +F+      D   VY+ L++AQ +++ +   
Sbjct: 186 GDRINLLSAEGVNTAAGRSPRRNTFDVVYIFQTGRYITDISRVYLPLEQAQTFYSRDGVH 245

Query: 225 SGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQ 258
             IE++V DPD +E+    + R LG    +  W+
Sbjct: 246 DEIEIYVADPDRVEEWISPLYRELGPEAFLYSWK 279


>gi|160900833|ref|YP_001566415.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Delftia acidovorans SPH-1]
 gi|160366417|gb|ABX38030.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Delftia acidovorans SPH-1]
          Length = 423

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 85/270 (31%), Positives = 144/270 (53%), Gaps = 12/270 (4%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ V WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 11  YELAVGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLS 70

Query: 64  INGHVVI---QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           +  H+ I   Q    P ++      R +  PDV+   PFV+ QA ++       G LVRG
Sbjct: 71  VVSHIEIFAPQGAALPDLERTMREARAN--PDVLGAAPFVAAQALLAR-GEDMKGTLVRG 127

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           I  +    + +  +     V      G+  V++G +LAR+LG+  GD + +++P G VTP
Sbjct: 128 IDPAREGEVTD-VAATNAEVLKRLVPGEFNVVLGVELARSLGVRQGDMVTLIAPGGQVTP 186

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G+  R K   V G F     +YD+ +V M  ++AQ  F LE   +GI + +KD     +
Sbjct: 187 AGVVPRLKQMHVAGTFDSGHYEYDSALVMMHYEDAQRLFRLEGP-TGIRLKLKDLHEAPR 245

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +   + + +++ DW Q+ + +F+  +
Sbjct: 246 VAMELAHTITDRLLIRDWTQQNRTWFAAVQ 275


>gi|42521026|ref|NP_966941.1| hypothetical protein WD1229 [Wolbachia endosymbiont of Drosophila
           melanogaster]
 gi|42410767|gb|AAS14875.1| conserved hypothetical protein [Wolbachia endosymbiont of
           Drosophila melanogaster]
          Length = 409

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 89/266 (33%), Positives = 144/266 (54%), Gaps = 10/266 (3%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ +A  YL + R   F SI +  S IG+ +GV  LIVVMSVMNGFR  ++  +LGI+G
Sbjct: 5   FEITMAACYLRA-RNARFCSIMTLFSIIGIALGVATLIVVMSVMNGFRAKLLDSILGIDG 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG-SGVLVRGISNSD 125
           H+ +        DY  ++  ++ IP ++K  P  + Q  +  +++G  +G +VRG+S  D
Sbjct: 64  HINVYFDRNINSDYYAVSKSIERIPGILKATPMTNDQVII--VANGKIAGSVVRGVSTKD 121

Query: 126 FSYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGI 184
              L +S +     +  D  +  +G+IIG  LA  L I  GD+I  +S       +G   
Sbjct: 122 ---LLDSTAVTNNVIIGDVKKFNEGIIIGARLAEVLNIDYGDEITFISSEEFDALLGEMP 178

Query: 185 RSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENI 244
           R K Y V+ +F M   +YDN ++YM L+ AQ +F+ +N++  IEV V D    +K  + I
Sbjct: 179 RMKKYKVIAIFDMGMFEYDNTLIYMPLKSAQAFFSYKNSIKNIEVLVDDVTRADKLADAI 238

Query: 245 VRILGNGVVVIDWQQRYQIFFSCYES 270
            + +  G+    WQ +   +FS  ++
Sbjct: 239 EKEI--GMEAESWQSQQSHYFSALKT 262


>gi|78485516|ref|YP_391441.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Thiomicrospira crunogena XCL-2]
 gi|78363802|gb|ABB41767.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Thiomicrospira crunogena XCL-2]
          Length = 416

 Score =  133 bits (335), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 86/266 (32%), Positives = 150/266 (56%), Gaps = 6/266 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+++ +RY  + R+N FIS  S  S IG+ +GV ALI VMS+MNGF++++  R+L +  
Sbjct: 6   FELLLGYRYTRAKRRNGFISFISLSSIIGIGLGVTALITVMSIMNGFQQELRDRILDMTA 65

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGISNS 124
           HV + ++   L  +Q + +    +P V    P   GQ     L+ G    GVLVRG+   
Sbjct: 66  HVTLSEQGERLNHWQDLYSVAKQLPHVEGAAPNAMGQGM---LTHGDRVKGVLVRGVLPK 122

Query: 125 DFSYLQNSFSRF-YGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
               + +  S+  YG++S+   +   VI+G +LA  LG+S+GDKI +++P   ++PMG+ 
Sbjct: 123 YEGQVADVESKMVYGHLSDLKSKDYNVILGTELANGLGVSVGDKITLVAPQASISPMGVV 182

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K +TV G+F +   +YD+ +  + + +AQ  F + + VS +++ + D  A+    E 
Sbjct: 183 PRLKRFTVSGLFEVGMHEYDSALAIVHMADAQRVFKMGHQVSALQLRLDDMFAVRDVREA 242

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +   + + + + DW Q++  FF   E
Sbjct: 243 VAENIDDVLYMRDWTQQHSNFFKAIE 268


>gi|134095407|ref|YP_001100482.1| outer membrane lipoproteins ABC transporter membrane protein
           [Herminiimonas arsenicoxydans]
 gi|133739310|emb|CAL62359.1| Lipoprotein-releasing system transmembrane protein LolC
           [Herminiimonas arsenicoxydans]
          Length = 421

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 80/268 (29%), Positives = 147/268 (54%), Gaps = 6/268 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FE +V  RY  + R+   N+FIS  S IS  G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 9   FEWLVGIRYTRAGRRSGRNSFISFISLISMAGIALGVAALIIVLSVMNGFQKEVRDRMLS 68

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ + + Y  L D+Q  A       +V    P+V  QA ++       GV VRG+  
Sbjct: 69  VLSHIEVFEPYGGLPDWQATAREAFMNKEVRGAAPYVDAQAMMT-RDETLRGVAVRGVLP 127

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
            +   + +  S+      +D   G+  +++G +LAR++   +GDK+ +++P G VTP G+
Sbjct: 128 DEEPKVSDVASQVKEGSLHDLRSGEFNIVLGNELARSMNARLGDKVTMIAPQGQVTPAGV 187

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K + V+G+F     +YD+ + ++ + +A   F L  A SG+ + ++D     +   
Sbjct: 188 IPRLKQFRVVGIFDSGHFEYDSTLAFIHIDDAMTMFKL-GAPSGLRLKIEDMQRAPQVAL 246

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYES 270
           ++ R L   V++ DW ++ + +F+  ++
Sbjct: 247 DLSRTLSGDVLIRDWSKQNRNWFAAVQT 274


>gi|222475557|ref|YP_002563974.1| Lipoprotein-releasing system transmembrane protein (lolE)
           [Anaplasma marginale str. Florida]
 gi|222419695|gb|ACM49718.1| Lipoprotein-releasing system transmembrane protein (lolE)
           [Anaplasma marginale str. Florida]
          Length = 408

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 138/265 (52%), Gaps = 14/265 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E ++A RY+ SN      S A+ +S +G+ IGV  LI V SVMNGF   ++  +LG+NG
Sbjct: 8   LEWLLARRYIQSNGGRFLFSTATVLSILGICIGVATLISVTSVMNGFSAKLLSSILGMNG 67

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+ I     P  DY  +   +  +PDV+   P + GQA +    +   G +VRG+   D 
Sbjct: 68  HITIHCNR-P--DYPNVIAEIHHVPDVVSAAPVIEGQALLK-YENNIMGAVVRGMHMCDI 123

Query: 127 SYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIR 185
               + +      V  D D   +G+++G  LA ++G   GD+I I+SP    T  G   R
Sbjct: 124 HRKLHGYV-----VRGDVDMLEEGIVLGFRLAESIGADYGDEITIISPETSPTIFGAVPR 178

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIV 245
           +K+Y V G+F +   +YD+   Y+ L+++QL F   N +  IEVF++D   + K+ E +V
Sbjct: 179 TKTYKVTGIFDVGVYEYDSAFAYIPLRDSQLLFGYANKIKYIEVFLED---VTKSSEALV 235

Query: 246 RIL-GNGVVVIDWQQRYQIFFSCYE 269
            I     + V DW+ +   +F   E
Sbjct: 236 EIARRTSLKVEDWKVQQGQYFRALE 260


>gi|239908487|ref|YP_002955229.1| lipoprotein releasing system transmembrane protein LolC
           [Desulfovibrio magneticus RS-1]
 gi|239798354|dbj|BAH77343.1| lipoprotein releasing system transmembrane protein LolC
           [Desulfovibrio magneticus RS-1]
          Length = 409

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 138/248 (55%), Gaps = 5/248 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ VA RYL + +K AFIS+ S IS +GV +GV +LIVV+ VM+GF  ++  ++LGIN 
Sbjct: 3   FELFVARRYLTARQKQAFISVISLISVLGVGLGVASLIVVVGVMHGFSTELRDKILGINA 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+V       + DY+ +  + + +P V+   PFV  +  +S  + G  GV++RG+  +  
Sbjct: 63  HMVAAVAGGAMHDYRELMGKAEAVPGVLGATPFVYTEVMLSS-ARGVKGVVLRGVDPASA 121

Query: 127 SYLQNSFSRFYGNVSNDFDRG---KGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
             +            +D +      G+++G++LA  LG+ +G+ +N++SP G  +  G  
Sbjct: 122 GKVLALPKEMIVGSLDDLEIPGPFPGIVLGRELADRLGLIVGETVNLMSPAGKESAAGFS 181

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAV-SGIEVFVKDPDAIEKTHE 242
            + K++ + G+F+    +YD+ + Y+++  AQ     +  + +G+E+ V D DA++    
Sbjct: 182 PKVKTFVLRGLFKSGMYEYDSTLAYVTIPAAQELLGFKRDIATGLELKVADVDAVDALAP 241

Query: 243 NIVRILGN 250
            +   LG 
Sbjct: 242 KVRAALGG 249


>gi|224369337|ref|YP_002603501.1| LolC [Desulfobacterium autotrophicum HRM2]
 gi|223692054|gb|ACN15337.1| LolC [Desulfobacterium autotrophicum HRM2]
          Length = 407

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 85/273 (31%), Positives = 137/273 (50%), Gaps = 17/273 (6%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +A RYL + ++  FIS+ + +S  GV +GVMAL++V++VM+G   +  +R+LG+  
Sbjct: 3   LEFFIAARYLRAKQREGFISLITLLSVAGVTVGVMALVIVIAVMSGAESEFRRRILGVEP 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           HV++        D      R   +P V  V P V  Q  +   S   SG +VRG+  +  
Sbjct: 63  HVLVMNHSGTAYDVNSTIKRAMDVPGVADVSPMVFAQTMIRT-SHSLSGAVVRGVDPA-- 119

Query: 127 SYLQNSFSRFYGNVSNDFDRG----------KGVIIGKDLARNLGISIGDKINILSPYGD 176
                S S   G    + DR            G+I+GK+LA+NL IS+GDKI ++SP G 
Sbjct: 120 ----VSLSLVKGFTPEELDRCLARDGNGVVLPGIILGKELAKNLAISVGDKIVLISPGGM 175

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
           ++P+G     K + V G+F     +YD+ + Y+ L EAQ    + + +S + V+VKD   
Sbjct: 176 ISPVGHVPALKRFRVTGIFESGMYEYDSSLAYVHLIEAQKLMGMGDRISALGVWVKDLFK 235

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +K    +V  L       DW +  +  F+  +
Sbjct: 236 ADKVKTALVAALDYPFYGRDWMEINKSLFAALK 268


>gi|320106710|ref|YP_004182300.1| hypothetical protein AciPR4_1483 [Terriglobus saanensis SP1PR4]
 gi|319925231|gb|ADV82306.1| protein of unknown function DUF214 [Terriglobus saanensis SP1PR4]
          Length = 409

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 78/270 (28%), Positives = 137/270 (50%), Gaps = 8/270 (2%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RFE+ +A RYL + R+ A + + + IS +GV  GV +LIV +++ NG R D+  R+LG  
Sbjct: 2   RFELFIAARYLRAKRRQAVVGVITAISVVGVAAGVASLIVALAITNGMRRDLQSRLLGST 61

Query: 66  GHV-VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVS-GLSSGGSGVLVRGISN 123
            HV +++     + D++ +  R+  +P V    P + GQ  +S G  SGG   L++G+  
Sbjct: 62  AHVDLMRVAADGIRDWKPLLERMRKLPHVTAAAPGLYGQVLISRGPRSGGG--LIKGVLP 119

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKG----VIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +D   + +         + D D+       +++G DLA  +G  +GD + + SP G++TP
Sbjct: 120 ADERTVSDLLQSIKTGSAADLDQTSSAQLPIVLGSDLAETIGARVGDTVLVTSPQGELTP 179

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           +G+  + + Y + G+F   F  YD+   ++ L +AQ  F   + +S I   V D    +K
Sbjct: 180 LGLIPKYQRYRLAGVFHSGFYQYDSSYAFLRLADAQKLFTEPDLISVISFKVDDLYHADK 239

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             + I    G G    +W  + +  F   E
Sbjct: 240 IAKEIEAAAGPGFQTTNWMGQNRELFRALE 269


>gi|194289277|ref|YP_002005184.1| outer membrane lipoproteins ABC transporter [Cupriavidus
           taiwanensis LMG 19424]
 gi|193223112|emb|CAQ69117.1| outer membrane lipoproteins ABC transporter, membrane component
           [Cupriavidus taiwanensis LMG 19424]
          Length = 416

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 146/269 (54%), Gaps = 9/269 (3%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  ++++   N FIS  S IS +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRASKRASRNTFISFISMISMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHV-VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  H+ VI     P  D+Q  A       +V+   P+V+ QA ++       GVL+RG+ 
Sbjct: 65  VLAHIEVIGPSALP--DWQKTAAEALQNKEVVGAAPYVAAQAMLTR-DDAVRGVLLRGVE 121

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +    +    S+F          G  G+ +G +LA  +G+ +GDKI +L+P G +TP G
Sbjct: 122 PTQEPKVSEIGSQFRAGSMAALVPGSFGIALGNELANAMGVQVGDKITLLAPQGTITPAG 181

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R K +TV+G+F     ++D+ +  ++LQ+A+  F L    +G+ + ++D        
Sbjct: 182 VLPRLKQFTVVGVFSSGHFEFDSALALVNLQDAETLFRLSGP-TGVRLKLQDMQRAPLVA 240

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYES 270
           + +   +   + + DW ++ + +F+  ++
Sbjct: 241 QELAGTMSGELYLRDWSKQNRNWFAAVQT 269


>gi|149914366|ref|ZP_01902897.1| lipoprotein releasing system transmembrane protein, putative
           [Roseobacter sp. AzwK-3b]
 gi|149811885|gb|EDM71718.1| lipoprotein releasing system transmembrane protein, putative
           [Roseobacter sp. AzwK-3b]
          Length = 416

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 84/271 (30%), Positives = 129/271 (47%), Gaps = 14/271 (5%)

Query: 10  IVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVV 69
           ++AWRYL + R    +S  ++IS IG+ + V ALI  +SV +GFR + +  +LG N HV 
Sbjct: 1   MIAWRYLRAKRAEGGVSTMTWISLIGITLAVFALIATLSVRSGFRAEFVDTILGANAHVT 60

Query: 70  I----------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVR 119
           +           +    L +Y+ +A  +  +  V +V P V GQ   +   S  +GV V 
Sbjct: 61  VYNMGTVDAQTGRLDRTLSEYEAMAESVRAVEGVTRVAPLVKGQVMANARDSN-AGVQVF 119

Query: 120 GISNSDFSYLQNSFSRFYGNVS-NDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           GI   D   +        G      F RG  + IG  +AR LG+ +GD+I ++SP G  T
Sbjct: 120 GIKPEDLVTIPRIADPATGRGDITAFSRG--IAIGSGVARELGVGVGDRIRLISPNGVRT 177

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
             G   R  +Y V+ +F     D D   VY+  +E+Q +FN E     +EV V+DPD +E
Sbjct: 178 AFGTSPRINAYDVVYIFSAGRYDIDRVRVYLPFEESQSFFNREGRADELEVMVRDPDRVE 237

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
                ++   G+   V  W+     F    E
Sbjct: 238 DMTLPLIAAAGDRAQVWTWKDASGGFLRALE 268


>gi|121595718|ref|YP_987614.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Acidovorax sp. JS42]
 gi|120607798|gb|ABM43538.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidovorax sp. JS42]
          Length = 417

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 87/275 (31%), Positives = 147/275 (53%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ + WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YELALGWRYTRAGRATRRNGFISFISGVSMLGISLGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYP----LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVR 119
           +  H+ I   + P    L D           P+V+   PFV+ QA ++       G LVR
Sbjct: 65  VVSHIEI---FAPGGAALPDMPRTLAEARANPNVVGAAPFVAAQALLAR-GEDMKGALVR 120

Query: 120 GISNSDFSYLQN----SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYG 175
           GI  +  + + +    +       V  +F     VI+G +LAR LG+  GD + +++P G
Sbjct: 121 GIDPAHEAEVTDLAAENLEGLKALVPGEFR----VILGSELARQLGVRAGDAVTLIAPAG 176

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD-P 234
            VTP G+  R K  TV G F     +YD+ +V +  ++A+  F LE   +G+ + +K+  
Sbjct: 177 QVTPAGVVPRLKQMTVAGTFNSGHYEYDSALVMLHHEDAERIFRLEGP-TGVRLKLKNLH 235

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           DA E T +    + GN +++ DW Q+ + +F+  +
Sbjct: 236 DAPEVTQQLAHSLSGN-LLIRDWTQQNRTWFAAVQ 269


>gi|222111925|ref|YP_002554189.1| lipoprotein releasing system, transmembrane protein, lolc/e family
           [Acidovorax ebreus TPSY]
 gi|221731369|gb|ACM34189.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidovorax ebreus TPSY]
          Length = 417

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 87/275 (31%), Positives = 147/275 (53%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ + WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YELALGWRYTRAGRATRRNGFISFISGVSMLGISLGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYP----LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVR 119
           +  H+ I   + P    L D           P+V+   PFV+ QA ++       G LVR
Sbjct: 65  VVSHIEI---FAPGGAALPDMPRTLAEARANPNVVGAAPFVAAQALLAR-GEDMKGALVR 120

Query: 120 GISNSDFSYLQN----SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYG 175
           GI  +  + + +    +       V  +F     VI+G +LAR LG+  GD + +++P G
Sbjct: 121 GIDPAHEAEVTDLAAENLEGLKALVPGEFR----VILGSELARQLGVRAGDAVTLIAPAG 176

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD-P 234
            VTP G+  R K  TV G F     +YD+ +V +  ++A+  F LE   +G+ + +K+  
Sbjct: 177 QVTPAGVVPRLKQMTVAGTFNSGHYEYDSALVMLHHEDAERIFRLEGP-TGVRLKLKNLH 235

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           DA E T +    + GN +++ DW Q+ + +F+  +
Sbjct: 236 DAPEVTQQLAHSLSGN-LLIRDWTQQNRTWFAAVQ 269


>gi|53803223|ref|YP_115028.1| lipoprotein ABC transporter permease LolE [Methylococcus capsulatus
           str. Bath]
 gi|53756984|gb|AAU91275.1| lipoprotein ABC transporter, permease protein LolE [Methylococcus
           capsulatus str. Bath]
          Length = 415

 Score =  131 bits (330), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 79/277 (28%), Positives = 137/277 (49%), Gaps = 18/277 (6%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+  FIS  +  S +G+ +GV ALI V+SVMNGF  ++ +R+L
Sbjct: 1   MFKPLVLYIGLRYTRAKRRTRFISFITLTSVLGIALGVTALITVLSVMNGFEAELRERIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I      L D++ +   L     ++   P++ GQA +S      SG ++RGI 
Sbjct: 61  GMTSHASISGPGGTLGDWRVLEPALSEDKRILGWAPYIEGQAMLSS-ERRASGAMLRGI- 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSP 173
                     +     +V+N    GK         G+I+G +LA  LG+S GDK+ +++P
Sbjct: 119 -------LPEYEPRVSDVANHMQLGKLGDLAPGQFGIILGAELAAYLGVSSGDKVTVITP 171

Query: 174 YGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
               TP G+  R K +TV+G F++   +YD  +  + L++A    ++E  +SG+ + + D
Sbjct: 172 QVTATPAGILPRLKRFTVIGTFQVGMFEYDRNLALIQLEDAARLLHMEGEISGLRLKLDD 231

Query: 234 PDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES 270
                +   ++   L     V DW Q +  FF   ++
Sbjct: 232 LFNAHRIARDLGPKLPGDYYVTDWTQAHTNFFRAIKT 268


>gi|254452272|ref|ZP_05065709.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Octadecabacter antarcticus 238]
 gi|198266678|gb|EDY90948.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Octadecabacter antarcticus 238]
          Length = 438

 Score =  131 bits (330), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 84/274 (30%), Positives = 137/274 (50%), Gaps = 21/274 (7%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FSRFE ++AWRY+ + R    +SI ++IS IGV + V ALI V++V +GFR D +  ++G
Sbjct: 8   FSRFEWMIAWRYIRAKRAEGGVSIMTWISLIGVTLAVFALIAVLAVRSGFRADFVDTIVG 67

Query: 64  INGHVVIQQKYYPLVDYQ-------------------FIANRLDFIPDVIKVLPFVSGQA 104
            N H+ ++Q +   V                       +A +L  I  V +  P + G+ 
Sbjct: 68  ANAHLTVRQNFMETVTVTQGDQSVDVTRRVDTIANGDELAAQLRAIDGVTRAAPIIRGEG 127

Query: 105 FVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISI 164
             + + +  S V V GI+  D   +    +    + S D D   GV +G  +A NLG+S+
Sbjct: 128 LAT-VGAQSSFVQVYGITPDDLRDIPLVLTPQQSSGSID-DFANGVALGSGVANNLGVSV 185

Query: 165 GDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAV 224
           GD+IN+LS  G  T  G   R  ++ V+ +F+      D   VY+ L +AQ +++ +   
Sbjct: 186 GDRINLLSAEGVNTAAGRSPRRNTFDVVYIFQTGRYITDISRVYLPLAQAQTFYSRDGVH 245

Query: 225 SGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQ 258
             IE++V DPD +E     + R LG    +  W+
Sbjct: 246 DEIEIYVADPDRVEDWISPLYRALGPEAFLYSWK 279


>gi|241767506|ref|ZP_04765187.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidovorax delafieldii 2AN]
 gi|241361667|gb|EER58009.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidovorax delafieldii 2AN]
          Length = 417

 Score =  131 bits (330), Expect = 9e-29,   Method: Compositional matrix adjust.
 Identities = 85/275 (30%), Positives = 141/275 (51%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ + WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 5   YELALGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVI---QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           +  H+ I   Q    P         R +  P+V+   PFV  QA ++       G LVRG
Sbjct: 65  VVSHIEIFAPQGAALPDPARTLAEARQN--PNVVGAAPFVGAQALLAR-GEDMKGTLVRG 121

Query: 121 ISN------SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPY 174
           I        +D +       +    V  +F     V++G +LAR LG+  GD + +++P 
Sbjct: 122 IDPALEGAVTDLAATNEETLKLL--VPGEFR----VVLGGELARALGVRKGDAVTLIAPA 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G VTP G+  R K  TV G F     +YD+ +V +  ++AQ  F LE   +GI + +KD 
Sbjct: 176 GQVTPAGVVPRLKQMTVAGTFDSGHYEYDSALVLLHHEDAQRIFRLEGP-TGIRLKLKDL 234

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +  + +   L   +++ DW Q+ + +F+  +
Sbjct: 235 HQAREVAQQLAGSLSGMLLIRDWTQQNRTWFAAVQ 269


>gi|260430961|ref|ZP_05784932.1| lipoprotein releasing system transmembrane protein LolE
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260414789|gb|EEX08048.1| lipoprotein releasing system transmembrane protein LolE
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 428

 Score =  131 bits (330), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/277 (30%), Positives = 131/277 (47%), Gaps = 15/277 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE  +AWRYL + R    +S+ ++IS IG+ + V ALI  ++V +GFR + +  +LG
Sbjct: 8   FAAFEWKIAWRYLRARRAEGGVSVMTWISLIGITLAVFALIATLAVRSGFRSEFVGTILG 67

Query: 64  INGHVVIQQKY---------YPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N HV +               + +Y  +A R+  +P V +  P V GQ  ++      S
Sbjct: 68  ANAHVTVYSAGNIDAQGRVDRTIANYDAMAERIAQVPGVQRAAPLVKGQVLITNRDRS-S 126

Query: 115 GVLVRGISNSDFSYLQN--SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           G  V GI   D   L       + YG+++  F+  +G+ IG  +AR +G ++GD++ + S
Sbjct: 127 GAEVFGIRPDDLLSLPGIAESDQAYGDLTR-FE--EGIAIGSGVARAIGATVGDRVKLTS 183

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R  +Y V+ +F     D D   VYM   EAQ +FN E     IEV V 
Sbjct: 184 PNGVKTAFGTSPRVNAYEVVYVFSAGRYDIDRTRVYMPFSEAQSFFNREGVADEIEVMVD 243

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            P+ +      I+   G  V +  W      F    E
Sbjct: 244 RPEDLNPILIPILEAAGERVQIWTWLDASGGFLRALE 280


>gi|311694961|gb|ADP97834.1| outer membrane-specific lipoprotein transporter subunit LolE
           [marine bacterium HP15]
          Length = 413

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 87/268 (32%), Positives = 134/268 (50%), Gaps = 8/268 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S  S IG+M+GV  LI+V+SVMNGF  ++ +R+L
Sbjct: 1   MFRPLSLYIGLRYTAAKRRNHFISFISLTSMIGLMLGVAVLIIVLSVMNGFDRELKQRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  IQ    PL D+Q I  ++   P V+   PF+ GQ  V+G   GG+  GV++ G
Sbjct: 61  GMVPHATIQGA-GPLDDWQSIDAKVQQHPRVLAAAPFIQGQGMVTG---GGNVRGVVLNG 116

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           I   +   +    +       ND   G+ G+IIG+ +A +L + IGDK+ ++ P   VTP
Sbjct: 117 ILPEEERTVSIIENHMVEGSLNDLVSGEFGIIIGRLMAASLRLQIGDKVTVVLPEASVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G+  R K +TV G+F +   + D     + + +A           GI + V D  A  K
Sbjct: 177 AGVLPRLKRFTVKGIFSVG-AELDGNYTLIHMDDAAKLMRTGGKAEGIRLLVDDLFAAPK 235

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSC 267
             +     LG    V DW + +   F  
Sbjct: 236 VSQQAAESLGGRYYVSDWTRTHGNLFQA 263


>gi|92113706|ref|YP_573634.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Chromohalobacter salexigens DSM 3043]
 gi|91796796|gb|ABE58935.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Chromohalobacter salexigens DSM 3043]
          Length = 413

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 90/272 (33%), Positives = 145/272 (53%), Gaps = 12/272 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +  R   ++  RY+ + R+N FIS  S  S +G+M+GV  LI+V+SVMNGF  ++  RVL
Sbjct: 1   MLDRLPFLIGLRYVRAKRRNHFISFISLTSMLGLMLGVAVLILVLSVMNGFDHELRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS-GVLVRGI 121
           G+  H  I+ +   + D++ +A RL+    VI   PFV  Q   S  S G + G +V GI
Sbjct: 61  GMVPHTRIEAQ-GGMTDWKALAERLEKRDYVIGAAPFVQQQGMFS--SEGRTQGAMVNGI 117

Query: 122 S---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
                S  S +    +R  G++ +D   G+  V++G  LARNLG+ +GD++ +L P   +
Sbjct: 118 QPDYESKVSIIDEHMTR--GSL-DDLAPGEWHVVLGDLLARNLGVGVGDRVTLLVPEASI 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           TP G+  R K +TV G+F++   D D  + Y ++Q+ Q    L ++V G+ + + D    
Sbjct: 175 TPGGVFPRLKRFTVSGIFKVG-ADLDANLAYANIQDMQTLGRLGDSVEGLRLELDDLFQA 233

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
                 IV  LG+G   +DW   +   F   +
Sbjct: 234 GPVTRAIVNDLGSGYRGVDWTYTHGNLFQAIQ 265


>gi|68171289|ref|ZP_00544690.1| Protein of unknown function DUF214 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88658053|ref|YP_506955.1| LolC/E family lipoprotein releasing system transmembrane protein
           [Ehrlichia chaffeensis str. Arkansas]
 gi|67999304|gb|EAM85952.1| Protein of unknown function DUF214 [Ehrlichia chaffeensis str.
           Sapulpa]
 gi|88599510|gb|ABD44979.1| lipoprotein releasing system transmembrane protein, LolC/E family
           [Ehrlichia chaffeensis str. Arkansas]
          Length = 410

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/231 (36%), Positives = 129/231 (55%), Gaps = 9/231 (3%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           +FE+++A RYL S+      S+ + +S +G+ +GV  LIVVMSVMNGF E ++  V+G+N
Sbjct: 4   KFELMLALRYLRSSSSKFLCSMITMLSLVGITLGVATLIVVMSVMNGFGEKLLNCVVGLN 63

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
           GH+VI        DY+ IA  +  I  V   +P    QA +   +S  SGV+VRGI   D
Sbjct: 64  GHIVIYFNDSVDYDYRSIAESIKGISGVKDAVPITENQAMIKS-NSNVSGVVVRGIEKQD 122

Query: 126 F---SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
               + + N+  R   +  ND     G+ IG  LA  L ++ GDK+ I+S     T +G 
Sbjct: 123 IERNNIIVNNIVRGSIDEFND-----GIAIGIKLAEILHVNYGDKLTIVSSESISTVIGN 177

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
             R K+Y +  +F +   +YD+ +VYM L  +QL+F+ +N V  IEV + D
Sbjct: 178 IPRMKTYKIAAVFDVGMYEYDSTLVYMPLHASQLFFHYDNRVKSIEVSILD 228


>gi|313672099|ref|YP_004050210.1| hypothetical protein Calni_0133 [Calditerrivibrio nitroreducens DSM
           19672]
 gi|312938855|gb|ADR18047.1| protein of unknown function DUF214 [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 409

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 142/270 (52%), Gaps = 8/270 (2%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           + E  +A RY+ S ++   IS  S I+ IG+++GV  LIVV +V  GF  ++  ++LG N
Sbjct: 2   KIENFIALRYIKSKKETKAISFISVIAIIGILLGVATLIVVTNVFTGFENNLKDKILGAN 61

Query: 66  GHVVIQQ-KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
            H+++ +     + D+Q + N++     V+ V PFV  Q  ++G  +  SGV++RGI   
Sbjct: 62  SHIIVNRIDVGTISDWQKVENKIRETKGVVAVSPFVFSQVLLTG-PANVSGVMLRGIIPE 120

Query: 125 DFSYLQNSFSRFYG-----NVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
             +   N   +F        +  DFD   G+++GKDLA  LG+ + D++ +++P+G   P
Sbjct: 121 KEAQAIN-IKQFITAGDLFKLKYDFDNKSGIVLGKDLALTLGVRLYDEVVMVAPFGKKGP 179

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G   + + + V+ +F     DY+NG+ ++ ++ AQ +F+L + ++G  V V + D   +
Sbjct: 180 FGFTPKMQKFYVVAIFDSGMYDYNNGLAFVDIKAAQKFFDLGDTITGFSVKVDNIDRASR 239

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             + I   L       DW    +  FS  E
Sbjct: 240 IAKEIATKLDFPFWARDWLSMNKNLFSALE 269


>gi|329850611|ref|ZP_08265456.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Asticcacaulis biprosthecum C19]
 gi|328840926|gb|EGF90497.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Asticcacaulis biprosthecum C19]
          Length = 427

 Score =  130 bits (328), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/264 (32%), Positives = 137/264 (51%), Gaps = 15/264 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F  +E  ++ +YL + RK+  I++ + ISF+G+M+ V ALI V+S+MNGFRE+++ RVL 
Sbjct: 9   FRAWEFDLSLKYLRTKRKDGGIAVIAIISFVGIMLAVTALISVLSIMNGFREELMSRVLA 68

Query: 64  INGH-VVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
             GH  V  +          +  RL   P V  V PF+     +   +    G ++RG+ 
Sbjct: 69  FGGHGYVYGRTIDDFAHRDDMVARLKAAPGVTSVTPFIDSPGLIQAGNGRTGGGIMRGVV 128

Query: 123 NSDFSYLQNSFSRFYGNVSN--DFDR-------GKGVIIGKDLARNLGISIGDKINILSP 173
             D   L+N+     G ++     D+       G  V+IG  LAR + +  GD+I ++SP
Sbjct: 129 PED---LKNT-PIIAGTIAKGGSMDQFGVGDYGGDVVLIGDGLARTVNVIPGDEITLISP 184

Query: 174 YGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
            G  T  G     K+Y V G+F       D   VYM +Q+AQL+F+ E+    +E+ V+ 
Sbjct: 185 -GRSTSFGSTPLRKTYIVGGLFHSGVSQIDQSFVYMPIQQAQLFFDREDEWDALEIKVEK 243

Query: 234 PDAIEKTHENIVRILGNGVVVIDW 257
           P  ++K  + IV+ +G G +  DW
Sbjct: 244 PYEVQKYRDAIVKAVGEGGLFEDW 267


>gi|218888078|ref|YP_002437399.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218759032|gb|ACL09931.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 417

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 86/256 (33%), Positives = 138/256 (53%), Gaps = 13/256 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ VA RYLF+ R+  FIS+ S  S +GV +GV +LIVV+ VMNGF  D+  ++LG N 
Sbjct: 3   FELFVALRYLFARRRQTFISVISVTSILGVALGVASLIVVLGVMNGFTTDLRDKILGANA 62

Query: 67  H-VVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI---- 121
           H +V+      L D   + +++  +  V    PF+  +  +S    G  G+++RGI    
Sbjct: 63  HGIVMSADRSGLGDAPQLIDKIRQVDGVRGATPFIYSEVMLS-TPHGVKGLVLRGIDPQS 121

Query: 122 SNSDFSYLQN----SFSRFYGNVSND--FDRGKGVIIGKDLARNLGISIGDKINILSPYG 175
           + S    L N    S +    +   D  +    GVIIG +LA+ LG+ +G ++N+LSP G
Sbjct: 122 APSVLGILSNMTKGSVADLAPHTGADGAYSGPPGVIIGDELAQRLGVVVGSRVNLLSPAG 181

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDP 234
             T  G   R + + V+G+F     +YD+ + ++SL  A+    L + AVSG+E+ V D 
Sbjct: 182 QKTSAGFAPRIRPFMVVGVFSTGMFEYDSSLGFVSLDAARDVLGLPDGAVSGVELAVTDV 241

Query: 235 DAIEKTHENIVRILGN 250
              ++  E + R +G 
Sbjct: 242 YKADQVAERVTRAVGG 257


>gi|84515337|ref|ZP_01002699.1| lipoprotein releasing system transmembrane protein LolE [Loktanella
           vestfoldensis SKA53]
 gi|84510620|gb|EAQ07075.1| lipoprotein releasing system transmembrane protein LolE [Loktanella
           vestfoldensis SKA53]
          Length = 418

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 80/270 (29%), Positives = 130/270 (48%), Gaps = 14/270 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F++FE ++AWRY+ + R    +S+ ++IS IGV + V ALI  ++V +GFR + I  ++G
Sbjct: 7   FAKFEWMIAWRYIRAKRAEGGVSVMTWISLIGVTLAVFALIATLAVRSGFRAEFIDTIVG 66

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVL----VR 119
            + HV + +    + DY  +++R+  +P V  V P V GQA      +G  G +    + 
Sbjct: 67  ADAHVTVLRPREVIADYADMSDRIMALPGVASVAPLVRGQAM-----AGAFGQIALADIY 121

Query: 120 GISNSDFSYLQN--SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
           GI   D    +      R  GN+    D   G+ +G  LA NLG+ +GD+I I +  G  
Sbjct: 122 GIHLDDLKASEAIVDSERTIGNID---DLQGGIALGSALAANLGLGLGDRIEITTRSGAA 178

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           TPMG   R  ++ V+ +F       D    Y+    AQ  FN +     ++V + D +  
Sbjct: 179 TPMGQSTRRNAFDVVYIFSTGRYQIDEVRAYLPFDVAQTIFNRDGVADELDVRLDDINKS 238

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
           E   ++I    G  +    WQ R   F   
Sbjct: 239 EALKQDIANAAGPNIWAYSWQDRVGRFLRA 268


>gi|73540778|ref|YP_295298.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Ralstonia eutropha JMP134]
 gi|72118191|gb|AAZ60454.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ralstonia eutropha JMP134]
          Length = 416

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 147/269 (54%), Gaps = 9/269 (3%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  ++++   N FIS  S IS +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRASKRASRNTFISFISMISMLGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHV-VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  H+ VI     P  D+Q  A       +VI   P+V+ QA ++       GVL+RG+ 
Sbjct: 65  VLSHIEVIGPSALP--DWQRTAAEAMRNKEVIGAAPYVAAQAMLT-REDAVRGVLLRGVD 121

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            ++   + +   +F          G+ G+ +G +LA  +G+ +GDKI +L+P G +TP G
Sbjct: 122 PAEEPKVSDIGKQFKAGHMESLQPGEFGIALGNELANAMGVQVGDKITLLAPQGTITPAG 181

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R K +TV+G+F     ++D+ +  +++++A+  F +    +G+ + + D     +  
Sbjct: 182 VLPRLKQFTVVGVFSSGHFEFDSALALVNIRDAETLFRMTGP-TGVRLKLADMQRAPQVA 240

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYES 270
             +   +   + + DW ++ + +F+  ++
Sbjct: 241 NELAGTMSGELYLRDWSKQNRNWFAAVQT 269


>gi|89055807|ref|YP_511258.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Jannaschia sp. CCS1]
 gi|88865356|gb|ABD56233.1| Lipoprotein releasing system transmembrane protein LolC/E family
           [Jannaschia sp. CCS1]
          Length = 461

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 89/290 (30%), Positives = 138/290 (47%), Gaps = 28/290 (9%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RFE ++AWRYL + R    +S  ++ISFIG+ + VMALI V++V  GFR + +  +LG N
Sbjct: 26  RFEFLIAWRYLRARRTEGGVSAMTWISFIGIALAVMALIAVLAVRAGFRHEFVGTILGAN 85

Query: 66  GHVVI---------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGV 116
            HV +          Q    L  Y  +A  +  +  V      + GQ  +S      S V
Sbjct: 86  PHVAVYDIAELNDAGQLERALEGYDAVAEAVRGVNGVTHAAAVIRGQ-VLSSYRGRNSAV 144

Query: 117 LVRGISNSDFS---------YLQNSFSRFYG--NVSNDFDR------GKGVIIGKDLARN 159
            V GI+  D S         + Q   S F     ++ + D       G G+ IG  +AR 
Sbjct: 145 EVIGITPEDLSNVPLVAEPEWRQGLLSAFGAPTEITPEVDGAFPIPGGPGIAIGSGVARE 204

Query: 160 LGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFN 219
           LG S+GD+I ++SP G  TP G   R  +Y V+ +F++   D D   VY+   EAQ YFN
Sbjct: 205 LGASVGDRIRLVSPDGARTPFGTSPRVSTYEVVYIFQVGRWDIDRTRVYIPFGEAQTYFN 264

Query: 220 LENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +     ++V V +P+ I +    +++  G  V +  W+     F +  +
Sbjct: 265 RDGVADEVQVTVAEPEQIAQYVLPLLQ-AGGDVQIWTWEDSSGAFLTALQ 313


>gi|85374229|ref|YP_458291.1| ABC-type transport system [Erythrobacter litoralis HTCC2594]
 gi|84787312|gb|ABC63494.1| ABC-type transport system [Erythrobacter litoralis HTCC2594]
          Length = 415

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 81/267 (30%), Positives = 127/267 (47%), Gaps = 3/267 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           + S FE  +A RYL   R  AFI++ + IS   VM+ V  L++VMSVMNGFR +++ +++
Sbjct: 4   LLSPFEWTIAKRYLLPGRGEAFIALVAGISVGVVMLSVAMLVIVMSVMNGFRAELLDKIV 63

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NGH ++Q     L +++ I   +   P V +  P +  Q  +   +     V VRG +
Sbjct: 64  GVNGHAIVQAYGGRLDNWESILEEVRDTPGVTEASPLIE-QPLLVTFNGRVEAVFVRGNT 122

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
             D + L +      GN+         V IG  LA N+G  +GD + I++P G  TP G 
Sbjct: 123 QEDIAELSDKV--VLGNLQRLQPEASVVAIGARLAENIGARVGDVVTIINPAGRSTPFGT 180

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R   Y V  +F +   DYD   + M + +AQ      + +  IEV  +D D + +   
Sbjct: 181 VPRQVGYEVAAIFEVGLYDYDQAFMVMPIPDAQTLLLTGDTIGMIEVKTEDADNVAEIMA 240

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   L     V  WQQ     F   +
Sbjct: 241 PVEAKLSGIAQVRTWQQINSSIFEALQ 267


>gi|152981241|ref|YP_001352955.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Janthinobacterium sp. Marseille]
 gi|151281318|gb|ABR89728.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Janthinobacterium sp. Marseille]
          Length = 421

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 148/268 (55%), Gaps = 6/268 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FE +V  RY  + R+   N+FIS  S IS  G+ +GV ALI+V+SVMNGF++++  R+L 
Sbjct: 9   FEWLVGIRYTRAGRRSGRNSFISFISLISMAGIALGVAALIIVLSVMNGFQKEVRDRMLS 68

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ I +    L ++Q  A       +V    P+V  QA ++       GV VRG+  
Sbjct: 69  VLSHIEIFEPQGALPNWQETAREAFTNKEVRGAAPYVDAQAMMTR-DDTLRGVAVRGVLP 127

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           ++   + +  S+      ++   G+  +++G +LAR +G  +GDK+ +++P G VTP G+
Sbjct: 128 AEEPKVSDVASQVRQGSLDNLRPGEFNIVLGNELARGMGAQLGDKVTMIAPQGQVTPAGV 187

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV+G+F     +YD+ + ++ + +A   F L  A SG+ + + D     +   
Sbjct: 188 IPRLKQFTVVGIFDSGHFEYDSTLAFIHINDAMTMFKLP-APSGLRLKIADMQRAPQVAM 246

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYES 270
           ++ +++   V++ DW ++ + +F+  ++
Sbjct: 247 DLTQVISGNVLIRDWSRQNRNWFAAVQT 274


>gi|77918853|ref|YP_356668.1| putative kinase [Pelobacter carbinolicus DSM 2380]
 gi|77544936|gb|ABA88498.1| putative kinase [Pelobacter carbinolicus DSM 2380]
          Length = 417

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 85/269 (31%), Positives = 141/269 (52%), Gaps = 8/269 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E  V+ RYL + RK  FIS+ SFIS  GV +GV ALIVV++VM GF + + +++LG   
Sbjct: 3   YEWFVSLRYLRAKRKQTFISVISFISIAGVTLGVAALIVVLAVMTGFHDGVRQQILGNVP 62

Query: 67  HVVIQQKYYPLVDYQFIANRL-DFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
           HV+IQQ+   +  Y+ +  ++   +P+ I V PFVS +A +       + V V+GI   +
Sbjct: 63  HVLIQQQGGSIARYKDLVEQVRQTVPEAIAVNPFVSKEAMLLA-HRNVAAVSVKGIEKGN 121

Query: 126 FSYLQNSFSRFYGN-----VSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
             + Q SF  F        + +D +   G+I+G D A  LG+++GD +N++ P  +VTP 
Sbjct: 122 KVFTQ-SFLNFRSEQVQSALFDDQEGLPGIILGLDTASTLGVALGDTVNVIPPKFNVTPF 180

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G+  + K + V+G+   R    D    Y+ L +AQ +      VSG+E+ +   +     
Sbjct: 181 GLIPKMKPFRVVGILEHRGGFLDAYFAYVDLLQAQQFLETREQVSGVEIELSSFEQSRPV 240

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +   L    +V  W+  +  F S  +
Sbjct: 241 TRRLRESLPYPYLVSSWEDLFGSFLSALK 269


>gi|94309985|ref|YP_583195.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Cupriavidus metallidurans CH34]
 gi|93353837|gb|ABF07926.1| outer membrane-specific lipoprotein transporter subunit ; membrane
           component of ABC superfamily [Cupriavidus metallidurans
           CH34]
          Length = 416

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/268 (27%), Positives = 148/268 (55%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  ++++   N FIS  S IS +G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRASKRASRNTFISFISMISMMGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  H+ +     PL D+Q  A       +V+   P+V+ QA ++       GVL+RG+  
Sbjct: 65  VLSHIEVIGAA-PLTDWQKTAAEALRNKEVVGAAPYVAAQAMMT-REDVVRGVLLRGVDP 122

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           ++   + +  ++F     N    G  G+ +G +LA  LG+ +GDK+ ++ P G +TP GM
Sbjct: 123 AEEPKVSDIANQFRAGSMNALAPGGFGIALGSELANALGVRVGDKVMLVVPQGTITPAGM 182

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV G+F     ++D+ +  +++ +A+  F  ++  +G+ + ++D     +  +
Sbjct: 183 LPRLKQFTVAGVFSSGHYEFDSALALINIGDAETLFR-QSGPTGVRLKLQDMQRAPQVAQ 241

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYES 270
            +   +   + + DW ++ + +F+  ++
Sbjct: 242 ELAGTMSGDLYLRDWSKQNRNWFAAVQT 269


>gi|289208378|ref|YP_003460444.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Thioalkalivibrio sp. K90mix]
 gi|288944009|gb|ADC71708.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Thioalkalivibrio sp. K90mix]
          Length = 416

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 138/269 (51%), Gaps = 3/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S +S +G+++GVMALI V+SVMNGF  ++  R+L
Sbjct: 1   MFRPLPLAIGLRYTRAKRRNHFISFISVVSILGLVLGVMALITVLSVMNGFERELRDRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPD-VIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
           G+  H  IQ     L +++ +  +++ I + V+ V P+V G+A +S  +   SG L+RG+
Sbjct: 61  GMASHATIQDVNGGLRNWESLKEQVETIDERVLAVAPYVQGEAMLSA-TGNISGALIRGV 119

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
                  +               + G   +++G++LA  L + +GD + +++P   V+P 
Sbjct: 120 DPEAEERVARIGEHMTQGRLGQLEPGAYRIVLGRELAAELRVRVGDSLILMAPQASVSPA 179

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G+  R + + V G+F +   +YD G  ++ LQ+AQ  F    +V+G+ + + D       
Sbjct: 180 GVMPRMRRFEVAGIFEVGMYEYDRGTAFIHLQDAQAVFQTGESVTGLRLRLTDMMRAGVV 239

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +   L     V DW +++   F   +
Sbjct: 240 SREVASQLDGLFRVSDWTRQHANLFRAIQ 268


>gi|322435055|ref|YP_004217267.1| protein of unknown function DUF214 [Acidobacterium sp. MP5ACTX9]
 gi|321162782|gb|ADW68487.1| protein of unknown function DUF214 [Acidobacterium sp. MP5ACTX9]
          Length = 415

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 84/277 (30%), Positives = 143/277 (51%), Gaps = 15/277 (5%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RFE+ +A RYL + R+ A I + + IS +GV  GV +LI+ +++ NG R D+ +R+LG  
Sbjct: 2   RFELFIAARYLRAKRRQAVIGVITAISVLGVAAGVASLIIALAITNGMRRDLQERLLGST 61

Query: 66  GHV-VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVS-GLSSGGSGVLVRGISN 123
            HV +++     + D++ + ++L  +P V    P + GQ  +S G  SGG   LV+G+  
Sbjct: 62  SHVELMRVSADGIRDWRPLLDKLRALPHVTAAAPGLYGQVLISRGARSGGG--LVKGVIP 119

Query: 124 SD---FSYLQNSFSR-----FYGNVSNDFDRGKG---VIIGKDLARNLGISIGDKINILS 172
           +D    S L  + +R         V+ D    +    ++IGKDLA  LG  +GD + + S
Sbjct: 120 ADEEKVSDLLQAVTRGSSRPLQPQVNPDAGDAQATPPIVIGKDLAETLGAEVGDTVLVTS 179

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G++TP+G+  R + + V+G+F   F  YD+   ++ L +AQ  F+  + +S I   V 
Sbjct: 180 PQGELTPLGLVPRYQRFQVVGIFASGFYQYDSSYTFVRLTDAQRLFSEPDLISVISFKVD 239

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           D          I    G G    +W ++ +  F   +
Sbjct: 240 DLYRANIIGRTIEETAGKGFQATNWMEQNRELFRALK 276


>gi|160872150|ref|ZP_02062282.1| lipoprotein-releasing system transmembrane protein LolC
           [Rickettsiella grylli]
 gi|159120949|gb|EDP46287.1| lipoprotein-releasing system transmembrane protein LolC
           [Rickettsiella grylli]
          Length = 417

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 80/266 (30%), Positives = 141/266 (53%), Gaps = 13/266 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + ++N FIS  S  S IG+ +GVM LI V+SVMNGF + +  R+ 
Sbjct: 1   MFRPIALYIGLRYTRAKKRNHFISFISLTSMIGIALGVMVLITVLSVMNGFDDAISHRIF 60

Query: 63  GINGHVVIQQKY-YPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS-GVLVRG 120
            +   V I      P+     +  ++   P VI   P+VSGQ  +  +  G S  +++ G
Sbjct: 61  NMATQVTITTTQGEPITQLTSLIRKISHQPHVIASAPYVSGQGML--VDQGQSHPIMITG 118

Query: 121 ISNSDFSYLQNSFSRF-YGNVSNDFDRGKG---VIIGKDLARNLGISIGDKINILSPYGD 176
           +      +L+ + S   +  +   F+   G   +++G++LA  LGI IGDK+NI++P   
Sbjct: 119 V----LPHLEKNVSEIPHKIIEGHFNLEPGHYNIVLGEELALMLGIQIGDKVNIITPRVS 174

Query: 177 VTPMGMGIRSKSYTVLGMFRM-RFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPD 235
           +TP+G+  R K++TV G+FR+ R   ++  M Y++L++AQ  F L   V+G+ + + D  
Sbjct: 175 LTPVGLIPRFKTFTVSGIFRVGRSFGFETSMAYIALKDAQTLFQLNQGVTGLRLKLDDLF 234

Query: 236 AIEKTHENIVRILGNGVVVIDWQQRY 261
           A  +    + ++L      +DW   +
Sbjct: 235 AAPQVSSALNQLLPPTYTALDWTHTF 260


>gi|188997478|ref|YP_001931729.1| protein of unknown function DUF214 [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188932545|gb|ACD67175.1| protein of unknown function DUF214 [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 401

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 87/262 (33%), Positives = 140/262 (53%), Gaps = 10/262 (3%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A RYLFS  K+  +S  S IS IG+ +GV ALI+ M+VM GF   +  ++L    H++I
Sbjct: 7   IALRYLFST-KSKLLSFMSIISIIGITLGVAALIITMAVMGGFMYGIKSKLLETAPHIMI 65

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG-ISNSDFSYL 129
            +      +YQ +  ++  +  VI   PFV  QA ++G SS    V VRG IS  D +++
Sbjct: 66  VKADGKFQEYQEVVQKIKDVEGVIDYEPFVYSQA-IAGKSSNLIPVYVRGVISEKDKNFM 124

Query: 130 QNSFSRFYG--NVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSK 187
                   G  ++++D      +I+GKD+A  L + +GD +NI+SP G  TP+G   + K
Sbjct: 125 ALDKKLISGRYDLTDD-----NIILGKDVALALNVWVGDSVNIVSPVGRKTPIGFLPKLK 179

Query: 188 SYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRI 247
            + V G+      +YD+  V MSL+ AQ +F+L  A++GI++ +KDP       E + + 
Sbjct: 180 EFKVAGIVEFGIYEYDSTFVCMSLENAQSFFDLNGAITGIQLKIKDPFNPSIVKEKLEKR 239

Query: 248 LGNGVVVIDWQQRYQIFFSCYE 269
           L    +V  W    +  F   +
Sbjct: 240 LDFPYIVRSWTDMNKSLFQALQ 261


>gi|121998042|ref|YP_001002829.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Halorhodospira halophila SL1]
 gi|121589447|gb|ABM62027.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Halorhodospira halophila SL1]
          Length = 414

 Score =  129 bits (325), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 137/274 (50%), Gaps = 13/274 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F   E+ +  RY  + R+  F+S  S  S IG+ +GV ALI V+SVMNGF  ++ +R+L
Sbjct: 1   MFRPVELFIGLRYTRARRRGHFVSFISMTSMIGIALGVAALITVLSVMNGFERELRERIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRG 120
           G+  H  +      + D+  +  R +  P V+   PF+ G+  V   + GG  SG L+RG
Sbjct: 61  GMVSHAEVHGAQRQVEDWPGVLERAERHPRVVGAAPFIDGEVMV---TRGGQVSGTLIRG 117

Query: 121 ISNSDFSYLQNSFSRFYGNV---SNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGD 176
           +       L+ S S     V       + G+ G+I+G  LAR LG  +GD+I +++P   
Sbjct: 118 VDPD----LEPSVSDVLDQVIAGEAKLEAGEFGLIMGSALARELGARVGDRITVITPEAR 173

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
           V+  G+  R + +T+ G+F +   +YD  +    +++      + + VSGI + + D  A
Sbjct: 174 VSVAGVTPRMRRFTLTGIFEVGMHEYDRTLAIAHIEDMARVKGMGDGVSGIRLKLDDMMA 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES 270
                  +   L     V+DW +++  FF   ++
Sbjct: 234 APWLAREVADDLPGQYRVVDWTRQHANFFRAVQT 267


>gi|114769538|ref|ZP_01447164.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [alpha proteobacterium HTCC2255]
 gi|114550455|gb|EAU53336.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [alpha proteobacterium HTCC2255]
          Length = 428

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 87/267 (32%), Positives = 137/267 (51%), Gaps = 15/267 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+R+E ++A RYL S R +  IS  ++IS IG+ + V ALI  ++V  GFR + +  +LG
Sbjct: 8   FNRYEWMIAIRYLRSKRSDGGISSMTWISLIGISLAVFALIATLAVRTGFRAEFVNTILG 67

Query: 64  INGHVVIQQKYY---------PLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
            N H  I    Y            +Y  I N ++ I  V+ V P V GQ   +  +    
Sbjct: 68  ANAHASIYNSPYINNDGVVVSGFANYNQIKNNIENIEGVLSVSPVVKGQVMANA-NGQNQ 126

Query: 115 GVLVRGISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
           GV V G +  D   L    S    YG++ + F+  KG+ IG  +AR+LG+ +GD + ++S
Sbjct: 127 GVEVFGETLIDIKKLPLIMSPELSYGSI-DSFE--KGIAIGSGIARSLGLKLGDTLTLIS 183

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P G  T  G   R   + V+ +F++   D DN  +YM L +AQ+YFN E  V   EV V 
Sbjct: 184 PDGVKTAFGTSPRINGFEVVYIFQVGRYDIDNTRIYMPLADAQIYFNSEGRVDEFEVIVN 243

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQ 259
           +P+ I+     ++  + N  ++  W+ 
Sbjct: 244 EPEDIDDLKILLLSSMSNSALIWTWRD 270


>gi|83942875|ref|ZP_00955335.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Sulfitobacter sp. EE-36]
 gi|83845883|gb|EAP83760.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Sulfitobacter sp. EE-36]
          Length = 415

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 81/274 (29%), Positives = 131/274 (47%), Gaps = 21/274 (7%)

Query: 10  IVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVV 69
           ++AWRYL + R    +S+ ++IS IG+ + V ALI  ++V +GFR + +  +LG N HV 
Sbjct: 1   MIAWRYLRARRAEGGVSVMTWISLIGITLAVFALIATLAVRSGFRAEFVDTILGANAHVT 60

Query: 70  I-----------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLV 118
           +            Q   P  DY  +A R+  +P V +V P V GQ   +      +G+ +
Sbjct: 61  VYNMASVDENGVSQTGIP--DYTEMAARVAQVPGVTQVAPLVRGQVMANK-GQANAGIEI 117

Query: 119 RGISNSDFSYLQNSFSRFYGNVSNDFDRG---KGVIIGKDLARNLGISIGDKINILSPYG 175
            GI  +D +    +  R     + D D     +G+ IG  +A+ L + +GD I I+SP G
Sbjct: 118 FGIEAADLA----NIPRIANPETADGDLADFEQGIAIGSGVAQALRVGLGDTIKIISPNG 173

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPD 235
             T  G   R   Y V  +F     D D    Y+ L EAQ +FN E     +EV V++PD
Sbjct: 174 VKTAFGTSPRVNGYEVTYIFSAGRYDIDRTRAYLPLAEAQSFFNREGVADELEVMVENPD 233

Query: 236 AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +++     ++   G   ++  W+     F S  +
Sbjct: 234 SVDDLTVPLLSAAGERGLIWTWRDASGSFLSALD 267


>gi|83954045|ref|ZP_00962765.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Sulfitobacter sp. NAS-14.1]
 gi|83841082|gb|EAP80252.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Sulfitobacter sp. NAS-14.1]
          Length = 415

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 81/274 (29%), Positives = 131/274 (47%), Gaps = 21/274 (7%)

Query: 10  IVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVV 69
           ++AWRYL + R    +S+ ++IS IG+ + V ALI  ++V +GFR + +  +LG N HV 
Sbjct: 1   MIAWRYLRARRAEGGVSVMTWISLIGITLAVFALIATLAVRSGFRAEFVDTILGANAHVT 60

Query: 70  I-----------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLV 118
           +            Q   P  DY  +A R+  +P V +V P V GQ   +      +G+ +
Sbjct: 61  VYNMASVDENGVSQTGIP--DYTEMAARVAQVPGVTQVAPLVRGQVMANK-GQANAGIEI 117

Query: 119 RGISNSDFSYLQNSFSRFYGNVSNDFDRG---KGVIIGKDLARNLGISIGDKINILSPYG 175
            GI  +D +    +  R     + D D     +G+ IG  +A+ L + +GD I I+SP G
Sbjct: 118 FGIEAADLA----NIPRIANPETADGDLADFEQGIAIGSGVAQALRVGLGDTIKIISPNG 173

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPD 235
             T  G   R   Y V  +F     D D    Y+ L EAQ +FN E     +EV V++PD
Sbjct: 174 VKTAFGTSPRVNGYEVTYIFSAGRYDIDRTRAYLPLAEAQSFFNREGVADELEVMVENPD 233

Query: 236 AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +++     ++   G   ++  W+     F S  +
Sbjct: 234 SVDDLTVPLLSAAGERGLIWTWRDASGSFLSALD 267


>gi|113867193|ref|YP_725682.1| ABC transporter permease [Ralstonia eutropha H16]
 gi|113525969|emb|CAJ92314.1| ABC-type transporter, permease component: LPT family [Ralstonia
           eutropha H16]
          Length = 416

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 145/269 (53%), Gaps = 9/269 (3%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E  + WRY  ++++   N FIS  S IS  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 5   YEWQIGWRYTRASKRASRNTFISFISMISMFGIALGVAALIVVLSVMNGFQKEVRDRMLS 64

Query: 64  INGHV-VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  H+ VI     P  D+Q  A       +V    P+V+ QA ++       GVL+RG+ 
Sbjct: 65  VLAHIEVIGPSALP--DWQKTAAEALQNKEVTGAAPYVAAQAMLT-RDDAVRGVLLRGVE 121

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            S    + +  S+F        + G  G+ +G +LA  +G+ +GDK+ +++P G +TP G
Sbjct: 122 PSQEPKVSDIGSQFRAGSMTALEPGGFGIALGNELANAMGVQVGDKVTLVAPQGTITPAG 181

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  R K +TV+G+F     ++D+ +  +++ +A+  F L    +G+ + ++D     +  
Sbjct: 182 VLPRLKQFTVVGVFSSGHFEFDSALALVNMHDAETLFRLSGP-TGVRLKLQDMQRAPQVA 240

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYES 270
             +   +   + + DW ++ + +F+  ++
Sbjct: 241 NELAGTMSGELYLRDWSKQNRNWFAAVQT 269


>gi|288940583|ref|YP_003442823.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Allochromatium vinosum DSM 180]
 gi|288895955|gb|ADC61791.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Allochromatium vinosum DSM 180]
          Length = 416

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 81/269 (30%), Positives = 137/269 (50%), Gaps = 7/269 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S  S +G+ +G++ALIVV+SVMNGF +++ +R+L
Sbjct: 1   MFHPLSLYIGLRYTRAKRRNHFISFISGTSMVGIALGIVALIVVLSVMNGFHKEIQQRIL 60

Query: 63  GINGHVVIQQKYYP-LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVR 119
            +  H  +   Y   + D+  +  ++   P V+   PF+  Q     L+SG   SG +VR
Sbjct: 61  AMASHATLSDPYGGGIADWPQVLEQVRAHPRVVGAAPFIEIQGM---LASGAQVSGAVVR 117

Query: 120 GISNSDFSYLQNSFSRFY-GNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
            I   +   + +       G+V    +    +I+G+DLA  LG+  GDK+ +++P    T
Sbjct: 118 AIEPVEEDEVADLRRHMVSGSVDALVNGAFNIILGQDLANYLGVGPGDKVTVVTPQVSST 177

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P+G+  R K +TV G+F +   DYD    ++ L +     +L  AV G+ + + D     
Sbjct: 178 PVGVMPRLKRFTVSGIFAVGMADYDRNAAFIHLADGARLMSLGEAVGGVRLKLDDMWQAP 237

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSC 267
           +    I   LG    ++DW Q +  FFS 
Sbjct: 238 RLAREIAYELGGVYRLVDWTQVHSNFFSA 266


>gi|308272632|emb|CBX29236.1| hypothetical protein N47_J02170 [uncultured Desulfobacterium sp.]
          Length = 412

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 89/270 (32%), Positives = 144/270 (53%), Gaps = 8/270 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ +  RYL + +K +FIS+ + +S +GVM+GVMALIVV++VM GF  D+  R+LG+  
Sbjct: 4   FELFIGGRYLRARQKQSFISLITILSVVGVMVGVMALIVVIAVMAGFETDLKSRILGVES 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI-SNSD 125
           HVV+ +      DY  +   +  I  V    PF+  Q  +   SSG SG +++G+   ++
Sbjct: 64  HVVVMRHGGEFSDYPAVLKNIRKINGVKDAAPFIYTQVMLKS-SSGVSGAVLKGVDPKAE 122

Query: 126 FSYLQNSFSRFYGNVSNDFDRG------KGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
              ++N  +    N   +           G+I+GK+LA  L +  GDKI ++SP G ++P
Sbjct: 123 GRIVKNLHALLLKNDEQEIKNNGYPNAVPGIILGKELAEKLRVYKGDKIYLISPAGMISP 182

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           +G     K Y V  +F     DYD  + Y+++++AQ    +  +++GIEV V D     K
Sbjct: 183 VGYLPSMKQYIVKDIFESGIHDYDASLAYINIEDAQKILRMNKSITGIEVNVIDIYNARK 242

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             ENI+  +G      DW Q  +  FS  +
Sbjct: 243 IAENIIDDIGFPYWARDWMQMNKNLFSALK 272


>gi|325294993|ref|YP_004281507.1| hypothetical protein Dester_0807 [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065441|gb|ADY73448.1| protein of unknown function DUF214 [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 408

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 81/263 (30%), Positives = 136/263 (51%), Gaps = 3/263 (1%)

Query: 10  IVAWRYLFSNR-KNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHV 68
           +V W  L   + K  ++S A FI+ +GV++GV ALI+V SVM GF++ + +++L  N  +
Sbjct: 4   LVRWLSLRGLKLKKGYLSFALFIAILGVVVGVAALIIVNSVMTGFQDAIKEKLLSSNADI 63

Query: 69  VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLS-SGGSGVLVRGISNSDFS 127
           ++ +K     +Y +   ++  +  V    PF+      S    S  SG  +RG       
Sbjct: 64  IVMKKSGAFYEYDYAERKIKELSHVKGTEPFIHIPVMASSTDISYASGASLRGCDPKKEP 123

Query: 128 YLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRS 186
            + +   +        F+  K GV++G+ LA NLGI+IGD+I +LSP G  TP G+  R+
Sbjct: 124 TVTDIPRKLILGDWQLFENTKDGVVVGRILADNLGITIGDRITLLSPMGRKTPFGIIPRT 183

Query: 187 KSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVR 246
            S+ V+G+F +    +D+G++   + E +  F L N V+GI V + DP+  +     I  
Sbjct: 184 ASFKVVGIFEVGMYQFDSGLILAHIDEVRKKFGLGNIVTGIMVKLDDPENAKIVERKIEE 243

Query: 247 ILGNGVVVIDWQQRYQIFFSCYE 269
            LGN  +  DW    +  FS  +
Sbjct: 244 TLGNEFIAQDWISLNKSLFSALK 266


>gi|149378068|ref|ZP_01895790.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Marinobacter algicola DG893]
 gi|149357637|gb|EDM46137.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Marinobacter algicola DG893]
          Length = 413

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 85/271 (31%), Positives = 137/271 (50%), Gaps = 14/271 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + V  RY  + R+N FIS  S  S IG+M+GV  LI+V+SVMNGF  ++ +R+L
Sbjct: 1   MFRPLSLYVGLRYTAAKRRNHFISFISLTSMIGLMLGVAVLIIVLSVMNGFDRELKQRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H VIQ     L D+Q +   ++  P VI   PF+ GQ  V+G   GG   GV++ G
Sbjct: 61  GMVPHAVIQGN-PDLDDWQEVDREVEKHPSVIAAAPFIQGQGMVTG---GGDVRGVMLNG 116

Query: 121 I---SNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGD 176
           +        S ++N      G + +D   G+ G+IIG+ +A +L + +GD++ ++ P   
Sbjct: 117 VLPEQERSVSIIENHM--IEGGL-DDLKSGEFGIIIGRQMAASLRLQLGDRVTVVLPEAS 173

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
           VTP G+  R K +TV G+F +   + D     + + +A      +    G+ + V D   
Sbjct: 174 VTPAGVLPRLKRFTVKGVFSVG-AELDGNYTLIHMDDASKLIRTDGKAQGVRLLVDDLFQ 232

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
             K  E + R L     + DW + +   F  
Sbjct: 233 APKVAEEVARQLSGRHYISDWTRTHGNLFQA 263


>gi|254294082|ref|YP_003060105.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Hirschia baltica ATCC 49814]
 gi|254042613|gb|ACT59408.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Hirschia baltica ATCC 49814]
          Length = 444

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 81/251 (32%), Positives = 134/251 (53%), Gaps = 13/251 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F  FE ++A+RY+ + R++  +++ S +S +GV + V ALI +MS+MNGFR +++ +V+G
Sbjct: 28  FGPFERMLAFRYIRAKREHGGLALISVVSTVGVTLAVFALITIMSIMNGFRLELLSKVVG 87

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGI 121
              HV +     P  D   +  R+  +  V+ V P +          SGG   GV V+G+
Sbjct: 88  FEPHVYVNAVEMPTADADDLGRRISELDGVVNVAPVIEEMVLA---DSGGRKEGVSVKGL 144

Query: 122 SNSDFSYLQNSFSRF-YGNVSN---DFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
              D   +    S    G++S    +  R   ++IG+ LAR++G  +G +I +LSP G  
Sbjct: 145 RPHDLEAIDLIVSHISEGDLSQFGVEGTRSDTIVIGEGLARSMGAVVGSRIKLLSPNGPS 204

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           T MG   RSK YTV  ++ +    YD   V M +  A+L+F+  ++   + V ++DPD  
Sbjct: 205 TVMGQVPRSKVYTVTAIYNVGNEKYDRYTVIMPMAHARLFFSKGDSYQYLGVRIEDPD-- 262

Query: 238 EKTHENIVRIL 248
               EN+VR L
Sbjct: 263 --QAENLVRSL 271


>gi|114798078|ref|YP_760469.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Hyphomonas neptunium ATCC 15444]
 gi|114738252|gb|ABI76377.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Hyphomonas neptunium ATCC 15444]
          Length = 423

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 77/273 (28%), Positives = 137/273 (50%), Gaps = 9/273 (3%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F + E  +AWRYL + R++   S+ + ISFIG+   V ALI+ MS+M+GFR  ++  +LG
Sbjct: 7   FGKLERTLAWRYLRARREHGGASLIAVISFIGIFFAVAALIITMSIMSGFRATLLDALLG 66

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVS--GLSSGGSGVLVRGI 121
              H+       P  + + +A  +   PDVI   P++     +S  G+ +GG   +VR +
Sbjct: 67  GEPHISAAVDGMPQDEAEALAKIISETPDVISASPYIEQFVLLSANGVRTGG---VVRAV 123

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGKG----VIIGKDLARNLGISIGDKINILSPYGDV 177
             +D   +          ++  F +G+     ++IG+ LA NLG+  GD + +++     
Sbjct: 124 PPADLKTMPILKDGGEAALAAGFGQGRNGGNVIMIGQYLAANLGLQPGDSVEVVTSQMRS 183

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
            P+G    SKSY V  +FR      DN  V+M + +AQ+ F  +     +++ VK+PD  
Sbjct: 184 GPLGQTPISKSYVVGDIFRTGSAQLDNVYVFMPMNQAQILFQSKGRYQFLDIRVKNPDMT 243

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYES 270
           E   + I    G  +++ DW+ + + +     +
Sbjct: 244 EVAMQRISEATGYSLLLRDWKTKNRTYLGALRT 276


>gi|206889294|ref|YP_002249050.1| ABC transporter, permease protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741232|gb|ACI20289.1| ABC transporter, permease protein [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 401

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 86/271 (31%), Positives = 138/271 (50%), Gaps = 18/271 (6%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           R    +A RYL S +K   +S  + IS  G+ +GVMALIVV+SV++GF ED+ K++LG  
Sbjct: 2   RLPFFIALRYLKSRKKG--LSFGAVISISGIALGVMALIVVISVVSGFHEDLQKKILGTQ 59

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI---- 121
            H V+      + DY+ + + L    ++    PF+ GQ  +S       GV +RGI    
Sbjct: 60  AHAVLLSYSGGISDYKTMMDFLSKKNEIQACSPFIMGQVLISS-GKRAHGVYLRGIIPEY 118

Query: 122 ---SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
              +   F Y++  +         ++     +IIGK+LA  LG+  GD I ++SP G + 
Sbjct: 119 DRKTTEIFKYIKYKY--------ENYTELPWIIIGKELANMLGVLPGDTITVISPMGTMG 170

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P+G+  + K + V G+F +   +YD  +V   L+ AQ +F   N V+GI++ +KD     
Sbjct: 171 PLGIIPKVKKFIVTGIFEIGMFEYDMNLVITDLKIAQDFFEYGNKVTGIQLRLKDVYKAN 230

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              + I + L     V DW Q  +  FS  +
Sbjct: 231 FISQAITKELDGEFYVKDWMQMNKNLFSALK 261


>gi|258406353|ref|YP_003199095.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfohalobium retbaense DSM 5692]
 gi|257798580|gb|ACV69517.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfohalobium retbaense DSM 5692]
          Length = 409

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 89/269 (33%), Positives = 142/269 (52%), Gaps = 8/269 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE  +A RYL + RK  FIS+ S IS +GV +GV ALIVV+ VMNGF  ++  ++LG+N 
Sbjct: 3   FERFIAVRYLLARRKQTFISVISLISVLGVGLGVAALIVVLGVMNGFSNELRDKILGVNA 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           HV++        DY+  A  +  +  V  V+PF+  +   S    G  G  +RGI     
Sbjct: 63  HVIVGATSGGFADYEQTAETVRRVQGVTGVMPFIYSEVMCS-TPHGVKGAALRGIDPERA 121

Query: 127 SYLQNSFSRF-YGNVSNDFDRGK--GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
             + N   +   G++    + G+  G+I+G+DLA  LG+  G  IN+LSP G  +  G  
Sbjct: 122 PEVLNLGEQMVQGSLQALTEPGEYPGIILGQDLADRLGVFSGRTINLLSPSGQSSAAGFS 181

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ--LYFNLENAVSGIEVFVKDPDAIEKTH 241
            + K + V+G+F     +YD+ + Y+ L  A+  L F  E  V+G+EV + D     +  
Sbjct: 182 PKIKIFRVVGVFESGMYEYDSSLAYVGLPAARDLLGFGGE-LVTGLEVRLADVYQAPQIG 240

Query: 242 ENIV-RILGNGVVVIDWQQRYQIFFSCYE 269
           E ++ R+  +   V +W +  + FFS  +
Sbjct: 241 EAVLERLDPSRFYVRNWMEMNESFFSALK 269


>gi|148244906|ref|YP_001219600.1| lipoprotein ABC transporter permease LolE [Candidatus
           Vesicomyosocius okutanii HA]
 gi|146326733|dbj|BAF61876.1| lipoprotein ABC transporter permease LolE [Candidatus
           Vesicomyosocius okutanii HA]
          Length = 411

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 89/264 (33%), Positives = 144/264 (54%), Gaps = 10/264 (3%)

Query: 8   EVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGH 67
           E I++ +YL SN+K  FIS    +S +G+++ V+ LI V+SVMNGF +++  RVL    H
Sbjct: 4   EFIISNQYLRSNQKKGFISFIPGVSIVGLILSVVTLITVLSVMNGFHKELRDRVLNTISH 63

Query: 68  VVIQQKYYPLVD-YQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
             I Q Y  LVD +Q +  +++  P+V+   P++   A +S   +G  GV VRGI  +  
Sbjct: 64  SYITQ-YNNLVDNWQNLQTKINKHPNVVSTSPYIEKYALLST-HNGTQGVNVRGIRPN-- 119

Query: 127 SYLQNSFSRFYGNVS--NDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGI 184
             L+   S     +   N       ++IG  LA  LG+ IGDKI +L+P      +G+  
Sbjct: 120 --LEKKTSILLDKIKSGNANLLKSDILIGTGLATQLGLIIGDKITLLTPKLSSNIIGIQP 177

Query: 185 RSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIEKTHEN 243
           R K +T+ G+F     +YDN + ++SL++AQ  + +++ VSGI + V D  +A + T+E 
Sbjct: 178 RFKRFTISGIFDAGISEYDNNLAFISLEQAQKLYIMKDKVSGIRLKVDDLFNAKKITNEI 237

Query: 244 IVRILGNGVVVIDWQQRYQIFFSC 267
           I  +L      IDW ++   F   
Sbjct: 238 ITNLLDGRYYGIDWTEQKANFIKA 261


>gi|319943691|ref|ZP_08017972.1| lipoprotein ABC superfamily ATP binding cassette transporter,
           permease protein [Lautropia mirabilis ATCC 51599]
 gi|319742924|gb|EFV95330.1| lipoprotein ABC superfamily ATP binding cassette transporter,
           permease protein [Lautropia mirabilis ATCC 51599]
          Length = 434

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 88/272 (32%), Positives = 146/272 (53%), Gaps = 8/272 (2%)

Query: 3   IFSRFEVIVAWRYLFSNR----KNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMI 58
           + S FE  V  RY  S +    KN FIS  S +S  G+ +GV ALI+VMSVMNGF++++ 
Sbjct: 18  LLSPFEWFVGLRYTRSGKRAGKKNGFISFISTLSVAGIALGVAALIIVMSVMNGFQKEVR 77

Query: 59  KRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLV 118
            R+L +  HV +     PL ++Q +A +L     V    PFVSGQ  +S  +    G LV
Sbjct: 78  DRMLSVLSHVEVYHVDGPL-NWQPLAEKLRGHDHVTGAAPFVSGQVVIS-RNQTVRGALV 135

Query: 119 RGISNSDFSYLQNSFSRFY-GNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
           RGI  +    + +   +   G++S       G++IG+ LA  LG+  GD++ +++P G V
Sbjct: 136 RGIVPAIEPQVSDMAGQVVEGSLSALTPGSFGIVIGRVLANQLGLIEGDRLALIAPQGTV 195

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           +P G+  R K +TV G+F     +YD+ ++  +L +A  +F    A+ G+ + + D    
Sbjct: 196 SPAGVVPRMKQFTVRGIFESGHYEYDSTLILANLDDAATFFRTGGAM-GLRLRLDDMQRA 254

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +  + +   LG+G  V DW    +++F+  +
Sbjct: 255 PEIGQQLGAELGDGYQVRDWSLENRVWFAAVQ 286


>gi|52842498|ref|YP_096297.1| lipoprotein ABC transporter [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52629609|gb|AAU28350.1| lipoprotein ABC transporter [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
          Length = 451

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/267 (29%), Positives = 141/267 (52%), Gaps = 4/267 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           ++    + +  RY  S +KN F+S  S  S +G+ +GVM LI V+SVMNGF +++ +R  
Sbjct: 37  MYKPLALFIGLRYTRSRKKNHFVSFISLSSMLGIGMGVMVLITVLSVMNGFDQEIHRRFF 96

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+   + I      L D+  +  +++ IP +  + P+V  Q  ++        VL   + 
Sbjct: 97  GMAPEITITGPDERLSDWPEVVKKVETIPGIKAIAPYVGSQGLLTHEGQVLPIVLTGILP 156

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
             + S    +     GN+SN   +  G+I+GK LA +LG+ IGDK+ I+ P   VTP GM
Sbjct: 157 EKEQSVTHLNKKLLAGNMSN--LKHFGIILGKGLADSLGVMIGDKVTIMIPQATVTPAGM 214

Query: 183 GIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEKT 240
             R K +TV+G+F      ++D  + ++++++AQ    ++ N VSGI++ + +     + 
Sbjct: 215 IPRFKRFTVVGVFSAGTGFNFDTKLAFINIEDAQKLMQMDKNDVSGIKMKINNVYKAPEL 274

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSC 267
              +  +LG G  V +W Q++  FF  
Sbjct: 275 SYELSDLLGEGYQVGNWTQQFGAFFEA 301


>gi|254995362|ref|ZP_05277552.1| hypothetical protein AmarM_05439 [Anaplasma marginale str.
           Mississippi]
          Length = 408

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 137/265 (51%), Gaps = 14/265 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E ++A RY+ SN      S A+ +S +G+ IGV  LI V SVMNGF   ++  +LG+NG
Sbjct: 8   LEWLLARRYIQSNGGRFLFSTATVLSILGICIGVATLISVTSVMNGFSAKLLSSILGMNG 67

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+ I     P  DY  +   +  +P V+   P + GQA +    +   G +VRG+   D 
Sbjct: 68  HITIHCNR-P--DYPNVIAEIYHVPGVVSAAPVIEGQALLK-YENNIMGAVVRGMHMCDI 123

Query: 127 SYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIR 185
               + +      V  D D   +G+++G  LA ++G   GD+I I+SP    T  G   R
Sbjct: 124 RRKLHGYV-----VRGDVDMLEEGIVLGFRLAESIGADYGDEITIISPETSPTIFGAVPR 178

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIV 245
           +K+Y V G+F +   +YD+   Y+ L+++QL F   N +  IEVF++D   + K+ E +V
Sbjct: 179 TKTYKVTGIFDVGVYEYDSAFAYIPLRDSQLLFGYANKIKYIEVFLED---VTKSSEALV 235

Query: 246 RIL-GNGVVVIDWQQRYQIFFSCYE 269
            I     + V DW+ +   +F   E
Sbjct: 236 EIARRTSLKVEDWKVQQGQYFRALE 260


>gi|255004675|ref|ZP_05279476.1| hypothetical protein AmarV_05264 [Anaplasma marginale str.
           Virginia]
          Length = 403

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 137/265 (51%), Gaps = 14/265 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E ++A RY+ SN      S A+ +S +G+ IGV  LI V SVMNGF   ++  +LG+NG
Sbjct: 3   LEWLLARRYIQSNGGRFLFSTATVLSILGICIGVATLISVTSVMNGFSAKLLSSILGMNG 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+ I     P  DY  +   +  +P V+   P + GQA +    +   G +VRG+   D 
Sbjct: 63  HITIHCNR-P--DYPNVIAEIYHVPGVVSAAPVIEGQALLK-YENNIMGAVVRGMHMCDI 118

Query: 127 SYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIR 185
               + +      V  D D   +G+++G  LA ++G   GD+I I+SP    T  G   R
Sbjct: 119 RRKLHGYV-----VRGDVDMLEEGIVLGFRLAESIGADYGDEITIISPETSPTIFGAVPR 173

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIV 245
           +K+Y V G+F +   +YD+   Y+ L+++QL F   N +  IEVF++D   + K+ E +V
Sbjct: 174 TKTYKVTGIFDVGVYEYDSAFAYIPLRDSQLLFGYANRIKYIEVFLED---VTKSSEALV 230

Query: 246 RIL-GNGVVVIDWQQRYQIFFSCYE 269
            I     + V DW+ +   +F   E
Sbjct: 231 EIARRTSLKVEDWKVQQGQYFRALE 255


>gi|255003548|ref|ZP_05278512.1| hypothetical protein AmarPR_04909 [Anaplasma marginale str. Puerto
           Rico]
          Length = 408

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 137/265 (51%), Gaps = 14/265 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E ++A RY+ SN      S A+ +S +G+ IGV  LI V SVMNGF   ++  +LG+NG
Sbjct: 8   LEWLLARRYIQSNGGRFLFSTATVLSILGICIGVATLISVTSVMNGFSAKLLSSILGMNG 67

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+ I     P  DY  +   +  +P V+   P + GQA +    +   G +VRG+   D 
Sbjct: 68  HITIHCNR-P--DYPNVIAEIYHVPGVVSAAPVIEGQALLK-YENNIMGAVVRGMHMCDI 123

Query: 127 SYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIR 185
               + +      V  D D   +G+++G  LA ++G   GD+I I+SP    T  G   R
Sbjct: 124 RRKLHGYV-----VRGDVDMLEEGIVLGFRLAESIGADYGDEITIISPETSPTIFGAVPR 178

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIV 245
           +K+Y V G+F +   +YD+   Y+ L+++QL F   N +  IEVF++D   + K+ E +V
Sbjct: 179 TKTYKVTGIFDVGVYEYDSAFAYIPLRDSQLLFGYANRIKYIEVFLED---VTKSSEALV 235

Query: 246 RIL-GNGVVVIDWQQRYQIFFSCYE 269
            I     + V DW+ +   +F   E
Sbjct: 236 EIARRTSLKVEDWKVQQGQYFRALE 260


>gi|56417192|ref|YP_154266.1| hypothetical protein AM1183 [Anaplasma marginale str. St. Maries]
 gi|56388424|gb|AAV87011.1| hypothetical protein AM1183 [Anaplasma marginale str. St. Maries]
          Length = 408

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 137/265 (51%), Gaps = 14/265 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E ++A RY+ SN      S A+ +S +G+ IGV  LI V SVMNGF   ++  +LG+NG
Sbjct: 8   LEWLLARRYIQSNGGRFLFSTATVLSILGICIGVATLISVTSVMNGFSAKLLSSILGMNG 67

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+ I     P  DY  +   +  +P V+   P + GQA +    +   G +VRG+   D 
Sbjct: 68  HITIHCNR-P--DYPNVIAEIYHVPGVVSAAPVIEGQALLK-YENNIMGAVVRGMHMCDI 123

Query: 127 SYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIR 185
               + +      V  D D   +G+++G  LA ++G   GD+I I+SP    T  G   R
Sbjct: 124 RRKLHGYV-----VRGDVDMLEEGIVLGFRLAESIGADYGDEITIISPETSPTIFGAVPR 178

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIV 245
           +K+Y V G+F +   +YD+   Y+ L+++QL F   N +  IEVF++D   + K+ E +V
Sbjct: 179 TKTYKVTGIFDVGVYEYDSAFAYIPLRDSQLLFGYANRIKYIEVFLED---VTKSSEALV 235

Query: 246 RIL-GNGVVVIDWQQRYQIFFSCYE 269
            I     + V DW+ +   +F   E
Sbjct: 236 EIARRTSLKVEDWKVQQGQYFRALE 260


>gi|118602817|ref|YP_904032.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
 gi|118567756|gb|ABL02561.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Candidatus Ruthia magnifica str. Cm (Calyptogena
           magnifica)]
          Length = 411

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 82/264 (31%), Positives = 140/264 (53%), Gaps = 10/264 (3%)

Query: 8   EVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGH 67
           E  ++ +YL S+RK  F+S  S +S +G+++ ++ LI V+SVMNGF +++  RVL    H
Sbjct: 4   EFTISNQYLCSSRKKGFVSFISGVSMVGLILSIVTLITVLSVMNGFHKELRDRVLNAISH 63

Query: 68  VVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS---NS 124
             I Q    + ++Q +  +++  P++I   P++   A +S   +G  G+ VRGI      
Sbjct: 64  SYITQYNNLINNWQDLQAKINQHPNIISTSPYIEKYALLSA-KNGTQGISVRGIKPDLEK 122

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGI 184
             S L N       N+         ++IG  LA  LG+ I DKI +L+P      +G+  
Sbjct: 123 KTSILLNRIKSGNANLLKS-----DILIGAGLAAQLGVIINDKITLLTPKLSSNIIGIQS 177

Query: 185 RSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIEKTHEN 243
           R K +T+ G+F     +YDN +V++SL++AQ  ++++  VSGI + V D  +A + T E 
Sbjct: 178 RFKRFTISGIFDAGISEYDNNLVFISLEQAQKLYSMKGQVSGIRLKVDDLFNAKKITQEV 237

Query: 244 IVRILGNGVVVIDWQQRYQIFFSC 267
           +  +  N    IDW ++   F   
Sbjct: 238 VASLQSNQYYGIDWTEQKANFIKA 261


>gi|126667255|ref|ZP_01738228.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Marinobacter sp. ELB17]
 gi|126628200|gb|EAZ98824.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Marinobacter sp. ELB17]
          Length = 413

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/271 (30%), Positives = 141/271 (52%), Gaps = 14/271 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RY+ + R+N FIS  S  S IG+M+GV  LI+V+SVMNGF  ++ +R+L
Sbjct: 1   MFKPLSFYIGLRYIAAKRRNHFISFISLTSMIGLMLGVAVLIIVLSVMNGFDRELKQRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H +I+    P+ +++ +   ++  P V+   PF+ GQ  V+G   GG   GVL+ G
Sbjct: 61  GMVPHAIIEGS-GPIENWEALDAAVEKHPRVLAAAPFIQGQGMVTG---GGEVRGVLLNG 116

Query: 121 I---SNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGD 176
           I        S +++   +  G++ +D   G+ G+IIG+ LA +L + +GDKI ++ P   
Sbjct: 117 ILPDQERTVSIIEDHMEQ--GSL-DDLKSGEFGIIIGRFLASSLRLQLGDKITVVLPEAS 173

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
           VTP G+  R K +TV G+F +   + D     + + +A      +    GI + V D  A
Sbjct: 174 VTPAGVLPRLKRFTVKGVFSVG-AELDGSYTLIHMDDAAKLMRTDGKAQGIRLLVDDLFA 232

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
             +  E   ++L     + DW + +   F  
Sbjct: 233 APRVAEQAAQLLSGRYYISDWTRTHGNLFQA 263


>gi|225848139|ref|YP_002728302.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643681|gb|ACN98731.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 403

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/261 (32%), Positives = 138/261 (52%), Gaps = 8/261 (3%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           ++ RYL S + N  +S  + +S +GVM+GV ALIV +SVMNGF   +  ++L    H++I
Sbjct: 9   ISLRYLLSIKSN-LLSFMTVVSIVGVMLGVAALIVTLSVMNGFMFGLKSKLLQTTPHIMI 67

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI-SNSDFSYL 129
            +      DY  +  ++   P V+   PF+  Q  +S   S  S V VRG+    D ++L
Sbjct: 68  LKADEKFDDYNQLIQKIKQNPQVLDYQPFIYTQGILSK-DSKVSAVYVRGVDPEKDKNFL 126

Query: 130 QNSFSRFYGNVSNDFDRG-KGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKS 188
                   GN    +D   + VIIGKDLA  LGI++GD++N++SP G  TP+G   + K 
Sbjct: 127 ALDKRIILGN----YDLSDECVIIGKDLAIMLGITVGDQVNLMSPVGRKTPLGFLPKIKP 182

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL 248
             V G+  +   +Y+   V  +L  AQ +F++ ++++ I++ +KDP   E    +I ++L
Sbjct: 183 VKVCGIADLGIYEYNASFVATNLSFAQNFFDMGDSITAIQLKLKDPFKAEAVKSDIEKVL 242

Query: 249 GNGVVVIDWQQRYQIFFSCYE 269
               +V  W    +  F   E
Sbjct: 243 EFPYIVKSWMDMNKSLFQALE 263


>gi|302037375|ref|YP_003797697.1| lipoprotein-releasing system, transmembrane protein lolC
           [Candidatus Nitrospira defluvii]
 gi|300605439|emb|CBK41772.1| Lipoprotein-releasing system, transmembrane protein LolC
           [Candidatus Nitrospira defluvii]
          Length = 425

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/284 (29%), Positives = 147/284 (51%), Gaps = 22/284 (7%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+ +  RYL + R+N  IS  + +S  G+ +GV ALI  + +M GF+ED+  ++LG   
Sbjct: 5   YEIFIGLRYLRAKRRNRTISFNTIVSIAGITLGVAALIGTVGIMTGFKEDVQAKILGTTA 64

Query: 67  HVVIQQKYYP-LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS- 124
           H+++  +    +VDY+    ++  +PDV+   PF+  Q  ++   SG  G+++RGI  + 
Sbjct: 65  HILVNDRMKESMVDYEEQVKKVAAVPDVVAATPFIFRQVLLTS-PSGVQGIILRGIDPAR 123

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGK-------------------GVIIGKDLARNLGISIG 165
           + +  + + +   GN+ +   + K                   G+I+GK+L+  LG   G
Sbjct: 124 EGTVTELAHNLVNGNLDDLARQNKVVIPEKEREPNGPETAMRPGIILGKELSMRLGAFPG 183

Query: 166 DKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVS 225
           D +N++SP G VT   M  + + + V+G+F+    +YD+ + Y+ L EAQ +FN+  +V+
Sbjct: 184 DTLNVVSPVGPVTGASMTPKIRQFVVVGIFQSGMYEYDSSLAYIELGEAQKFFNMGASVT 243

Query: 226 GIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           GIEV V D          I   LG      DW Q  +  FS  +
Sbjct: 244 GIEVKVTDVFRAADIARAIEHHLGFAFWARDWMQMNRNLFSALK 287


>gi|94987468|ref|YP_595401.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Lawsonia intracellularis PHE/MN1-00]
 gi|94731717|emb|CAJ55080.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Lawsonia intracellularis PHE/MN1-00]
          Length = 427

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/275 (30%), Positives = 134/275 (48%), Gaps = 24/275 (8%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           +FE+ +A  YLF+ RK AFI + S +S +GV IGV +L+VV+ V NGF  D+  ++LG N
Sbjct: 2   KFELFIALHYLFARRKQAFIYLISLMSILGVAIGVASLVVVLGVYNGFTIDIRDKILGAN 61

Query: 66  GHVVIQQKYYPLVDYQ-----------------FIANRLDFIPDVIKVLPFVSGQAFVSG 108
            H++I   +   ++                    I N+L     +I   PF+  +  +S 
Sbjct: 62  AHIIITGNFDSPIEEPTSFTQLSTTSMLSQNALIILNKLQQTSAIIGATPFIYAECMISS 121

Query: 109 LSSGGSGVLVRGISNSDFSYLQNSFSRFY-GNVSNDFDR----GKGVIIGKDLARNLGIS 163
              G  G+++RGI  S    + +  S    GN+ +   +      G+IIG +LA+ L ++
Sbjct: 122 -PHGVKGLILRGIDPSSAQNVISMLSHLTKGNLEDLIPKVLGTPDGIIIGNELAQRLNVT 180

Query: 164 IGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-EN 222
           IG ++N+LSP G  T  G   R +   V G+F     +YD  + + SL  A+    L  N
Sbjct: 181 IGSRVNLLSPTGQKTSSGFQPRIRPLIVTGIFHTGMFEYDTSLAFTSLNAARELLGLPHN 240

Query: 223 AVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDW 257
            +SGIEV + D          + + LG+   V  W
Sbjct: 241 YISGIEVSIHDVYQANYITNQLQQELGHNFSVRSW 275


>gi|54298182|ref|YP_124551.1| hypothetical protein lpp2239 [Legionella pneumophila str. Paris]
 gi|53751967|emb|CAH13391.1| hypothetical protein lpp2239 [Legionella pneumophila str. Paris]
          Length = 415

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 141/269 (52%), Gaps = 4/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           ++    + +  RY  S +KN F+S  S  S +G+ +GVM LI V+SVMNGF +++ +R  
Sbjct: 1   MYKPLALFIGLRYTRSRKKNHFVSFISLSSMLGIGMGVMVLITVLSVMNGFDQEIHRRFF 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+   + I      L D+  +  +++ IP +  + P+V  Q  ++        VL   + 
Sbjct: 61  GMAPEITITGPDERLSDWPEVVKKVETIPGIKAIAPYVGSQGLLTHEGQVLPIVLTGILP 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
             + S    +     GN+ N   +  G+I+GK LA +LG+ IGDK+ I+ P   VTP GM
Sbjct: 121 EKEQSVTHLNKKLLAGNMDN--LKHFGIILGKGLADSLGVMIGDKVTIMIPQATVTPAGM 178

Query: 183 GIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEKT 240
             R K +TV+G+F      ++D  + ++++++AQ    ++ N VSGI++ + +     + 
Sbjct: 179 IPRFKRFTVVGVFSAGTGFNFDTKLAFINIEDAQKLMQMDKNDVSGIKMKINNVYKAPEL 238

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +  +LG G  V +W Q++  FF   +
Sbjct: 239 SYELSDLLGEGYQVGNWTQQFGAFFEAVK 267


>gi|296136689|ref|YP_003643931.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Thiomonas intermedia K12]
 gi|295796811|gb|ADG31601.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Thiomonas intermedia K12]
          Length = 422

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 146/266 (54%), Gaps = 7/266 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FE+++ WRY  S R+   N FIS  S +S  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 9   FELLIGWRYTRSGRRSRRNGFISFISAVSVGGIALGVAALIVVISVMNGFQKEVRDRMLN 68

Query: 64  INGHV-VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  H+ ++      L D++ +A ++   P V  V PFV GQA V+   S   GVLV G+ 
Sbjct: 69  VIPHIQILNVNGQALPDWRGVAQQVKSNPAVTGVAPFVQGQALVAQ-GSQLQGVLVWGVE 127

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            S+ + +                 G  GV++G +LA  LG+ +GD+I ++ P G +TP G
Sbjct: 128 PSEETQVSQIPEHMVAGSLAALKPGDFGVVLGNELANALGVGVGDQITMVVPSGSITPAG 187

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           M  R ++  V+G+F +   +YD+ +  ++LQ+A   F      +G+ V  ++ +   +  
Sbjct: 188 MIPRLRTLRVVGIFNVGHYEYDSTLALVNLQDASALFR-TGGPTGLRVQTRNMNDAPQIA 246

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
           +++ R+L   +V   W ++ + +F  
Sbjct: 247 QDLQRVLPPELVAQPWTEQNRTWFEA 272


>gi|319791977|ref|YP_004153617.1| lipoprotein releasing system, transmembrane protein, lolc/e family
           [Variovorax paradoxus EPS]
 gi|315594440|gb|ADU35506.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Variovorax paradoxus EPS]
          Length = 418

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 85/274 (31%), Positives = 149/274 (54%), Gaps = 19/274 (6%)

Query: 7   FEVIVAWRYLFS---NRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           +E+ + WRY  +    R+N FIS  S +S +G+ +GV ALI+V+SVMNGF++++  R+LG
Sbjct: 5   YELQLGWRYTRAGRATRRNGFISFISGVSMLGIALGVAALIIVLSVMNGFQKEVRDRMLG 64

Query: 64  INGHVVI---QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           +  H+ I     +    +D    A R +  P+VI   PF++ QA ++       G +VRG
Sbjct: 65  VVSHIEIFSRDGQALQSLDEIMAAARKN--PEVIGAAPFINTQALIA-RGEDMKGAIVRG 121

Query: 121 ISNSDFSYLQNSFSRFYGNVSN-DFDR---GK-GVIIGKDLARNLGISIGDKINILSPYG 175
           I       L+   +   G  S   FD+   G+ G+++G +LAR++ +  GDK+ +++P G
Sbjct: 122 IDPK----LEPEVTDTGGIASKGTFDKLVPGEFGIVLGVELARSMFVQPGDKVTLVAPGG 177

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPD 235
            VTP G+  R K +TV+G F     +YD+ +  +  Q+A   F LE   +GI + +KD +
Sbjct: 178 QVTPAGVVPRLKQFTVVGTFDSGHYEYDSALAMVHEQDAAKVFRLEGP-TGIRLKLKDLN 236

Query: 236 AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
                 + +   L    ++ DW ++ + +F+  +
Sbjct: 237 EARDVADQLAVSLPGEFLIRDWTRQNKTWFAAVQ 270


>gi|255067892|ref|ZP_05319747.1| lipoprotein releasing system, permease protein [Neisseria sicca
           ATCC 29256]
 gi|255047880|gb|EET43344.1| lipoprotein releasing system, permease protein [Neisseria sicca
           ATCC 29256]
          Length = 375

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 79/273 (28%), Positives = 146/273 (53%), Gaps = 12/273 (4%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
            +  E  +  RYL + ++N F+S  + IS +G+ +GVMALIVV+SVM GF+ D+  ++L 
Sbjct: 1   MASLETWIGLRYLRAKKRNGFMSFITVISIVGIALGVMALIVVLSVMAGFQRDIRGQLLK 60

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIP---DVIKVLPFVSGQAFVSGLSSGGS--GVLV 118
           +  H   +  YY   + +   +  + I    +V++  P+VSGQA    L++ G   GV +
Sbjct: 61  VAPHA--EMGYYDNGNGKSWESLREIIKGRKEVLQSAPYVSGQAL---LANAGEVQGVQI 115

Query: 119 RGISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
           RGI   +   +            +D   G+  +I+G+DLA  L + +G+KI +++P G+V
Sbjct: 116 RGILPDEEKKIVEYSKEMPVGSFDDLKPGEFDIILGQDLAETLDVKVGEKITVVTPEGNV 175

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DA 236
           TP G+  R K + V+G+ + +  + +N +    +++AQ+ + L+   +G+ + + DP +A
Sbjct: 176 TPAGVVPRLKQFKVVGLVKTKIHELNNSLALTHMKDAQVLYRLDENAAGLRLKLADPINA 235

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              T   + + L   V + DW    + +F   E
Sbjct: 236 PSFTETLLPKNLQEEVWLRDWTYTNRSYFEAVE 268


>gi|294340844|emb|CAZ89239.1| putative Lipoprotein releasing system, LolC/E family [Thiomonas sp.
           3As]
          Length = 422

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 84/266 (31%), Positives = 146/266 (54%), Gaps = 7/266 (2%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FE+++ WRY  S R+   N FIS  S +S  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 9   FELLIGWRYTRSGRRSRRNGFISFISAVSVGGIALGVAALIVVISVMNGFQKEVRDRMLN 68

Query: 64  INGHV-VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           +  H+ ++      L D++ +A ++   P V  V PFV GQA V+   S   GVLV G+ 
Sbjct: 69  VIPHIQILNVNGQALPDWRGVAQQVKSNPAVTGVAPFVQGQALVAQ-GSQLQGVLVWGVE 127

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            S+ + +                 G  GV++G +LA  LG+ +GD+I ++ P G +TP G
Sbjct: 128 PSEETQVSQIPEHMVAGSLAALKPGDFGVVLGNELANALGVGVGDQITMVVPSGSITPAG 187

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           M  R ++  V+G+F +   +YD+ +  ++LQ+A   F      +G+ V  ++ +   +  
Sbjct: 188 MIPRLRTLRVVGIFNVGHYEYDSTLALVNLQDASALFR-TGGPTGLRVQTRNMNDAPQIA 246

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
           +++ R+L   +V   W ++ + +F  
Sbjct: 247 QDLQRVLPPELVAQPWTEQNRTWFEA 272


>gi|148359829|ref|YP_001251036.1| lipoprotein ABC transporter [Legionella pneumophila str. Corby]
 gi|148281602|gb|ABQ55690.1| lipoprotein ABC transporter [Legionella pneumophila str. Corby]
          Length = 451

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 141/269 (52%), Gaps = 4/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           ++    + +  RY  S +KN F+S  S  S +G+ +GVM LI V+SVMNGF +++ +R  
Sbjct: 37  MYKPLALFIGLRYTRSRKKNHFVSFISLSSMLGIGMGVMVLITVLSVMNGFDQEIHRRFF 96

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+   + I      L D+  +  +++ IP +  + P+V  Q  ++        VL   + 
Sbjct: 97  GMAPEITITGPDERLSDWPEVVKKVETIPGIKAIAPYVGSQGLLTHEGQVLPIVLTGILP 156

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
             + S    +     GN+ N   +  G+I+GK LA +LG+ IGDK+ I+ P   VTP GM
Sbjct: 157 EKEQSVTHLNKKLLAGNMDN--LKHFGIILGKGLADSLGVMIGDKVTIMIPQATVTPAGM 214

Query: 183 GIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEKT 240
             R K +TV+G+F      ++D  + ++++++AQ    ++ N VSGI++ + +     + 
Sbjct: 215 IPRFKRFTVVGVFSAGTGFNFDTKLAFINIEDAQKLMQMDKNDVSGIKMKINNVYKAPEL 274

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +  +LG G  V +W Q++  FF   +
Sbjct: 275 SYELSDLLGEGYQVGNWTQQFGAFFEAVK 303


>gi|296283772|ref|ZP_06861770.1| ABC-type transport system [Citromicrobium bathyomarinum JL354]
          Length = 413

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 79/263 (30%), Positives = 126/263 (47%), Gaps = 3/263 (1%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE  +A RYL+  +   FI + + IS   VM+ V  L++VMSVMNGFR +++ +++G+NG
Sbjct: 6   FEWTIAKRYLWPGKGEGFIKLVAGISIGVVMLSVAMLVIVMSVMNGFRAELLDKIVGLNG 65

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H ++Q     L D++ +   +     V+   P +  Q  +         VLVRG +  D 
Sbjct: 66  HAIVQAYGGRLDDWKSVLADIRESEGVVSASPLIE-QPLLVTFDGRVEAVLVRGNTQEDI 124

Query: 127 SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRS 186
             LQ+      G+++        V IG  LA N+G  +GD I +++P G  TP G   R 
Sbjct: 125 DALQD--KTLMGSMAEIKPGADKVAIGSRLAENIGARVGDVITVINPAGRSTPFGTVPRQ 182

Query: 187 KSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVR 246
             Y V  +F +   DYD   + M + +AQ      + +  IEV  +D D + +    I +
Sbjct: 183 VGYEVGAIFEVGLYDYDGAFIIMPIPQAQTLLLTGDTIGMIEVTTEDADRVTEIMAPIEQ 242

Query: 247 ILGNGVVVIDWQQRYQIFFSCYE 269
            L    +V  WQQ     F   +
Sbjct: 243 RLQGIAIVRTWQQINSSIFEALQ 265


>gi|167950861|ref|ZP_02537935.1| lipoprotein ABC transporter, permease protein LolE [Endoriftia
           persephone 'Hot96_1+Hot96_2']
          Length = 215

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 74/203 (36%), Positives = 121/203 (59%), Gaps = 4/203 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           ++  FE+ +  RY  + R+N FIS  S IS +G+M+GV+ALIVV+SVMNGF +++ +R+L
Sbjct: 1   MYKPFELFIGLRYTRAKRRNHFISFISLISTLGIMLGVVALIVVLSVMNGFHKEVRERIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQA-FVSGLSSGGSGVLVRGI 121
           G+  H  I      L D++ +  +    P VI   P+V GQ  F++G     SG ++RGI
Sbjct: 61  GMASHATISAVKGGLSDWRDVMAQAGKNPHVIGRAPYVEGQGMFINGQKV--SGAILRGI 118

Query: 122 SNSDFSYLQNSFSRF-YGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
             ++   +         G+V++    G GVI+G++LA  LG+ +GDK+ +++P  +VTP 
Sbjct: 119 DPAEEGKVSVVVEAMKVGSVTDLQPGGYGVILGQELAYLLGVGMGDKVTLVTPQINVTPA 178

Query: 181 GMGIRSKSYTVLGMFRMRFPDYD 203
           G+  R K + V G+F +   DY+
Sbjct: 179 GIMPRLKRFKVTGIFEVGMGDYE 201


>gi|254497932|ref|ZP_05110696.1| lipoprotein ABC transporter [Legionella drancourtii LLAP12]
 gi|254352826|gb|EET11597.1| lipoprotein ABC transporter [Legionella drancourtii LLAP12]
          Length = 414

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 79/273 (28%), Positives = 145/273 (53%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           ++    + +  RY  S +KN F+S  S  S +G+ +GVM LI V+SVMNGF + +  R  
Sbjct: 1   MYKPLALFMGLRYTRSRKKNHFVSFISLSSMLGIGLGVMVLITVLSVMNGFDQQIHNRFF 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+   + +      + D+  +A ++  IP++  + P+V GQ     L   G    +++ G
Sbjct: 61  GMAPEITVSGPGERINDWPEVAKKIQTIPEIKALAPYVGGQGL---LVHEGQVLPIILTG 117

Query: 121 I---SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
           +      + ++L++      GN+ N   +  G+I+GK LA +LG+ IGDK+ ++ P   V
Sbjct: 118 VMPDKEENITHLKDKL--LAGNIDN--LKHFGMILGKGLADSLGVMIGDKVTVMIPQATV 173

Query: 178 TPMGMGIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
           TP GM  R K +TV+G+F      ++D  + ++++++AQ    L N VSGI++ + +   
Sbjct: 174 TPAGMVPRFKRFTVVGVFSAGTGFNFDTKIAFINIEDAQKLLQLGNDVSGIKMKINEVYQ 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +  + +  +LG    V +W Q++  FF   +
Sbjct: 234 APELSDRLSHLLGEQYQVGNWTQQFGSFFEAVK 266


>gi|54295131|ref|YP_127546.1| hypothetical protein lpl2211 [Legionella pneumophila str. Lens]
 gi|53754963|emb|CAH16451.1| hypothetical protein lpl2211 [Legionella pneumophila str. Lens]
          Length = 415

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 79/267 (29%), Positives = 139/267 (52%), Gaps = 4/267 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           ++    + +  RY  S +KN F+S  S  S +G+ +GVM LI V+SVMNGF +++ +R  
Sbjct: 1   MYKPLALFIGLRYTRSRKKNHFVSFISLSSMLGIGMGVMVLITVLSVMNGFDQEIHRRFF 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+   + I      L D+  +  +++ IP +  + P+V  Q  ++        VL   + 
Sbjct: 61  GMAPEITITGPDERLSDWPEVVKKVETIPGIKAIAPYVGSQGLLTHEGQVLPIVLTGILP 120

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
             + S    +     GN+ N   +  G+I+GK LA +LG+ IGDK+ I+ P   VTP GM
Sbjct: 121 EKEESVTHLNKKLLAGNMDN--LKHFGIILGKGLADSLGVMIGDKVTIMIPQATVTPAGM 178

Query: 183 GIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEKT 240
             R K +TV G+F      ++D  + ++++++AQ    ++ N VSGI++ + +     + 
Sbjct: 179 IPRFKRFTVAGVFSAGTGFNFDTKLAFINIEDAQKLMQMDKNDVSGIKMKINNVYKAPEL 238

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSC 267
              +  +LG G  V +W Q++  FF  
Sbjct: 239 SYELSDLLGEGYQVGNWTQQFGAFFEA 265


>gi|89070122|ref|ZP_01157451.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Oceanicola granulosus HTCC2516]
 gi|89044239|gb|EAR50385.1| ABC lipoprotein efflux transporter, inner membrane subunit, LolE
           [Oceanicola granulosus HTCC2516]
          Length = 440

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 85/279 (30%), Positives = 143/279 (51%), Gaps = 29/279 (10%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+ FE  +AWRY+ + R    +S+ ++IS +G+ + V ALI  ++V +GFR++ +  ++G
Sbjct: 8   FAPFEWKIAWRYIRARRAEGGVSVMTWISLVGISLAVFALIATLAVRSGFRQEFVDTIVG 67

Query: 64  INGHVVIQQKYYPLV-------------------DYQFIANRLDFIPDVIKVLPFVSGQA 104
            N H+ ++Q+    V                   DY  +A RL  +  V +    V G+ 
Sbjct: 68  ANAHLAVRQQTQETVTVTQGDQSVDVTRWVDTISDYPDLAARLAALEGVERANSVVRGE- 126

Query: 105 FVSGLSSGGSG---VLVRGISNSDFS--YLQNSFSRFYGNVSNDFDRGKGVIIGKDLARN 159
              GL+S G     V + GIS  + +   L  +  +  G ++ DF    GV +G  +AR 
Sbjct: 127 ---GLASRGEEATFVQIYGISPEELADVPLIRAPEQSSGRLA-DFGGESGVALGSGVARA 182

Query: 160 LGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFN 219
           LG+S+G++I + +  G  T +G   R  S+ V+ +F+      D   VYM L++AQ +FN
Sbjct: 183 LGVSVGERITLTTAAGVQTAVGRSPRRASFDVVYIFQTGRYATDVVRVYMPLEKAQDFFN 242

Query: 220 LENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQ 258
             +AV  IEVFV DPD +E+    +   L  G ++  W+
Sbjct: 243 RGDAVDEIEVFVTDPDNVEQWISPVYAQLEPGSLLYSWK 281


>gi|289163940|ref|YP_003454078.1| outer membrane-specific lipoprotein transporter subunit ; membrane
           component of ABC superfamily [Legionella longbeachae
           NSW150]
 gi|288857113|emb|CBJ10928.1| outer membrane-specific lipoprotein transporter subunit ; membrane
           component of ABC superfamily [Legionella longbeachae
           NSW150]
          Length = 414

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 82/274 (29%), Positives = 144/274 (52%), Gaps = 15/274 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           ++    + +  RY  + +KN F+S  S  S +G+ +GVM LI V+SVMNGF + + KR  
Sbjct: 1   MYKPLALFMGLRYTRARKKNHFVSFISLSSMLGIGLGVMVLITVLSVMNGFDQQIHKRFF 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSG----LSSGGSGVLV 118
           G+   + +      L ++  IA +++ IP++    PFV GQ  +      L    +GVL 
Sbjct: 61  GMAPEITVSGPNERLNNWPEIAKKIETIPEIKAFSPFVGGQGLLVHDGQVLPIVLTGVLP 120

Query: 119 RGISNSDFSYLQNSFSRFYGNVSN--DFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           +       S+LQ+      G+++N  DF    G+I+G+ LA ++G  IGDK+ ++ P   
Sbjct: 121 Q--EEEKMSHLQDKL--LAGDINNLKDF----GIILGRGLADSMGTMIGDKVTVMIPQAT 172

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPD 235
           VTP GM  R K +TV+G+F      ++D  + +++L +AQ    + N V+GI++ + +  
Sbjct: 173 VTPAGMIPRFKRFTVVGVFSAGTGFNFDTKLAFINLGDAQKLLQMGNDVTGIKMKIDNVY 232

Query: 236 AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +    +  +LG    V +W ++Y  FF   +
Sbjct: 233 QAPELSSRLSHLLGEEYQVGNWTEQYGSFFQAVK 266


>gi|270157792|ref|ZP_06186449.1| lipoprotein-releasing system transmembrane protein LolC/E
           [Legionella longbeachae D-4968]
 gi|269989817|gb|EEZ96071.1| lipoprotein-releasing system transmembrane protein LolC/E
           [Legionella longbeachae D-4968]
          Length = 423

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 82/274 (29%), Positives = 144/274 (52%), Gaps = 15/274 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           ++    + +  RY  + +KN F+S  S  S +G+ +GVM LI V+SVMNGF + + KR  
Sbjct: 10  MYKPLALFMGLRYTRARKKNHFVSFISLSSMLGIGLGVMVLITVLSVMNGFDQQIHKRFF 69

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSG----LSSGGSGVLV 118
           G+   + +      L ++  IA +++ IP++    PFV GQ  +      L    +GVL 
Sbjct: 70  GMAPEITVSGPNERLNNWPEIAKKIETIPEIKAFSPFVGGQGLLVHDGQVLPIVLTGVLP 129

Query: 119 RGISNSDFSYLQNSFSRFYGNVSN--DFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           +       S+LQ+      G+++N  DF    G+I+G+ LA ++G  IGDK+ ++ P   
Sbjct: 130 Q--EEEKMSHLQDKL--LAGDINNLKDF----GIILGRGLADSMGTMIGDKVTVMIPQAT 181

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPD 235
           VTP GM  R K +TV+G+F      ++D  + +++L +AQ    + N V+GI++ + +  
Sbjct: 182 VTPAGMIPRFKRFTVVGVFSAGTGFNFDTKLAFINLGDAQKLLQMGNDVTGIKMKIDNVY 241

Query: 236 AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +    +  +LG    V +W ++Y  FF   +
Sbjct: 242 QAPELSSRLSHLLGEEYQVGNWTEQYGSFFQAVK 275


>gi|99034569|ref|ZP_01314537.1| hypothetical protein Wendoof_01000651 [Wolbachia endosymbiont of
           Drosophila willistoni TSC#14030-0811.24]
          Length = 385

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 83/246 (33%), Positives = 134/246 (54%), Gaps = 13/246 (5%)

Query: 29  SFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLD 88
           +  S IG+ +GV  LIVVMSVMNGFR  ++  +LGI+GH+ +        DY  ++  ++
Sbjct: 2   TLFSIIGIALGVATLIVVMSVMNGFRAKLLDSILGIDGHINVYFDRNINSDYYAVSKSIE 61

Query: 89  FIPDVIKVLPFVSGQAFVSGLSSGG-SGVLVRGISNSDF---SYLQNSFSRFYGNVSNDF 144
            IP ++K  P  + Q  +  +++G  +G +VRG+S  D    + + N+     G+V   F
Sbjct: 62  RIPGILKATPMTNDQVII--VANGKIAGSVVRGVSTKDLLDSTAVTNNV--IIGDVKK-F 116

Query: 145 DRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDN 204
           D  +G+IIG  LA  L I  GD+I  +S       +G   R K Y V+ +F M   +YDN
Sbjct: 117 D--EGIIIGARLAEVLNIDYGDEITFISSEEFDALLGEMPRMKKYKVIAIFDMGMFEYDN 174

Query: 205 GMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIF 264
            ++YM L+ AQ +FN +N++  IEV V D    +K  + I + +  G+    WQ +   +
Sbjct: 175 TLIYMPLKSAQAFFNYKNSIKNIEVLVDDVTRADKLADAIEKEI--GMEAESWQSQQSHY 232

Query: 265 FSCYES 270
           FS  ++
Sbjct: 233 FSALKT 238


>gi|85708822|ref|ZP_01039888.1| ABC-type transport system [Erythrobacter sp. NAP1]
 gi|85690356|gb|EAQ30359.1| ABC-type transport system [Erythrobacter sp. NAP1]
          Length = 412

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 129/267 (48%), Gaps = 3/267 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           + + FE ++A RYL+  +   FI++ + IS   VM+ V  L++VMSVM GFR +M+++  
Sbjct: 1   MLTPFERMIAKRYLWPGKGEGFIALVAGISVGVVMLSVAMLVLVMSVMGGFRTEMLEKFS 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+NGH +IQ     L  ++ +   +     V    P +  Q  V+ ++   + V VRG +
Sbjct: 61  GLNGHAIIQAYGGELDGWERVVEEVRATEGVTDASPLIE-QPLVASVNGRLNPVFVRGNT 119

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
             D + + +     +G++S+       V IG  LA N+G  +GD + +++P G  TP G 
Sbjct: 120 PEDLALISDKV--LFGDISSLQPDAGRVAIGSRLAANMGARVGDTVTLINPSGRTTPFGT 177

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R   Y V  +      D+D   V M + +AQ    + + +  I V V DPD +     
Sbjct: 178 TFRQVPYEVGAIVEFGLYDFDEKFVVMPMSDAQTLLLMGDTIGLIRVNVTDPDNVSGILG 237

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + + L     + DW+Q     F   E
Sbjct: 238 AVEQDLTGRAQIADWKQINSTLFEALE 264


>gi|269958415|ref|YP_003328202.1| lipoprotein releasing system, transmembrane protein [Anaplasma
           centrale str. Israel]
 gi|269848244|gb|ACZ48888.1| lipoprotein releasing system, transmembrane protein [Anaplasma
           centrale str. Israel]
          Length = 403

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 86/267 (32%), Positives = 136/267 (50%), Gaps = 18/267 (6%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E ++A RYL SN      S A+ +S +G+ IGV  LI V SVMNGF   ++  +LG+NG
Sbjct: 3   LEWLLARRYLQSNGGRFLFSTATALSILGICIGVATLISVTSVMNGFSAKLLSSILGMNG 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           HV +        DY  +   +  +P V+   P V GQA    L  G +  G +VRG+   
Sbjct: 63  HVTVHCN---CPDYPDVIAGISIMPGVVSATPVVEGQAM---LKYGRNIMGAVVRGMRMR 116

Query: 125 DFSYLQNSFSRFYGN-VSNDFDR-GKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           D  +      +  G+ V  D D   +G+++G  LA ++G   GD+I ++SP    T  G 
Sbjct: 117 DVRH------KLRGHIVVGDVDMLEEGIVLGFRLAESIGADYGDEITVISPETSSTIFGA 170

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R+++Y V G+F +   +YD+   Y+ L+++QL F   + V  +EVF++D     +   
Sbjct: 171 APRTQTYRVTGIFDVGVYEYDSAFAYIPLRDSQLLFGYMDRVRYVEVFLRDVTQSSEALA 230

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            I R    G+ V DW+ +   +F   E
Sbjct: 231 AIAR--RTGLRVEDWKVQQGQYFRALE 255


>gi|164430472|gb|ABY55553.1| lipoprotein releasing system transmembrane protein [Bartonella
           volans]
          Length = 167

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 96/160 (60%)

Query: 12  AWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQ 71
           A+RY+  N+K+   S+ S IS IG+M+GV +L+VVM+VMNGFR +++ R+LG+NGH+++Q
Sbjct: 5   AFRYMIPNKKHVVASVISIISLIGIMLGVFSLVVVMAVMNGFRTELLNRILGMNGHLIVQ 64

Query: 72  QKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQN 131
                  +Y  + + L+ I  +   LP V GQA V G   GGSG LVRG+   D   L+ 
Sbjct: 65  TVDSGFSNYNALISSLESIEGLKFALPVVEGQALVQGEFQGGSGALVRGMRKQDLEKLKA 124

Query: 132 SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINIL 171
                       FD+ +G+ IG  LA  LG+++G  + I+
Sbjct: 125 VSQNIKLGSLAQFDKEEGIAIGSGLAEKLGLTVGSDLRII 164


>gi|95929406|ref|ZP_01312149.1| protein of unknown function DUF214 [Desulfuromonas acetoxidans DSM
           684]
 gi|95134522|gb|EAT16178.1| protein of unknown function DUF214 [Desulfuromonas acetoxidans DSM
           684]
          Length = 417

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 83/269 (30%), Positives = 142/269 (52%), Gaps = 8/269 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E  ++ RYL + RK  FIS+ SFIS  GV +GV ALI+V+++M GF + + +++LG   
Sbjct: 3   YEWFISLRYLRARRKQTFISVISFISVTGVTLGVAALILVLAIMTGFHDGVRQQILGNVP 62

Query: 67  HVVIQQKYYPLVDY-QFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG-SGVLVRGISNS 124
           HV +Q +   + D+ Q +A        V+   P+V  +A +  L+ G  +   ++G+S+ 
Sbjct: 63  HVTVQSQGGTVSDWPQLVATIQSTSSSVVSAEPYVVKEAML--LAHGNVAAANLKGVSSD 120

Query: 125 DFSYLQNSFSRFYGNVS----NDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           +    Q  F+     ++    N      G++I  D A  LG+S+GD+IN++ P   +TP 
Sbjct: 121 NRVLSQEFFTEDNQPINSVLFNATRTQPGIVIAADTAALLGVSLGDRINVIPPDFTLTPF 180

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G+  + K + V+G+ R R    D    Y+SL++AQ +    + VSGIEV V   D  +  
Sbjct: 181 GLIPKIKPFDVVGIARTRGGFLDTYYAYISLEQAQHFIGEVDKVSGIEVEVARFDDAQPL 240

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            E +   LG    +  WQ+ +  F +  +
Sbjct: 241 AEALRADLGYPYSIRSWQEMFGSFLAALK 269


>gi|59801184|ref|YP_207896.1| LolC [Neisseria gonorrhoeae FA 1090]
 gi|293399051|ref|ZP_06643216.1| lipoprotein-releasing system permease [Neisseria gonorrhoeae F62]
 gi|59718079|gb|AAW89484.1| putative lipoprotein releasing system transmembrane protein
           [Neisseria gonorrhoeae FA 1090]
 gi|291610465|gb|EFF39575.1| lipoprotein-releasing system permease [Neisseria gonorrhoeae F62]
          Length = 415

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/271 (29%), Positives = 142/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFAENRKGILAAAPYVSNQAL---LANAGEIRGVQIRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +GDK+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGIGLAEALGAEVGDKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGIVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDTVWVRDWTYSNRSYFEAVE 267


>gi|225023633|ref|ZP_03712825.1| hypothetical protein EIKCOROL_00493 [Eikenella corrodens ATCC
           23834]
 gi|224943515|gb|EEG24724.1| hypothetical protein EIKCOROL_00493 [Eikenella corrodens ATCC
           23834]
          Length = 416

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/268 (29%), Positives = 136/268 (50%), Gaps = 8/268 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RY+ + ++N  +S+ S IS +G+  GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LETWIGLRYMRAKKRNGLMSVISIISILGIATGVTALIVVLSVMNGFQKEIRGQLLQVTP 63

Query: 67  HVVIQQKYY---PLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           H  +Q  Y    P   +Q +A      P V+ V P+VSGQA ++  S    GV V+GI  
Sbjct: 64  H--MQMSYLQADPGDTWQGLAKIAQANPRVLGVAPYVSGQALLAN-SGEVQGVQVKGIDP 120

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           ++   +     +    +      G+  +I+GKD+A  LG+  G+K+ ++SP G+VTP+GM
Sbjct: 121 AEEPKVSEYGEKLPNELYQQLKPGQFEMILGKDIADRLGVQPGEKVTLISPEGNVTPVGM 180

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE 242
             R K +TV           DN +  + +++A+  +   +    I++ +  P+       
Sbjct: 181 VPRMKQFTVASTVSTGIFAVDNSLSIIHIEDAKTLYRAGDGDVSIQLRLSQPETAPDVTA 240

Query: 243 NIVRILG-NGVVVIDWQQRYQIFFSCYE 269
            IV     N +   DW  + + +F   E
Sbjct: 241 TIVPAEQRNRIAAFDWTYQNRDYFQAVE 268


>gi|303257510|ref|ZP_07343522.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderiales bacterium 1_1_47]
 gi|302859480|gb|EFL82559.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderiales bacterium 1_1_47]
          Length = 424

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/270 (28%), Positives = 140/270 (51%), Gaps = 11/270 (4%)

Query: 7   FEVIVAWRYLFSNRK---NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FE ++  RY  S RK   + F+S  S +S   + +GVMALI+V+SVMNGF++++  ++L 
Sbjct: 11  FEWMIGLRYTLSRRKGRSDGFVSFISAMSMASIALGVMALIIVLSVMNGFQKEVRDKMLS 70

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFI-PDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           +  H  +     P+ D+Q  A  L    P++I   PF+ GQ     L+SG +  GV + G
Sbjct: 71  VLSHAEVLSIGAPIPDWQKTAAELKKQQPEIIGAAPFLRGQGL---LTSGTNVRGVQLNG 127

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           I     S + +          +D   G+  +I+G DLAR LG+  G+K+N++ P G  TP
Sbjct: 128 IDPETESQVSDVAKNMKIGRLSDLKPGEFKIILGTDLARMLGVIPGEKVNVMVPQGQFTP 187

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G   R + +TV G+F     ++D+ M +++L +A+     +    GI + + +     +
Sbjct: 188 AGTMPRMRQFTVAGVFNSGHYEFDSAMSFINLTDAEKLMRTQTP-GGIRLKLSNMQDAPR 246

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +   +  G++  DW ++ + +F+  +
Sbjct: 247 VAAELNNQMPPGLLATDWSRQNRTWFAAVQ 276


>gi|251770986|gb|EES51570.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Leptospirillum ferrodiazotrophum]
          Length = 415

 Score =  123 bits (309), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 86/274 (31%), Positives = 143/274 (52%), Gaps = 16/274 (5%)

Query: 7   FEVIVAWRYLFSNRKNAF-ISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           FE+ VA RYL S+R +   +S+ + IS  GV +GV AL+  + VM GF+  +  ++LG+N
Sbjct: 5   FELRVALRYLRSSRSDKRRLSLNTVISVAGVTVGVAALMATLGVMTGFQHKLRSKILGVN 64

Query: 66  GHVVIQQ-KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
            H+V+   +   + D   I   +  IP V  + PF+ GQA +S      SG ++RG+  +
Sbjct: 65  SHIVLTDGRGSAIPDPAQIEKVVASIPGVTALSPFIVGQAMISA-DKTVSGTVIRGVDPA 123

Query: 125 DFSYLQNSFSRFY--GNVSNDFDRGK--------GVIIGKDLARNLGISIGDKINILSPY 174
             S L     R+   G++S D  R +        GVI+G DLA  LG+ +GDK++++SP 
Sbjct: 124 HES-LVTRIDRYMVEGHLS-DLSRDRTPKPEDLPGVILGSDLADRLGVDVGDKVDLISPT 181

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKD 233
           G  +  GM  + + + V G+F+    +YDN +  + + +A  +  L + +V+G+E+ V D
Sbjct: 182 GTPSAFGMIPKIRHFQVAGIFKSGLYEYDNTLALLEIGQAARFLGLPQGSVTGLEIRVHD 241

Query: 234 PDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
             A       I + LG       W +  +  FS 
Sbjct: 242 IFAATDMAHRIGKKLGFPYWARSWLEMNKNLFSA 275


>gi|325204219|gb|ADY99672.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis M01-240355]
          Length = 415

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 143/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFTENRKGILAAAPYVSNQAL---LANAGEIRGVQMRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G+K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGAEVGNKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T + I     + V V DW    + +F   E
Sbjct: 237 LTAKLIPEAQRDAVWVRDWTYNNRSYFEAVE 267


>gi|296840854|ref|ZP_06863602.2| lipoprotein releasing system transmembrane protein LolC [Neisseria
           polysaccharea ATCC 43768]
 gi|296839803|gb|EFH23741.1| lipoprotein releasing system transmembrane protein LolC [Neisseria
           polysaccharea ATCC 43768]
          Length = 644

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/271 (29%), Positives = 142/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++ V P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTGTDWRNLLRFTENHKGILAVAPYVSNQAL---LANAGEIRGVQMRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGAEVGSKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDAVWVRDWTFSNRSYFEAVE 267


>gi|319942336|ref|ZP_08016651.1| LolC/E family Lipoprotein releasing system [Sutterella
           wadsworthensis 3_1_45B]
 gi|319804209|gb|EFW01109.1| LolC/E family Lipoprotein releasing system [Sutterella
           wadsworthensis 3_1_45B]
          Length = 435

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 82/255 (32%), Positives = 134/255 (52%), Gaps = 13/255 (5%)

Query: 21  KNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDY 80
           K+ F+S  S +S   + +GV ALI+V+SVMNGF++++  R+L +  HV I+     L D 
Sbjct: 40  KDGFMSFISGMSVASIALGVAALIIVLSVMNGFQKEVRDRMLSVIPHVEIRASKGALTDV 99

Query: 81  QFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS---GVLVRGISNSD---FSYLQNSFS 134
           + +   L    DV+ V PFV GQ    GL S G+   G +V+GI  +     S L  S S
Sbjct: 100 EGVEKVLQAQSDVVAVAPFVEGQ----GLFSSGAVVRGAVVKGIDPAKEPGVSELAQSVS 155

Query: 135 RFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGM 194
                +S+   +   VI+G+ LAR L + IGDK+ +L P G++TP G+  R K  TV G 
Sbjct: 156 G--AELSDLKPKAFQVILGQALARQLRVHIGDKVALLVPEGNMTPAGLIPRMKQLTVAGY 213

Query: 195 FRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVV 254
           F     +YD+    +++++A   +       G+ V   D D   +    +V +L +G+  
Sbjct: 214 FSSGHYEYDSTYALVNIEDAAALYR-TGGPQGLRVKTTDMDRAPQIAAKLVSVLPSGLYA 272

Query: 255 IDWQQRYQIFFSCYE 269
            DW ++ + +F+  +
Sbjct: 273 TDWSRQNRTWFAAVQ 287


>gi|254670085|emb|CBA04983.1| lipoprotein releasing system transmembrane protein [Neisseria
           meningitidis alpha153]
          Length = 415

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 142/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFTENRKGILAAAPYVSNQAL---LANAGEIRGVQMRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G+K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGAEVGNKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDAVWVRDWTYNNRSYFEAVE 267


>gi|325132581|gb|EGC55274.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis M6190]
 gi|325138354|gb|EGC60923.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis ES14902]
 gi|325142494|gb|EGC64898.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis 961-5945]
 gi|325198368|gb|ADY93824.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis G2136]
          Length = 415

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 142/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFTENRKGILAAAPYVSNQAL---LANAGEIRGVQMRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G+K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGAEVGNKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDAVWVRDWTYNNRSYFEAVE 267


>gi|15677107|ref|NP_274259.1| hypothetical protein NMB1235 [Neisseria meningitidis MC58]
 gi|9977671|sp|P57062|LOLC_NEIMB RecName: Full=Lipoprotein-releasing system transmembrane protein
           lolC
 gi|7226474|gb|AAF41616.1| conserved hypothetical protein [Neisseria meningitidis MC58]
 gi|316985093|gb|EFV64046.1| liporeleasing system, transmembrane , LolC/E family protein
           [Neisseria meningitidis H44/76]
 gi|325140535|gb|EGC63056.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis CU385]
 gi|325200134|gb|ADY95589.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis H44/76]
          Length = 415

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 142/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFTENRKGILAAAPYVSNQAL---LANAGEIRGVQMRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G+K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGAEVGNKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDAVWVRDWTYSNRSYFEAVE 267


>gi|218768237|ref|YP_002342749.1| putative integral membrane protein [Neisseria meningitidis Z2491]
 gi|9977668|sp|P57061|LOLC_NEIMA RecName: Full=Lipoprotein-releasing system transmembrane protein
           lolC
 gi|121052245|emb|CAM08570.1| putative integral membrane protein [Neisseria meningitidis Z2491]
 gi|319410484|emb|CBY90845.1| lipoprotein-releasing system transmembrane protein LolC [Neisseria
           meningitidis WUE 2594]
          Length = 415

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 143/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFTENRKGILAAAPYVSNQAL---LANAGEIRGVQIRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G+K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGAEVGNKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T + I     + V V DW    + +F   E
Sbjct: 237 LTAKLIPEAQRDTVWVRDWTFSNRSYFEAVE 267


>gi|303328116|ref|ZP_07358555.1| lipoprotein releasing system, permease protein [Desulfovibrio sp.
           3_1_syn3]
 gi|302861942|gb|EFL84877.1| lipoprotein releasing system, permease protein [Desulfovibrio sp.
           3_1_syn3]
          Length = 411

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 86/269 (31%), Positives = 140/269 (52%), Gaps = 9/269 (3%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ VA RYLFS RK  FI I S +S +GV IGV AL+VV+ V NG   DM  ++LG N 
Sbjct: 6   FELFVALRYLFSRRKQTFIYIISLMSILGVAIGVGALVVVLGVYNGLTTDMRDKILGANA 65

Query: 67  HVVIQQKYYPLVDY-QFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGISN 123
           H ++        ++ Q +  R+  +  V    PF+  +     LS+GG   GV++RGI  
Sbjct: 66  HAIVMSYVPSAFEHDQDLTQRIRSVDGVTGATPFIYTEVM---LSAGGGVKGVVLRGIDP 122

Query: 124 SDFSYLQNSFSRFYGNVSNDFDR--GKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
           +    + +   +       D  +    G+IIG++LAR LG++ G ++N+LSP G  T  G
Sbjct: 123 ASAPEVLSLLHQMRSGSPEDLQKEGTPGIIIGEELARRLGLAAGSRVNLLSPSGQKTASG 182

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENA-VSGIEVFVKDPDAIEKT 240
              R + + V+G+F+    +YD+ + +++L  A+    L    +SGIE+ V+D    ++ 
Sbjct: 183 YSPRIRPFEVVGIFKTGMFEYDSSLAFVTLNAARDVLGLPPGFLSGIEITVRDVFKADQV 242

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +   LG+   V  W +     F+  +
Sbjct: 243 AARLSTELGSPFYVRTWMEMNANLFAALK 271


>gi|327399437|ref|YP_004340306.1| hypothetical protein Hipma_1289 [Hippea maritima DSM 10411]
 gi|327182066|gb|AEA34247.1| protein of unknown function DUF214 [Hippea maritima DSM 10411]
          Length = 396

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 83/268 (30%), Positives = 145/268 (54%), Gaps = 18/268 (6%)

Query: 7   FEVIVAWRYLFSNR-KNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           FE  +A+RY+ S++ K  FIS ++ +S +G+++GV ALI+VM VMNGF  ++ ++++ +N
Sbjct: 3   FESFLAFRYIKSSKNKEKFISFSALMSILGIIVGVAALIIVMGVMNGFDNELQRKIVDVN 62

Query: 66  GHVVIQQKYYPLVDY-QFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
            HV+++     L DY Q I NR++    V  V P +  Q  +S  ++  +GV++ GI   
Sbjct: 63  PHVLVKN-VSGLFDYNQTIINRINSQKGVKTVSPLLVTQGMISS-NNISTGVVINGI--- 117

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGK---GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
           D S  QN        +     +GK   GV++G +L++ LG+ +G  + I+ P+G  TP G
Sbjct: 118 DISKEQN--------IKRYITKGKLKGGVVLGFELSKILGVGVGGNVRIILPFGKTTPFG 169

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
               S    V+G+F+    DYD+  VY+ L+E     +L+  ++ I V + DP    K  
Sbjct: 170 FAPLSFKEKVVGIFKSGMYDYDSSFVYIPLKELWAKTSLKGKINTIAVELNDPFKANKFT 229

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           E++  ++        W +    FF+  +
Sbjct: 230 EHLAGVMPFSFYASSWIKLNSNFFTALK 257


>gi|309378622|emb|CBX22800.1| unnamed protein product [Neisseria lactamica Y92-1009]
          Length = 415

 Score =  121 bits (304), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 142/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++   +L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGELLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTGTDWRNLLRFTENRKGILAAAPYVSNQAL---LANAGEIRGVQMRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG+ +G+K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGVEVGNKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDTVWVRDWTFSNRSYFEAVE 267


>gi|325128359|gb|EGC51243.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis N1568]
 gi|325134518|gb|EGC57163.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis M13399]
 gi|325144621|gb|EGC66920.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis M01-240013]
 gi|325205989|gb|ADZ01442.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis M04-240196]
          Length = 415

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 143/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFTENRKGILAAAPYVSNQAL---LANAGEIRGVQMRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G+K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGAEVGNKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T + I     + V V DW    + +F   E
Sbjct: 237 LTAKLIPEAQRDTVWVRDWTFSNRSYFEAVE 267


>gi|308389328|gb|ADO31648.1| putative integral membrane protein [Neisseria meningitidis
           alpha710]
 gi|325136279|gb|EGC58887.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis M0579]
 gi|325202071|gb|ADY97525.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis M01-240149]
 gi|325208175|gb|ADZ03627.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria meningitidis NZ-05/33]
          Length = 415

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 143/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFTENRKGILAAAPYVSNQAL---LANAGEIRGVQMRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G+K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGAEVGNKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T + I     + V V DW    + +F   E
Sbjct: 237 LTAKLIPEAQRDTVWVRDWTFSNRSYFEAVE 267


>gi|254805014|ref|YP_003083235.1| putative lipoprotein releasing system trasmembrane protein
           [Neisseria meningitidis alpha14]
 gi|254668556|emb|CBA06021.1| putative lipoprotein releasing system trasmembrane protein
           [Neisseria meningitidis alpha14]
          Length = 415

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 142/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFTENRKGILAAAPYVSNQAL---LANAGEIRGVQMRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G+K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGAEVGNKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDAVWVRDWTFSNRSYFEAVE 267


>gi|268596791|ref|ZP_06130958.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae FA19]
 gi|268603728|ref|ZP_06137895.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae PID1]
 gi|268682199|ref|ZP_06149061.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae PID332]
 gi|268550579|gb|EEZ45598.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae FA19]
 gi|268587859|gb|EEZ52535.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae PID1]
 gi|268622483|gb|EEZ54883.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae PID332]
          Length = 415

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 141/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFAENRKGILAAAPYVSNQAL---LANAGEIRGVQIRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGAEVGGKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGIVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDTVWVRDWTYSNRSYFEAVE 267


>gi|194098671|ref|YP_002001733.1| LolC [Neisseria gonorrhoeae NCCP11945]
 gi|260440468|ref|ZP_05794284.1| LolC [Neisseria gonorrhoeae DGI2]
 gi|268594828|ref|ZP_06128995.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae 35/02]
 gi|268599046|ref|ZP_06133213.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae MS11]
 gi|268684350|ref|ZP_06151212.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae SK-92-679]
 gi|268686671|ref|ZP_06153533.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae SK-93-1035]
 gi|291043769|ref|ZP_06569485.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae DGI2]
 gi|193933961|gb|ACF29785.1| LolC [Neisseria gonorrhoeae NCCP11945]
 gi|268548217|gb|EEZ43635.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae 35/02]
 gi|268583177|gb|EEZ47853.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae MS11]
 gi|268624634|gb|EEZ57034.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae SK-92-679]
 gi|268626955|gb|EEZ59355.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae SK-93-1035]
 gi|291012232|gb|EFE04221.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae DGI2]
 gi|317164273|gb|ADV07814.1| LolC [Neisseria gonorrhoeae TCDC-NG08107]
          Length = 415

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 141/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFAENRKGILAAAPYVSNQAL---LANAGEIRGVQIRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGAEVGGKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDTVWVRDWTYSNRSYFEAVE 267


>gi|254493772|ref|ZP_05106943.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae 1291]
 gi|268601399|ref|ZP_06135566.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae PID18]
 gi|226512812|gb|EEH62157.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae 1291]
 gi|268585530|gb|EEZ50206.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           gonorrhoeae PID18]
          Length = 415

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 141/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFAENRKGILAAAPYVSNQAL---LANAGEIRGVQIRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGIGLAEALGAEVGGKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGIVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDTVWVRDWTYSNRSYFEAVE 267


>gi|307544566|ref|YP_003897045.1| ABC lipoprotein-releasing system transmembrane protein [Halomonas
           elongata DSM 2581]
 gi|307216590|emb|CBV41860.1| ABC-type lipoprotein-releasing system transmembrane protein
           [Halomonas elongata DSM 2581]
          Length = 413

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 133/260 (51%), Gaps = 12/260 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +  R  +++  RY+ + R+N FIS  S  S +G+ +GV  LI+V+SVMNGF  ++  R+L
Sbjct: 1   MLDRLPLLIGLRYVRAKRRNHFISFISLTSMLGLTLGVAVLILVLSVMNGFDRELRTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRG 120
           G+  H  I +K   + D+Q +A RL     VI   P++  Q      S GG   G +V G
Sbjct: 61  GMVPHTQI-EKPSGMTDWQSLAERLTQREHVIGAAPYIEQQGM---FSVGGRNHGAMVNG 116

Query: 121 IS---NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
           I        S +    SR  G++ +       V++G  LAR LG+ +GD + +L P   +
Sbjct: 117 IEPDWERRVSIIDEHMSR--GSLDDLVPGEWNVVLGSILARQLGVGVGDSVTLLVPEASI 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           TP G+  R K +TV G+F +   D D  + Y ++++ Q    + + V G+ + + D    
Sbjct: 175 TPAGVFPRLKRFTVSGIFSVG-ADLDANLAYANIEDMQTLARMGDDVGGLRLELDDLFKA 233

Query: 238 EKTHENIVRILGNGVVVIDW 257
               ++I+  LG G   +DW
Sbjct: 234 GSVTQSIIDDLGAGYRGLDW 253


>gi|304387503|ref|ZP_07369692.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Neisseria meningitidis ATCC 13091]
 gi|261392503|emb|CAX50054.1| lipoprotein-releasing system transmembrane protein LolC [Neisseria
           meningitidis 8013]
 gi|304338390|gb|EFM04511.1| ABC superfamily ATP binding cassette transporter, ABC protein
           [Neisseria meningitidis ATCC 13091]
          Length = 415

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 142/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFTENRKGILAAAPYVSNQAL---LANAGEIRGVQMRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G+K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGAEVGNKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDTVWVRDWTFSNRSYFEAVE 267


>gi|121634928|ref|YP_975173.1| putative integral membrane protein [Neisseria meningitidis FAM18]
 gi|120866634|emb|CAM10385.1| putative integral membrane protein [Neisseria meningitidis FAM18]
          Length = 415

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 142/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLLRFTENRKGILAAAPYVSNQAL---LANAGEIRGVQMRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG  +G+K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGAEVGNKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K +TV+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFTVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDTVWVRDWTFSNRSYFEAVE 267


>gi|73666711|ref|YP_302727.1| hypothetical protein Ecaj_0078 [Ehrlichia canis str. Jake]
 gi|72393852|gb|AAZ68129.1| protein of unknown function DUF214 [Ehrlichia canis str. Jake]
          Length = 410

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 143/270 (52%), Gaps = 17/270 (6%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           +FE+++A RYL S+      S+ + +S +G+ +GV  LI+VMSVMNGF E ++  V+G+N
Sbjct: 4   KFELMLALRYLQSSSSQFLCSMITILSLVGITLGVATLIIVMSVMNGFGEKLLDCVVGLN 63

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
           GH+ I        DY  I   +  IP V   +P    QA +   SS  SGV+VRGI   D
Sbjct: 64  GHIAIYCDGNFDYDYHEITKSIKEIPGVKYAVPITENQAMIK-SSSSVSGVIVRGIEKQD 122

Query: 126 F---SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
               + + N+  R  G+++   D   G+ IG  LA  L +  GDK+ I+S     T +G 
Sbjct: 123 IERNNIIVNNIVR--GDIAEFND---GIAIGIKLAEVLRVDYGDKLTIISSESLSTVIGN 177

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD---PDAIEK 239
             R K+Y V+ +F +   ++D+ +VYM L  +QL+F+ +N V  IEV + D      + K
Sbjct: 178 IPRMKTYKVVAIFDVGMYEFDSSLVYMPLHASQLFFHYDNRVKNIEVSIFDGNKSSEMLK 237

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             EN + + G      DW+ +   +F   E
Sbjct: 238 LIENKIDMKGE-----DWKMQQGSYFHALE 262


>gi|261401207|ref|ZP_05987332.1| lipoprotein releasing system transmembrane protein LolC [Neisseria
           lactamica ATCC 23970]
 gi|269208785|gb|EEZ75240.1| lipoprotein releasing system transmembrane protein LolC [Neisseria
           lactamica ATCC 23970]
          Length = 415

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 142/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTGTDWRNLLRFTENRKGILAAAPYVSNQAL---LANAGEIRGVQMRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG+ +G+K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGVEVGNKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K + V+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFNVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDTVWVRDWTYSNRSYFEAVE 267


>gi|317486634|ref|ZP_07945451.1| LolC/E family lipoprotein releasing system [Bilophila wadsworthia
           3_1_6]
 gi|316922017|gb|EFV43286.1| LolC/E family lipoprotein releasing system [Bilophila wadsworthia
           3_1_6]
          Length = 430

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 94/290 (32%), Positives = 144/290 (49%), Gaps = 27/290 (9%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RFE+ VA RYLF+ RK AFI I S +S +GV IGV AL+VV+ V NGF  D+  ++LG N
Sbjct: 2   RFELFVALRYLFARRKQAFIYIISAMSVLGVAIGVAALVVVLGVYNGFTTDIRDKILGAN 61

Query: 66  GHVVIQQKY----YPLVDYQF----------------IANRLDFIPDVIKVLPFVSGQAF 105
            H+++         P  D  F                +  R++  P V+   PF+  +  
Sbjct: 62  AHIIVSGPLAALTAPPSDADFEKMRGGEAPELSGMAAVLRRINATPGVVGSTPFLYAEGM 121

Query: 106 VSGLSSGGSGVLVRGISNSD----FSYLQNSFSRFYGNVSNDFDRG-KGVIIGKDLARNL 160
           +S    G  GV++RGI         + L N  S    +++   +    GV+IGK+LA+ L
Sbjct: 122 LSS-PRGVKGVVLRGIDPKTAPDVLTMLDNLSSGSVADLNASVEGAPPGVLIGKELAQRL 180

Query: 161 GISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL 220
           G+ +G ++N+LSP G  T  G   R + Y V G+F+    +YD+ + ++SL  A+    L
Sbjct: 181 GLVVGSRVNLLSPSGQKTTAGFQPRIRPYKVAGIFQTGMFEYDSSLGFISLAAARDLLGL 240

Query: 221 -ENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             + +SGIEV VKD    +     + + LG    V  W       F+  +
Sbjct: 241 PSDQISGIEVTVKDVYKADTVAAALQKELGPLASVRTWMDMNANLFAALK 290


>gi|171463256|ref|YP_001797369.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Polynucleobacter necessarius subsp. necessarius STIR1]
 gi|171192794|gb|ACB43755.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Polynucleobacter necessarius subsp. necessarius STIR1]
          Length = 420

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 83/271 (30%), Positives = 139/271 (51%), Gaps = 10/271 (3%)

Query: 7   FEVIVAWRYLFSNRK------NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKR 60
            E+ +  RY  S R+      + F+S  S IS  G+ +GV +LIVV+SVMNGF++++  R
Sbjct: 6   IELEIGLRYTRSKRRKTVGKRDGFLSFISGISTAGIALGVASLIVVISVMNGFQKEVRDR 65

Query: 61  VLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           +L +  HV I      L +++ +A ++   P V+ V P VS Q  +S   S   GV +RG
Sbjct: 66  MLSVLSHVEITAPDG-LANWEPLALKVAAQPHVVGVAPMVSSQGLLSR-ESMMRGVAIRG 123

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           I  S+ S + +   +F     +D   G  GV +G  LA  +G  +GD+IN++ P  D+TP
Sbjct: 124 ILPSEESKVSDLPKQFVAGSIDDLKPGSFGVALGAQLAAIVGAHLGDRINLIVPESDLTP 183

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G   R +   V+G+      +YD+ +  M  ++A     L +  SG+ V V D     +
Sbjct: 184 AGAMPRMRILQVVGIVDSGHYEYDSSLAIMHWKDAAALLRLHDP-SGLRVKVDDMQRAPQ 242

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYES 270
               +  I+   + VIDW +  + +F+  ++
Sbjct: 243 VANELAAIVPQALWVIDWSKSNRNWFAAVQT 273


>gi|261378751|ref|ZP_05983324.1| lipoprotein releasing system transmembrane protein LolC [Neisseria
           cinerea ATCC 14685]
 gi|269144906|gb|EEZ71324.1| lipoprotein releasing system transmembrane protein LolC [Neisseria
           cinerea ATCC 14685]
          Length = 415

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/267 (28%), Positives = 140/267 (52%), Gaps = 7/267 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTDTDWRNLRKFTENQKGILATAPYVSDQAL---LANAGEVRGVQIRGILPS 120

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           +   +     +       D   G+  +I+G  LA  LG+ +G+K+ +++P G+VTP G+ 
Sbjct: 121 EERKVVEYGDKMPSGKFEDLIPGQFDIILGVGLAEALGVEVGNKVTVITPEGNVTPAGVV 180

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIEKTHE 242
            R K + V+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A   T +
Sbjct: 181 PRLKQFNVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPALTAK 240

Query: 243 NIVRILGNGVVVIDWQQRYQIFFSCYE 269
            I     + V V DW    + +F   E
Sbjct: 241 LIPEAQRDTVWVRDWTFSNRSYFEAVE 267


>gi|167041423|gb|ABZ06175.1| putative Predicted permease [uncultured marine microorganism
           HF4000_006O13]
          Length = 408

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 140/269 (52%), Gaps = 25/269 (9%)

Query: 8   EVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGH 67
           ++ +A+R LFS +++ FISI +FIS + + +GV +LIVV+SVMNGF+ ++ +RV+ ++ H
Sbjct: 4   KLFIAYRQLFSKQQSQFISIVTFISILAIALGVSSLIVVLSVMNGFQAEIEERVIRLSSH 63

Query: 68  VVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFS 127
           + IQ    P+  +Q I N L+  P++   +PFV  +  +S       G L+ GI+ +D  
Sbjct: 64  ITIQSD-QPIRRWQSIVNELEQFPEIKHTIPFVEAKGIISN-GQESKGALITGINPAD-- 119

Query: 128 YLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSP----YGDVT-PMGM 182
                   F+G    D + G+ +I+G+ +A  L +  GD+  +  P     G ++ P   
Sbjct: 120 ------EFFFGIKLKDLENGE-LILGRGIALQLNLRAGDQAQLTVPSMNLQGKISFPDSQ 172

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD----PDAIE 238
             R K     G+ R     YD+  V M L +A     L NAV+GI V + +       ++
Sbjct: 173 YFRIKEVVEFGLQR-----YDSSQVVMHLVDASSLLGLGNAVNGISVELGNVYQVKSMVK 227

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSC 267
           +   ++ +I G  + + DW ++ Q  F  
Sbjct: 228 EIESSLKKIKGLEITITDWSKQNQALFDA 256


>gi|256822602|ref|YP_003146565.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Kangiella koreensis DSM 16069]
 gi|256796141|gb|ACV26797.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Kangiella koreensis DSM 16069]
          Length = 414

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/276 (28%), Positives = 138/276 (50%), Gaps = 27/276 (9%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           F + V  RY  + R+N FIS  S IS IG+ +GVM LI VMSVMNGF  ++  R+LG+  
Sbjct: 5   FSLFVGLRYTRAKRRNHFISFISLISMIGIALGVMVLITVMSVMNGFERELRDRILGMAP 64

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           HV++Q    P+ D+Q +  ++   P+VI   P+V  ++            + R      F
Sbjct: 65  HVLVQGLGTPIEDWQALEQKVKEHPEVIGASPYVQTES------------MFRFQGRERF 112

Query: 127 SYLQNSFSRFYGNVS--------NDFDRGK----GVIIGKDLARNLGISIGDKINIL-SP 173
             +Q       G VS          FD  K     +I+G  +AR+LG+++GDK+++L   
Sbjct: 113 GMVQGVLPNKIGEVSIVKDNMLTGSFDEIKPGEYNIILGASIARSLGLNLGDKVSLLILK 172

Query: 174 YGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
              V+  G+ +R+K +TV G+F  R  + D  + ++ + +A      E  V+ +++   +
Sbjct: 173 ETRVSMAGLSMRAKRFTVTGIFETR-SEADKSLAFIHMDDAAQLLRQE-GVTALQLKTNN 230

Query: 234 PDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +   +  +  +L +   V DW ++++  F+  +
Sbjct: 231 VMNVYDINYQVSELLNHQYFVTDWTRQHETLFNAID 266


>gi|187251715|ref|YP_001876197.1| putative ipoprotein releasing system [Elusimicrobium minutum
           Pei191]
 gi|186971875|gb|ACC98860.1| Putative lipoprotein releasing system [Elusimicrobium minutum
           Pei191]
          Length = 409

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 79/263 (30%), Positives = 136/263 (51%), Gaps = 14/263 (5%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RFE+ VA RYL S RK  F  I + I   GV +GV ALI  ++VM GF+ D+ ++V+G  
Sbjct: 2   RFELFVAKRYLNSKRKGLFALITTIIGIAGVTVGVAALITTLAVMTGFQTDIKEKVIGAQ 61

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS-GVLVRGIS-- 122
            H++I       V YQ    +++ +P V    P + GQ  ++   +G S  +++RG+   
Sbjct: 62  SHILIFGHMTEAV-YQDKIKKIEQLPLVYAAAPNIFGQGIIT--HNGSSLAIVLRGLEPE 118

Query: 123 -NSDFSYLQNSFSRFYGNVSNDFDRGKG-----VIIGKDLARNLGISIGDKINILSPYGD 176
                + L +SF    G+       G+      +++G +LA +L + +GD + ++SP   
Sbjct: 119 MEDKVNRLNSSFEE--GSYVAPLREGETSAPAPLVLGTELANSLNLEVGDDVVLISPSSI 176

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
            T  GM  + K + + G  +  + ++D  M Y +L+ A  + NL+   +GI + +K+ D 
Sbjct: 177 STSAGMVPKMKKFRISGTIKTGYYEFDRTMGYTTLEHASEFLNLQKGATGISIRLKNIDN 236

Query: 237 IEKTHENIVRILGNGVVVIDWQQ 259
            EK  + I  I+GNG  +  + Q
Sbjct: 237 AEKAAKLIRPIMGNGFSIRTFAQ 259


>gi|58584740|ref|YP_198313.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
 gi|58419056|gb|AAW71071.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Wolbachia endosymbiont strain TRS of
           Brugia malayi]
          Length = 385

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 133/247 (53%), Gaps = 15/247 (6%)

Query: 29  SFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLD 88
           +  S IG+ +GV  LIVVMSVMNGFR  ++  +LGI+GH+ +        DY+ +   + 
Sbjct: 2   TLFSIIGIALGVATLIVVMSVMNGFRARLLDSILGIDGHINVYFDRNINSDYRTVLESVK 61

Query: 89  FIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF---SYLQNSFSRFYGNVSNDFD 145
            IP V+K     + Q  ++  +S   G +VRG+S  D    + ++NS     G+V   FD
Sbjct: 62  KIPGVLKATLMTNDQVIITA-NSRIVGAVVRGVSAKDLLNNTTIKNSV--IVGDV-RKFD 117

Query: 146 RGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNG 205
             KGV+IG  LA  L +  GDKI ++S  G  + +    R K Y V+ +F M   +YDN 
Sbjct: 118 --KGVVIGARLAEVLDVGYGDKIVLISSEGFDSLLSEVPRMKEYEVIAIFDMGMFEYDNT 175

Query: 206 MVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHE--NIVRILGNGVVVIDWQQRYQI 263
           ++YM ++ AQ +F+  ++   IEVFV D   + K +E  NI+     G+    WQ +   
Sbjct: 176 LIYMPIKSAQAFFHYRDSARNIEVFVSD---LTKANELANIIE-KETGMEARSWQLQQSH 231

Query: 264 FFSCYES 270
           +F+  E+
Sbjct: 232 YFNALET 238


>gi|313668350|ref|YP_004048634.1| lipoprotein releasing system transmembrane protein [Neisseria
           lactamica ST-640]
 gi|313005812|emb|CBN87266.1| Putative lipoprotein releasing system transmembrane protein
           [Neisseria lactamica 020-06]
          Length = 415

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 142/271 (52%), Gaps = 15/271 (5%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  
Sbjct: 4   LEAWIGLRYLRAKKRNGFMSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I        D++ +    +    ++   P+VS QA    L++ G   GV +RGI  S
Sbjct: 64  HAEIGYIDNTGTDWRNLLRFTENRKGILAAAPYVSNQAL---LANAGEIRGVQMRGILPS 120

Query: 125 DFSYL-----QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +   +     +    +F   +  +FD    +I+G  LA  LG+ +G+K+ +++P G+VTP
Sbjct: 121 EERKVVEYGDKMPAGKFEDLIPGEFD----IILGVGLAEALGVEVGNKVTVITPEGNVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIE 238
            G+  R K + V+G+ +    + DN +    +Q+A++ + L+  V+G+ + + DP +A  
Sbjct: 177 AGVVPRLKQFNVVGLVKTGVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPA 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            T   I     + V V DW    + +F   E
Sbjct: 237 LTATLIPEAQRDTVWVRDWTFSNRSYFEAVE 267


>gi|145589649|ref|YP_001156246.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
 gi|145048055|gb|ABP34682.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Polynucleobacter necessarius subsp. asymbioticus
           QLW-P1DMWA-1]
          Length = 420

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 139/271 (51%), Gaps = 10/271 (3%)

Query: 7   FEVIVAWRYLFSNRK------NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKR 60
            E+ +  RY  S R+      + F+S  S IS  G+ +GV +LIVV+SVMNGF++D+  R
Sbjct: 6   IELEIGLRYTRSKRRKTVGKHDGFLSFISGISTAGIALGVASLIVVLSVMNGFQKDVRDR 65

Query: 61  VLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           +L +  HV I      L +++ +A ++   P V+ V P V+ Q  +S   +   GV +RG
Sbjct: 66  MLSVLSHVEITAPDG-LANWEPLALKVAAQPHVVGVAPMVASQGLLSR-DNVMRGVAIRG 123

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +S S+   + +   +F     ND   G  GV +G  LA  +G  +GD+IN++ P  D+TP
Sbjct: 124 VSPSEEGKVSDLPKQFVAGSINDLTPGGFGVALGAQLAALVGAHVGDRINLIVPESDLTP 183

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
            G   R ++  V+G+      ++D+ +  M  ++A     L +  SG+ V V D     +
Sbjct: 184 AGAMPRMRTLQVVGIVDSGHYEFDSSLAIMHWKDAAALLRLHDP-SGLRVKVDDMQRAPE 242

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYES 270
               +  ++   + V DW +  + +F+  ++
Sbjct: 243 VANELAAVVPQALWVTDWSRSNRNWFAAVQT 273


>gi|241758822|ref|ZP_04756935.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria flavescens SK114]
 gi|241321030|gb|EER57243.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Neisseria flavescens SK114]
          Length = 416

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 144/275 (52%), Gaps = 18/275 (6%)

Query: 5   SRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGI 64
           +  E  +  RYL + ++N F+S  + IS +G+ +GV ALIVV+SVMNGF++++  ++L +
Sbjct: 2   ASLETWIGLRYLRAKKRNGFMSFITMISIVGIALGVTALIVVLSVMNGFQKEIRGQLLNV 61

Query: 65  NGHVVIQQKYYPL---VDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVR 119
             H  I   YY +    D+Q +   +    +V+   P+VS QA    L++ G   GV +R
Sbjct: 62  APHAEI--GYYDVGSAPDWQNLREFVKGKKEVLASAPYVSDQAL---LANAGEVRGVQIR 116

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
           GI  S+   + +          +D   G+  +I+G+ LA  LG  IG K+ +++P G+VT
Sbjct: 117 GILPSEEKNVVDYGKDMPAGSFDDLKPGEFDIILGQGLAEALGTEIGGKVTVITPEGNVT 176

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + V+G+ +    + DN +    +++AQ+ + L   V G+ + + DP   +
Sbjct: 177 PAGVVPRLKQFNVVGVVKTGVYEVDNTLAMTHIKDAQVLYRLGENVGGLRLRLADP---Q 233

Query: 239 KTHENIVRILGNG----VVVIDWQQRYQIFFSCYE 269
                I +++ +     V V DW    + +F   E
Sbjct: 234 NAPSFIAKLIPDAKKDEVWVRDWTFNNRSYFEAVE 268


>gi|285018590|ref|YP_003376301.1| ABC transporter-type lipoprotein-releasing ABC transporter
           [Xanthomonas albilineans GPE PC73]
 gi|283473808|emb|CBA16310.1| putative abc transporter-type lipoprotein-releasing abc transporter
           [Xanthomonas albilineans]
          Length = 414

 Score =  118 bits (295), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 71/261 (27%), Positives = 132/261 (50%), Gaps = 7/261 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFKPIPVAIGLRYLRAKRRNNFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI- 121
            +  H  +  +  P+ D++   +     P V    P+V  +A ++GL +     +VRGI 
Sbjct: 61  QMAAHATVSAQGAPMQDWRHAVDVAMGDPRVAGAAPYVEEEALLTGLRN--QPAIVRGIV 118

Query: 122 --SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
               +  S L     +  G+V +       +++G++LA  LG+++GDK+ ++      +P
Sbjct: 119 PAEEAKVSVLAQKMKQ--GSVDSLVPGSYNIVLGQELALWLGVAVGDKVVVMLGEPQASP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           MGM  R K +TV G+F   + + D G+   S+ + Q    + + V+G+ + + D D    
Sbjct: 177 MGMVPRYKRFTVSGIFEAGYNEVDRGLAVTSMADLQRVLRMGDGVTGVRLKLHDMDLAWN 236

Query: 240 THENIVRILGNGVVVIDWQQR 260
              ++   L    +V DW + 
Sbjct: 237 VARDLALKLRGPYMVSDWTRE 257


>gi|192361053|ref|YP_001982252.1| efflux ABC transporter permease [Cellvibrio japonicus Ueda107]
 gi|190687218|gb|ACE84896.1| efflux ABC transporter, permease protein [Cellvibrio japonicus
           Ueda107]
          Length = 434

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/269 (29%), Positives = 142/269 (52%), Gaps = 7/269 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           + +   + +  RY  + R+N FIS  S  S IG+ +GVMALI+V+SVMNGF  +M +R+L
Sbjct: 23  MLTNIPLYIGLRYTRAKRRNQFISFISAFSLIGMALGVMALIIVLSVMNGFDREMKERIL 82

Query: 63  GINGHVVIQQKYYPLV-DYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
            +  H ++ QK  PL+ D+  +A +++  P V+   P+++    +S  + G   V ++GI
Sbjct: 83  SVVPHGLVDQK--PLLHDWHLLAEQVEQHPRVVAAAPYLASTVMIS-YADGVEAVELQGI 139

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
              + + +     R           G+ G+++G+ LA  L ++ GDKI I SP  ++TP+
Sbjct: 140 IPEEEARVSIVDKRMLVGDMALLQPGEYGIVMGRILASRLALAPGDKIRITSPDINITPL 199

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G   R++ +T++G+F +     D+ +V++ L +A+ +     A  G+ V   +       
Sbjct: 200 GAFTRTRHFTLVGVFEVG-ALVDSNLVFIHLDDAKRFLRQPGA-QGLHVKTDNMLDAPLI 257

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +I + LG+ V V DW Q     F   +
Sbjct: 258 MSDIRQRLGDSVQVKDWSQTQGSLFQAVK 286


>gi|149927854|ref|ZP_01916105.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Limnobacter sp. MED105]
 gi|149823476|gb|EDM82707.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Limnobacter sp. MED105]
          Length = 425

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 80/270 (29%), Positives = 144/270 (53%), Gaps = 10/270 (3%)

Query: 7   FEVIVAWRYLF---SNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F+V +A RY+       ++ FIS  S +S  G+ +GV ALIVV+SVMNGF++++  R+L 
Sbjct: 13  FDVEIALRYVRGGGHRSRDKFISFISGLSMAGIGLGVAALIVVLSVMNGFQKEVRDRMLS 72

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFI-PDVIKVLPFVSGQAFVSGLSSGG--SGVLVRG 120
           +  H+ +        + + +   +    P VI   P+V+G++    L+ G      +VRG
Sbjct: 73  VIAHIEVLAPQEGFDNPEALVGAIKAANPKVIGAAPYVAGESM---LAHGDLLRPAIVRG 129

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           I  +    + +      G++SN       V++G +LA+ +G+S+GD+I +++P G +TP 
Sbjct: 130 IDPAQEREVSDFKEVISGSLSNLQAGEFRVVLGIELAKQIGVSVGDRITLIAPSGQMTPA 189

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           GM  R K++ +  +      +YD+G+V M+L +A  ++      +GI V + D DA    
Sbjct: 190 GMIPRLKAFEITALVSTGHYEYDSGLVLMNLDDAARFYR-SLGPTGIRVKLNDMDAAPLV 248

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYES 270
             +I R L   V V DW  + + +F+  ++
Sbjct: 249 ARDIERQLPPTVWVRDWSVQNRTWFAAVQT 278


>gi|325266690|ref|ZP_08133367.1| lipoprotein ABC superfamily ATP binding cassette transporter,
           membrane protein [Kingella denitrificans ATCC 33394]
 gi|324982133|gb|EGC17768.1| lipoprotein ABC superfamily ATP binding cassette transporter,
           membrane protein [Kingella denitrificans ATCC 33394]
          Length = 419

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 69/251 (27%), Positives = 132/251 (52%), Gaps = 14/251 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
            +  E  +  RYL + +++ F+S  S +S +G+ +GV+ALIVV+SV+NGF++++  ++L 
Sbjct: 1   MASLETWIGLRYLRAKKRSGFMSFISVMSIVGIALGVIALIVVLSVVNGFQKEIRGQLLN 60

Query: 64  INGHVVI-----QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLV 118
           I  H  +      Q   P   +Q +  +    P+V+   PF++GQ  ++  S    G  +
Sbjct: 61  IAPHAEVGYLIDSQNGTP-ATWQALQQKFAGKPEVLASAPFIAGQGLLAN-SGEVRGTQL 118

Query: 119 RGISNSDFSYLQNSFSRFYGNVSNDFDRGK----GVIIGKDLARNLGISIGDKINILSPY 174
           RGI       + +   +     +  FD  K    G+I+G+ LA  LG  + +K+ +++P 
Sbjct: 119 RGILPDQERKVIDYADKM---TAGSFDALKADEFGIILGESLAETLGAKVNEKVTVITPE 175

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
           G+VTP G+  R K +TV+G+ +  F + D+ +  + L +AQ  +  ++A   + + + DP
Sbjct: 176 GNVTPAGVVPRLKQFTVVGIVKTGFDEADSSLALIHLADAQKLYRTDDAAIALRLRLADP 235

Query: 235 DAIEKTHENIV 245
                  E ++
Sbjct: 236 QNAPAVMERLL 246


>gi|89092895|ref|ZP_01165847.1| transport protein of outer membrane lipoproteins (ABC superfamily,
           membrane) [Oceanospirillum sp. MED92]
 gi|89082920|gb|EAR62140.1| transport protein of outer membrane lipoproteins (ABC superfamily,
           membrane) [Oceanospirillum sp. MED92]
          Length = 414

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 126/236 (53%), Gaps = 11/236 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  S  S +G+M+GV ALIVV+SVMNGF  ++ +R+L
Sbjct: 1   MFKPLSIFIGLRYTAAKRSNHFISFISMASMLGLMLGVAALIVVLSVMNGFDRELKQRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRG 120
           G+  H  I     PL ++  +  +L+  P+VI   PFV  Q     L+S G   G +V G
Sbjct: 61  GMVPHATISGYGKPLDNWSELIEQLESNPEVIAAAPFVQAQGM---LTSRGVVRGAMVNG 117

Query: 121 IS---NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
           I+     + S L N      G++    ++  G+++G+ LAR LG  IGDK+ ++ P   V
Sbjct: 118 INPEIEKNVSILGNHIES--GSLDALNEQRFGIVLGEILARYLGAKIGDKVTLVLPEASV 175

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           +  G+  R K +TV+G+F +   + D  + Y+ +++A     +   V GI +   D
Sbjct: 176 SVAGVVPRLKRFTVVGIFSVG-AELDANLAYIHMRDAAKIKRIGEGVDGIRLKFDD 230


>gi|152985881|ref|YP_001347545.1| hypothetical protein PSPA7_2173 [Pseudomonas aeruginosa PA7]
 gi|150961039|gb|ABR83064.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 416

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 136/264 (51%), Gaps = 9/264 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R++ F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  R+L
Sbjct: 1   MFRPLSVFIGTRYTRAKRRSHFVSFISLTSMIGLALGVLVMIVVLSVMNGFDREMRTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI- 121
           G+     ++  Y P+ D++ +A ++     V  V PF   Q  +S  +     V+V  + 
Sbjct: 61  GMVPQATVE-SYQPIDDWRALAEKVKAHEHVTAVAPFTQMQGMLSA-NGAVQTVMVDAVD 118

Query: 122 --SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
               +  S + + F +  G+++     G G++IG+  A+ LG+ IGDK+ ++ P   VTP
Sbjct: 119 PREEAKVSIIPDFFKQ--GSLAELKAGGFGIVIGQLAAQKLGVGIGDKVTLILPEVAVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIE 238
            G+  R K +TV+G FR+   + D G+  + L++ A+L     N V G+ + + D     
Sbjct: 177 AGVFPRMKRFTVVGTFRVGAGELDGGLSLIHLEDAARLQRWKTNQVQGLRLKLDDLFQAP 236

Query: 239 KTHENIVRILG-NGVVVIDWQQRY 261
           +    I R L  N     DW + +
Sbjct: 237 RVAWEIARTLTDNDFYARDWTRSH 260


>gi|225075253|ref|ZP_03718452.1| hypothetical protein NEIFLAOT_00256 [Neisseria flavescens
           NRL30031/H210]
 gi|224953428|gb|EEG34637.1| hypothetical protein NEIFLAOT_00256 [Neisseria flavescens
           NRL30031/H210]
          Length = 416

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 128/237 (54%), Gaps = 11/237 (4%)

Query: 5   SRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGI 64
           +  E  +  RYL + ++N F+S  + IS  G+ +GV ALIVV+SVMNGF++++  ++L +
Sbjct: 2   ASLETWIGLRYLRAKKRNGFMSFITMISIAGIALGVTALIVVLSVMNGFQKEIRGQLLNV 61

Query: 65  NGHVVIQQKYYPLVDYQFIANRLDFIP---DVIKVLPFVSGQAFVSGLSSGGS--GVLVR 119
             H  I   YY +       N  +F+    +V+   P+VS QA    L++ G   GV +R
Sbjct: 62  APHAEI--GYYDVGSAPGWQNLREFVKGKKEVLASAPYVSDQAL---LANAGEVRGVQIR 116

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
           GI  S+   + +          +D   G+  +I+G+ LA  LG  IG K+ +++P G+VT
Sbjct: 117 GILPSEEKNVVDYGKDMPAGSFDDLKPGEFDIILGQGLAEALGTEIGGKVTVITPEGNVT 176

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPD 235
           P G+  R K + V+G+ +    + DN +    +++AQ+ + L   V G+ + + DP 
Sbjct: 177 PAGVVPRLKQFNVVGVVKTGVYEVDNTLAMTHIKDAQVLYRLGENVGGLRLRLADPQ 233


>gi|291286026|ref|YP_003502842.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Denitrovibrio acetiphilus DSM 12809]
 gi|290883186|gb|ADD66886.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Denitrovibrio acetiphilus DSM 12809]
          Length = 410

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/271 (28%), Positives = 138/271 (50%), Gaps = 9/271 (3%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           +FE  VA RYL S + N  +S  S IS +G+++GV  LIVV+SVM+GF +++  R+LG N
Sbjct: 2   KFERFVAGRYLRSRKSNKILSFISGISILGILLGVATLIVVVSVMSGFSDNLKNRILGAN 61

Query: 66  GHVVIQQ-KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
            H+V+ +    P+ ++Q I   ++ +  V  V PF+  Q  ++  ++    V+   +   
Sbjct: 62  AHIVVNRVDVSPIKNWQGIGKIIEDVDGVTGVSPFILNQVLLTSENNVSGVVVRGVVPER 121

Query: 125 DFSYLQNSFSRF-----YGNVSNDFDRGKGVI-IGKDLARNLGISIGDKINILSPYGDVT 178
           +      S  +F     + ++S   + G   I +GK+LA NLG+  GD++ ++SP+G   
Sbjct: 122 ELKV--TSIKKFMTDGYFNDISKKAENGNPQIAVGKELAANLGVLPGDEVVMVSPFGKKG 179

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  + K + V G+F     +Y+N + Y+ + +AQ +F   +  SG  +   + D   
Sbjct: 180 PFGITPKMKRFEVSGIFDTGMYEYNNSLAYIDISDAQEFFGTGDIASGFSISTGNFDKAP 239

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
                I + L       DW    +  FS  +
Sbjct: 240 AIAAQIQKELDFPFWSRDWISMNKNLFSALK 270


>gi|15598184|ref|NP_251678.1| hypothetical protein PA2988 [Pseudomonas aeruginosa PAO1]
 gi|107102537|ref|ZP_01366455.1| hypothetical protein PaerPA_01003601 [Pseudomonas aeruginosa PACS2]
 gi|116050991|ref|YP_790185.1| hypothetical protein PA14_25430 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|218890813|ref|YP_002439677.1| putative lipoprotein releasing system, permease protein
           [Pseudomonas aeruginosa LESB58]
 gi|254235963|ref|ZP_04929286.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|254241694|ref|ZP_04935016.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|296388519|ref|ZP_06877994.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas aeruginosa PAb1]
 gi|313108277|ref|ZP_07794309.1| hypothetical protein PA39016_001330003 [Pseudomonas aeruginosa
           39016]
 gi|9949088|gb|AAG06376.1|AE004724_5 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|115586212|gb|ABJ12227.1| putative lipoprotein releasing system, permease protein
           [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126167894|gb|EAZ53405.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126195072|gb|EAZ59135.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218771036|emb|CAW26801.1| putative lipoprotein releasing system, permease protein
           [Pseudomonas aeruginosa LESB58]
 gi|310880811|gb|EFQ39405.1| hypothetical protein PA39016_001330003 [Pseudomonas aeruginosa
           39016]
          Length = 416

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/264 (29%), Positives = 136/264 (51%), Gaps = 9/264 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R++ F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  R+L
Sbjct: 1   MFRPLSVFIGTRYTRAKRRSHFVSFISLTSMIGLALGVLVMIVVLSVMNGFDREMRTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI- 121
           G+     ++  Y P+ D++ +A ++     V  V PF   Q  +S  +     V+V  + 
Sbjct: 61  GMVPQATVE-SYQPIDDWRALAEKVKAHEHVTAVAPFTQMQGMLSA-NGAVQTVMVDAVD 118

Query: 122 --SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
               +  S + + F +  G+++     G G++IG+  A+ LG+ IGDK+ ++ P   VTP
Sbjct: 119 PLEEAKVSIIPDFFKQ--GSLAELKAGGFGIVIGQLAAQKLGVGIGDKVTLILPEVAVTP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIE 238
            G+  R K +TV+G FR+   + D G+  + L++ A+L     N V G+ + + D     
Sbjct: 177 AGVFPRMKRFTVVGTFRVGAGELDGGLSLIHLEDAARLQRWKTNQVQGLRLKLDDLFQAP 236

Query: 239 KTHENIVRILG-NGVVVIDWQQRY 261
           +    I R L  N     DW + +
Sbjct: 237 RVAWEIARTLTDNDFYARDWTRSH 260


>gi|261380149|ref|ZP_05984722.1| lipoprotein releasing system, permease protein [Neisseria subflava
           NJ9703]
 gi|284796986|gb|EFC52333.1| lipoprotein releasing system, permease protein [Neisseria subflava
           NJ9703]
          Length = 416

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 143/275 (52%), Gaps = 18/275 (6%)

Query: 5   SRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGI 64
           +  E  +  RYL + ++N F+S  + IS +G+ +GV ALIVV+SVMNGF++++  ++L +
Sbjct: 2   ASLETWIGLRYLRAKKRNGFMSFITMISIVGIALGVTALIVVLSVMNGFQKEIRGQLLNV 61

Query: 65  NGHVVIQQKYYPLVDYQFIANRLDFIP---DVIKVLPFVSGQAFVSGLSSGGS--GVLVR 119
             H  I   YY +       +  +F+    +V+   P+VS QA    L++ G   GV +R
Sbjct: 62  APHAEI--GYYDVGSAPGWQSLREFVKGKKEVLASAPYVSDQAL---LANAGEVRGVQIR 116

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
           GI  S+   + +          +D   G+  +I+G+ LA  LG  IG K+ +++P G+VT
Sbjct: 117 GILPSEEKNVVDYGKDMPAGSFDDLKPGEFDIILGQGLAEALGTEIGGKVTVITPEGNVT 176

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + V+G+ +    + DN +    +++AQ+ + L   V G+ + + DP   +
Sbjct: 177 PAGVVPRLKQFNVVGVVKTGVYEVDNTLAMTHIKDAQVLYRLGENVGGLRLRLADP---Q 233

Query: 239 KTHENIVRILGNG----VVVIDWQQRYQIFFSCYE 269
                I +++ +     V V DW    + +F   E
Sbjct: 234 NAPSFIAKLIPDAKKDEVWVRDWTFNNRSYFEAVE 268


>gi|319638359|ref|ZP_07993121.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           mucosa C102]
 gi|317400108|gb|EFV80767.1| lipoprotein-releasing system transmembrane protein lolC [Neisseria
           mucosa C102]
          Length = 416

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 80/275 (29%), Positives = 142/275 (51%), Gaps = 18/275 (6%)

Query: 5   SRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGI 64
           +  E  +  RYL + ++N F+S  + IS  G+ +GV ALIVV+SVMNGF++++  ++L +
Sbjct: 2   ASLETWIGLRYLRAKKRNGFMSFITMISIAGIALGVTALIVVLSVMNGFQKEIRGQLLNV 61

Query: 65  NGHVVIQQKYYPLVDYQFIANRLDFIP---DVIKVLPFVSGQAFVSGLSSGGS--GVLVR 119
             H  I   YY +       N  +F+    +V+   P+VS QA    L++ G   GV +R
Sbjct: 62  APHAEI--GYYDVGSAPGWQNLREFVKGKKEVLASAPYVSDQAL---LANAGEVRGVQIR 116

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
           GI  S+   + +          +D   G+  +I+G+ LA  LG  +G K+ +++P G+VT
Sbjct: 117 GILPSEEKNVVDYGKDMPAGSFDDLKPGEFDIILGQGLAEALGTELGGKVTVITPEGNVT 176

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + V+G+ +    + DN +    +++AQ+ + L   V G+ + + DP   +
Sbjct: 177 PAGVVPRLKQFNVVGVVKTGVYEVDNTLAMTHIKDAQVLYRLGENVGGLRLRLADP---Q 233

Query: 239 KTHENIVRILGNG----VVVIDWQQRYQIFFSCYE 269
                I +++ +     V V DW    + +F   E
Sbjct: 234 NAPSFIAKLIPDAKKDEVWVRDWTFNNRSYFEAVE 268


>gi|218513337|ref|ZP_03510177.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Rhizobium etli 8C-3]
          Length = 115

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 72/105 (68%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS FE +VAWRYL + RK AFIS+ +  SF+G+M+GV  LI+VM+VMNGFR +++ R+LG
Sbjct: 8   FSIFERLVAWRYLRARRKEAFISVIAGFSFVGIMLGVATLIIVMAVMNGFRTELVSRILG 67

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSG 108
           INGH+++Q    P  DY  + +RL  +P V   LP V GQ   S 
Sbjct: 68  INGHMIVQPSDGPFTDYTDLTSRLAAVPGVKMALPLVEGQVLASA 112


>gi|110833910|ref|YP_692769.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Alcanivorax borkumensis SK2]
 gi|110647021|emb|CAL16497.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Alcanivorax borkumensis SK2]
          Length = 414

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 81/275 (29%), Positives = 134/275 (48%), Gaps = 20/275 (7%)

Query: 2   SIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRV 61
            +F      V  RY  +  +N+FIS+ + IS +G+M+GV  LI V+SVMNGF  ++  R+
Sbjct: 3   CMFRPLSFYVGLRYTGARARNSFISVITLISALGLMLGVAVLITVLSVMNGFDRELQTRI 62

Query: 62  LGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
           LG+  H+ +  +  P+ D+Q +ANRLD    +  V PFV  +  ++      +G L+ GI
Sbjct: 63  LGMVTHLSVHGR-EPVQDWQALANRLDHHDQIEAVAPFVQLEGMLTH-RGNVAGALINGI 120

Query: 122 SNS---------DFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILS 172
                       DF + Q          S +FD    V++G  LAR L   +GDKI ++ 
Sbjct: 121 DPEAERKVSIVGDFMH-QGELDSLE---SGEFD----VVLGYGLARRLDAQLGDKITLVL 172

Query: 173 PYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
           P   ++P G+  R K +TV G+FR+R  + D+   Y+++ +A         V G+ + + 
Sbjct: 173 PEATISPAGVMPRFKRFTVTGIFRVR-AEVDSLYAYVNVADAAKLARQAGTVQGVRLKLN 231

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
           D  +       + + LG      DW + +   F  
Sbjct: 232 DLFSASNLGWTLQQELGPNYYTSDWTRSHGNLFQA 266


>gi|94970594|ref|YP_592642.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Candidatus Koribacter versatilis Ellin345]
 gi|94552644|gb|ABF42568.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Candidatus Koribacter versatilis Ellin345]
          Length = 423

 Score =  115 bits (289), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 141/281 (50%), Gaps = 20/281 (7%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           +FE+ +A RYL + R+ A I + + IS IGV  GV +LI+ +++ NGFR D+  R+LG  
Sbjct: 2   KFELFIATRYLRAKRRQAVIGVITGISIIGVAAGVASLIIALAINNGFRSDLQARLLGSM 61

Query: 66  GHV-VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
            H+ +++ +   + +++ +  +L+  P V+   P +  Q  +S   +   G L++GI  +
Sbjct: 62  SHINLMRLQNDGIKNWRDLLAKLEKQPHVVAGAPAIYEQVLIS-RGARAQGALLKGIVPA 120

Query: 125 D---FSYLQNSFSRFYGNVSNDFDRGKG---------------VIIGKDLARNLGISIGD 166
           D    S L ++      +  +    G+G               +++GKD+A  LG + G 
Sbjct: 121 DERRVSALLDNVKFGSADALDSSQNGEGAPKTLSDEVTQSLPPIVLGKDMADTLGATTGS 180

Query: 167 KINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSG 226
            + + SP G++TP G+  + + + V+G+F   F DYD+      L +AQ  F L + V  
Sbjct: 181 VVLVTSPQGELTPFGIVPKYQRFKVVGIFESGFYDYDSSWGLTRLDDAQKLFGLGDIVPV 240

Query: 227 IEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
           +E  V D     +  + +V + G G    +W ++ Q  F  
Sbjct: 241 LEFKVDDIYKAPQIADQLVDVAGQGFGAKNWMEQNQALFRA 281


>gi|90021454|ref|YP_527281.1| lipoprotein releasing system transmembrane protein LolE
           [Saccharophagus degradans 2-40]
 gi|89951054|gb|ABD81069.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Saccharophagus degradans 2-40]
          Length = 414

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 78/266 (29%), Positives = 138/266 (51%), Gaps = 22/266 (8%)

Query: 14  RYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQK 73
           RY+ + R+N FI+  S+ + +G+ +GV A+IVV+SVMNGF  ++ +R+L +  H  +  +
Sbjct: 12  RYVRAKRRNGFIAFVSWFALLGMALGVFAIIVVLSVMNGFDRELKERILRVVPHGFLTTE 71

Query: 74  YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQN-- 131
             PL  ++ ++ ++   P ++   P++ G    +GL S G GV    I   D  Y +N  
Sbjct: 72  -KPLTQWRALSEQIQHQPHLLASAPYIDG----TGLVSYGGGVRPVEIQGIDPDYERNIS 126

Query: 132 ---SFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSK 187
               F    G +S D   G+  +++G  +ARNLG++IGD + +  P   +TP G+  RSK
Sbjct: 127 LVDDF-MLVGALS-DLQAGEYQIVLGNLIARNLGLAIGDTVAVTLPQVSITPAGVFPRSK 184

Query: 188 SYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD----PDAIEKTHEN 243
            +T++G+F +     D  +  + + +A+  F + ++V+G+ +   D    P  I K   +
Sbjct: 185 RFTLIGVFEVG-AQVDQSLALIHIDDAKKLFRMGDSVAGLHLKYDDIYSAPAEISKLKAS 243

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
               LG G    DW Q     F   +
Sbjct: 244 ----LGEGYTTKDWSQTQGSLFQAVK 265


>gi|299137494|ref|ZP_07030676.1| protein of unknown function DUF214 [Acidobacterium sp. MP5ACTX8]
 gi|298600899|gb|EFI57055.1| protein of unknown function DUF214 [Acidobacterium sp. MP5ACTX8]
          Length = 413

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 145/274 (52%), Gaps = 12/274 (4%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RFE+ +A RYL + R+ A +   + IS IGV  GV +LIV +++ NG R D+ +R++G  
Sbjct: 2   RFELFIAARYLRARRRQAVVGFITVISIIGVAAGVASLIVALAITNGMRRDLQERLVGST 61

Query: 66  GHVVIQQKYYP-LVDYQFIANRLDFIPDVIKVLPFVSGQAFVS-GLSSGGSGVLVRGISN 123
            HV++ +     + +++ +  +L  +P V  V P + GQ  +S G  SGG+  L++GI  
Sbjct: 62  AHVMLMRTAGDGIHNWRPLMAQLAQMPHVQAVAPGLFGQVLISRGAHSGGA--LIKGIIP 119

Query: 124 SDF--------SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYG 175
           +D         S  Q S +      +   +    ++IG DLA  LG ++GD + + SP G
Sbjct: 120 ADELKVGDLLQSIKQGSAAELEPTATAGNELAPPIVIGNDLAETLGATVGDALLVTSPQG 179

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPD 235
           ++TP+G+  R + + V+G+F   F  YD+   +M L ++Q  F+  + +S +   + D  
Sbjct: 180 ELTPLGLVPRYQRFRVVGIFASGFYQYDSSYAFMRLSDSQRLFSEPDLISAMSFRIDDLY 239

Query: 236 AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             ++  + + +  G G  V +W ++ +  F   +
Sbjct: 240 RAQEVGQTLEQAAGPGFQVTNWMEQNRELFRALK 273


>gi|189218221|ref|YP_001938863.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Methylacidiphilum infernorum V4]
 gi|189185079|gb|ACD82264.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Methylacidiphilum infernorum V4]
          Length = 416

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 87/268 (32%), Positives = 134/268 (50%), Gaps = 13/268 (4%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           F + +A RYL   R  +F+S+ +F+S +GV +GV  L++V+SVM GF  ++ K+++G N 
Sbjct: 5   FSLFLALRYLRPRR--SFVSVITFLSILGVSLGVAVLVIVLSVMAGFSHELEKKIIGFNA 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+VI           FIA   +  P V+   PFVSG   V   S   + +L RGI N D 
Sbjct: 63  HLVISNGEILHRPQNFIA-LAEKDPFVVGAAPFVSGPVMVEYASRITTPIL-RGI-NLDM 119

Query: 127 SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSP-----YGDVTPMG 181
                   +F    S D + G+ VI+G++ A++    +GDK+ I +P     + D    G
Sbjct: 120 EEKVIPIKKFLIAGSYDLE-GESVIVGEEWAKHTDAYLGDKVLIYAPRHFQAFRDNFQKG 178

Query: 182 --MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
               I    +T+ G+FR    +YD+     SL  AQ  ++L N V GI + +KDP A  K
Sbjct: 179 KQTTILPSEFTITGIFRTGLYEYDSSYFITSLANAQYLYSLGNGVHGISIRIKDPLAASK 238

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSC 267
             E +   L   V  + W  + +  FS 
Sbjct: 239 VKERLNLQLQPPVEALTWIDQNRPLFSA 266


>gi|119945863|ref|YP_943543.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Psychromonas ingrahamii 37]
 gi|119864467|gb|ABM03944.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Psychromonas ingrahamii 37]
          Length = 408

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 87/272 (31%), Positives = 142/272 (52%), Gaps = 13/272 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  S R N FIS  S  S  G+ +GV+ALI V+SVMNGF  ++  R+L
Sbjct: 1   MFYPLSVFIGLRYTKSKRNNKFISFVSLFSTGGITLGVLALITVLSVMNGFENELKVRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G   H +I  +   + D+Q     L  +P V  V P V  +A +   + G  GV + GI 
Sbjct: 61  GAIPHAIISNQEQVIDDWQSRLPALQNMPLVNTVEPVVRSEAIIQS-NRGLQGVQLEGII 119

Query: 123 NSDF--SYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGD-VT 178
              +  + ++N+ +   G +S D   G+  VIIG+ LA+ LG++ GDKI I+S  G   T
Sbjct: 120 PDLYVSNVIKNNLT--LGQMS-DLKAGQYNVIIGQSLAQQLGVTKGDKIRIISARGSRFT 176

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAI 237
           P+G     +++TV+G+F +   D D  +V +  Q+A     +  + V+G+ ++  D   +
Sbjct: 177 PLGRIPSQRNFTVMGLFAVG-SDVDKQLVLLHAQDAARLIRIGLDQVTGLRLYFNDAFDV 235

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           E   + +  +L  G  + DW+Q +   FS  +
Sbjct: 236 E---DWLPPVLKEGQTLQDWRQTHGELFSAVK 264


>gi|238020904|ref|ZP_04601330.1| hypothetical protein GCWU000324_00799 [Kingella oralis ATCC 51147]
 gi|237867884|gb|EEP68890.1| hypothetical protein GCWU000324_00799 [Kingella oralis ATCC 51147]
          Length = 420

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/277 (26%), Positives = 140/277 (50%), Gaps = 16/277 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
            +  E  +  RYL + +++ F+S  S IS +G+ +GV+ALI V+SV+NGF++++  ++L 
Sbjct: 1   MASLETWIGLRYLRAKKRSGFMSFISAISIVGIALGVIALITVLSVVNGFQKEIRGQLLN 60

Query: 64  INGHVVIQQKYYP-------LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS-- 114
           I  H ++   Y P          ++ +  +L    +VI   P +SGQA    L++ G   
Sbjct: 61  IAPHAMV--SYLPSETESANAPTWKQLQTQLANKTEVIATAPVLSGQAL---LANAGEVR 115

Query: 115 GVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSP 173
           GV + GI       + +  +       ND    +  +I+G  LA+ L ++IG+K+ +++P
Sbjct: 116 GVQLDGILPEQERKVVDYANNLEAGSLNDLKPDEFNIILGSALAKTLEVNIGNKVTVITP 175

Query: 174 YGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
            G+VTP G+  R K + V+G+ +    D DN    + L++A+  +  + +   + + + D
Sbjct: 176 EGNVTPAGVAPRLKQFNVVGIVKTGVEDADNVKALIHLEDAKKLYRQDESSVLLRLRLAD 235

Query: 234 PDAIEKTHENIV-RILGNGVVVIDWQQRYQIFFSCYE 269
           P       + ++     N + V DW    + +FS  E
Sbjct: 236 PQNAPAVMQRLIPESQRNTIWVQDWTDNNRSYFSAVE 272


>gi|223936218|ref|ZP_03628131.1| protein of unknown function DUF214 [bacterium Ellin514]
 gi|223895080|gb|EEF61528.1| protein of unknown function DUF214 [bacterium Ellin514]
          Length = 428

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 80/274 (29%), Positives = 139/274 (50%), Gaps = 27/274 (9%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+++A RYL    K  F+SI + IS +GV +GV  L++V+SVM+GF   + +++LG N 
Sbjct: 6   FELLLALRYL--RPKRTFVSIITLISVLGVTLGVAVLVIVISVMSGFDSQLREKILGFNS 63

Query: 67  HVVI------QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVL--- 117
           H+ +       ++   L D+  ++N +    +V+ V PFV  + ++      G   +   
Sbjct: 64  HLKVFEIDPKTKQEGVLHDFAVVSNMVKSNQNVVSVSPFVLNRVYIQTEPPRGEPRIDVP 123

Query: 118 -VRGISNSDFSYLQNSFSRFYGNVSN-DFD-RGKGVIIGKDLARNLGISIGDKINILSPY 174
            VRG+  S     + + S    N+    FD  G+G+++G D A  +G+ +GD +++L P 
Sbjct: 124 YVRGVDPSS----KEAVSLIATNIKQGTFDISGRGMLVGTDFANMMGLQVGDPVSVLLPR 179

Query: 175 GDVTPMGMG--------IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSG 226
            D+  M           I  K Y + G+F   + +Y+  +V  SL+ AQ  ++L   V G
Sbjct: 180 -DLMKMKESMDRGEKELILPKDYEITGIFDTGYYEYNFSVVVTSLENAQDMYDLGEDVHG 238

Query: 227 IEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQR 260
           + V +KDP   +K    + + LG+   V  W Q 
Sbjct: 239 LMVMIKDPTQSDKVRAQLQKSLGSNYKVTSWVQE 272


>gi|83645163|ref|YP_433598.1| lipoprotein release ABC transporter permease [Hahella chejuensis
           KCTC 2396]
 gi|83633206|gb|ABC29173.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Hahella chejuensis KCTC 2396]
          Length = 413

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 139/271 (51%), Gaps = 10/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           ++    + +  RY  + R N FIS  S  S IG+++GV+ LI VMSVMNGF  ++ +R+L
Sbjct: 1   MYKPLSLFIGLRYTSAKRDNHFISFISLTSMIGLILGVLVLITVMSVMNGFDRELRQRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI- 121
           G+  H VI+  + P+  ++ +       P V  V PFV  Q   +  +    G+++ GI 
Sbjct: 61  GMVPHAVIKS-HDPMGSWREVKEFALQHPQVEGVAPFVYAQGMATA-AGNVHGIMINGID 118

Query: 122 --SNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
             +    S +QN      G++ +D   G+ G+++G  LA  +   +GDKI ++ P   VT
Sbjct: 119 PEAEKGVSIVQNHL--ISGSL-DDLKPGEFGIVLGDILASYMRARVGDKITVILPEASVT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K +TV G+F +   + D+ +  +++++A     L ++V G+ + + +     
Sbjct: 176 PAGVFPRMKRFTVKGIFSVG-AELDSTLAIINIEDAARIKRLGDSVEGVRLKLTNLFDAS 234

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           K    IV  LG+G    DW + +   F   +
Sbjct: 235 KVSRTIVAELGSGYYASDWTRTHGNLFQAIQ 265


>gi|220903888|ref|YP_002479200.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
 gi|219868187|gb|ACL48522.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Desulfovibrio desulfuricans subsp. desulfuricans str.
           ATCC 27774]
          Length = 411

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 85/268 (31%), Positives = 140/268 (52%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ VA RYLFS RK  FI I S +S +GV +GV AL+VV+ V NG   DM  ++LG N 
Sbjct: 6   FELFVALRYLFSRRKQTFIYIISLMSILGVALGVGALVVVLGVYNGMTTDMRDKILGANS 65

Query: 67  HVVIQQKYYPLV--DYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
           H ++   Y P    +   +  R+  I  V    PFV  +  +S  ++G  GV++RGI   
Sbjct: 66  HAIVMS-YLPSAFENDDGLLERIRSIKGVTGATPFVYTEVMLST-ANGVKGVVLRGIDPE 123

Query: 125 DFSYLQNSFSRFYGNVSNDFDR--GKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
               + +   +     + D  +    G+IIG++LA+ LG+++G ++N+LSP G  T  G 
Sbjct: 124 SGPRVLSMLRQMRSGSAADLQKEGAPGLIIGEELAKRLGLAVGSRVNLLSPSGQKTASGY 183

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPDAIEKTH 241
             R + + V+G+F+    +YD+ + ++ L  A+    L E  +SG+E+ V D    ++  
Sbjct: 184 APRIRPFEVVGVFKTGMFEYDSSLAFVHLSAARDVLGLPEKYLSGVELTVNDLFKADQIS 243

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +   LG+   V  W +     F+  +
Sbjct: 244 SRVATELGSPFYVRSWMEMNANLFAALK 271


>gi|33596665|ref|NP_884308.1| lipoprotein releasing system transmembrane protein [Bordetella
           parapertussis 12822]
 gi|33573366|emb|CAE37350.1| lipoprotein releasing system transmembrane protein [Bordetella
           parapertussis]
          Length = 410

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/256 (29%), Positives = 132/256 (51%), Gaps = 15/256 (5%)

Query: 24  FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYP------- 76
           FIS  +  S  G+ +GV ALIVV+SVMNGF++++  R+L +  H+   + Y P       
Sbjct: 14  FISFIAATSMAGIALGVAALIVVLSVMNGFQKEVRDRMLSVLPHI---ELYIPGAAPERV 70

Query: 77  LVDYQFIANRLDFIPDVIKVLPFVSGQA-FVSGLSSGGSGVLVRGISNSDFSYLQNSFSR 135
           L  ++  A      P+V    PFV+ Q   V G +    GV VRGI  +    + N   +
Sbjct: 71  LQQWRQFAQAARANPEVKGEAPFVAAQGMLVRGQAL--RGVQVRGIDPATEGNVSNIPRQ 128

Query: 136 FY-GNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGM 194
              G +S+    G G ++G DLA  LG+  GD + +L+P G ++P G   R + +TV+G+
Sbjct: 129 MVSGKLSDLVAGGFGAVLGSDLADGLGVKTGDTVLMLAPQGSISPAGFAPRMRQFTVVGI 188

Query: 195 FRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVV 254
           F     +YD+ +V++  ++A   F  E+  +G+ + V D     +    + ++L   V+ 
Sbjct: 189 FSSGHYEYDSTLVFIDDEDAAKVFR-ESGTAGVRLRVADMQRAPEVAAELTKVLPPYVMA 247

Query: 255 IDWQQRYQIFFSCYES 270
            DW +  + +F+  ++
Sbjct: 248 ADWSRNNRTWFAAVQT 263


>gi|261365091|ref|ZP_05977974.1| lipoprotein releasing system, permease protein [Neisseria mucosa
           ATCC 25996]
 gi|288566517|gb|EFC88077.1| lipoprotein releasing system, permease protein [Neisseria mucosa
           ATCC 25996]
          Length = 416

 Score =  113 bits (283), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 82/275 (29%), Positives = 141/275 (51%), Gaps = 22/275 (8%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + ++N F+S  + IS IG+ +GV ALI V+SVMNGF++++  ++L +  
Sbjct: 4   LETWIGLRYLRAKKRNGFMSFITMISIIGIALGVTALITVLSVMNGFQKEIRGQLLNVAP 63

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVL---PFVSGQAFVSGLSSGGS--GVLVRGI 121
           H  I   YY   +     N  + + D  +VL   P++S QA    L++ G   GV +RGI
Sbjct: 64  HAEI--GYYDNGNGLGWQNLREIVKDKKEVLASAPYISDQAL---LANAGEVRGVQIRGI 118

Query: 122 SNSDFSYLQNSFSRFYGN--VSNDFDRGK----GVIIGKDLARNLGISIGDKINILSPYG 175
             S+   + +     YG    +  FD  K     +I+G+ LA+ LG  +G K+ +++P G
Sbjct: 119 LPSEEKNVVD-----YGKDMPAGSFDSLKPGNFDIILGEGLAQALGAEVGGKVTVITPEG 173

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPD 235
           +VTP G+  R K + V+G+ +    + DN +    +Q+AQ+ + L     G+ + + DP 
Sbjct: 174 NVTPAGVVPRLKQFNVVGLVKTGVYEVDNSLAMTHIQDAQVLYRLGENFGGLRLKLADPQ 233

Query: 236 AIEKTHENIVRI-LGNGVVVIDWQQRYQIFFSCYE 269
                  N++     + + V DW    + +F   E
Sbjct: 234 NAPSFTANLISPSKKDSIWVRDWTFNNRSYFEAVE 268


>gi|153003985|ref|YP_001378310.1| hypothetical protein Anae109_1118 [Anaeromyxobacter sp. Fw109-5]
 gi|152027558|gb|ABS25326.1| protein of unknown function DUF214 [Anaeromyxobacter sp. Fw109-5]
          Length = 661

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 80/283 (28%), Positives = 132/283 (46%), Gaps = 28/283 (9%)

Query: 16  LFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGH-VVIQQKY 74
           LF   +     + + IS  GV IGV AL VV+SVM+GF  D+ +++LG N H +++    
Sbjct: 241 LFVRPRMPATLLMTLISIGGVAIGVWALTVVLSVMSGFEADLKQKILGQNAHGMLLTYGQ 300

Query: 75  YPLVDYQFIANRLDFIPDVIKVLPFV-------SGQ----AFVSGLSSGGSGV---LVRG 120
             L D++    R+  +P V    P +       +GQ    A V G+     G    L R 
Sbjct: 301 DELTDWRATRQRVLVVPGVEGATPILYNEVMLSAGQNLTGAIVKGIDVASVGTVTELPRS 360

Query: 121 ISNSDFSYLQNS---------FSRFYGNVSNDFDRGK---GVIIGKDLARNLGISIGDKI 168
           I      +L+                G        GK   G+++G++LAR L + +GD++
Sbjct: 361 IEEGKLEWLEQPGRIPLPGRDERAAEGEGRPPARAGKTLPGIVVGRELARALRVFVGDQV 420

Query: 169 NILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIE 228
           N++SP+GD+ P G   +S+ + V  +F     +YD+   Y+ L E Q +F   ++++  E
Sbjct: 421 NVVSPFGDLGPAGPQPKSRPFRVAAIFHSGMFEYDSKFAYVDLAEGQRFFGTGDSITAFE 480

Query: 229 VFVKDPDAIEKTHENIVRILGNGVV-VIDWQQRYQIFFSCYES 270
           + V DPDA       +V  LG       DW +  +  FS  ++
Sbjct: 481 LKVHDPDAARAVMGRVVFELGGWPYRARDWTELNRSLFSALQT 523


>gi|254796537|ref|YP_003081373.1| lipoprotein releasing system transmembrane protein LolE
           [Neorickettsia risticii str. Illinois]
 gi|254589774|gb|ACT69136.1| lipoprotein releasing system transmembrane protein LolE
           [Neorickettsia risticii str. Illinois]
          Length = 405

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 83/264 (31%), Positives = 133/264 (50%), Gaps = 9/264 (3%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           + E+ +A  YL S    +F  + +F+S +GV IGV +LIVV SVM+GF+ ++I  ++G++
Sbjct: 5   KLELELACSYLISK---SFRGLVTFLSLVGVAIGVASLIVVTSVMDGFKAELISNIVGVS 61

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
           GHV I  +     D   I +    IP V KV+P +  +A +S       GVLVRG+  +D
Sbjct: 62  GHVNIWFQRGINEDVTRIRSIATGIPHVAKVVPALEARAIISN-ELTNVGVLVRGMELND 120

Query: 126 FSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIR 185
           F        +       DF+   G++IG  +A  LG+S+GD++  LS     T +G   R
Sbjct: 121 FVRESLVTEKIIQGKVADFE--DGIVIGARMAEELGVSVGDEVKFLSASYTNTMLGPIPR 178

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIV 245
            K   +  +F +   +YD+ +VYM    A  +F  E   + I  F+ DP       E I 
Sbjct: 179 MKHLKIAAIFALGLVEYDSALVYMPFNVASTFFRSEMNTASI--FLDDPYFASDVSERIK 236

Query: 246 RILGNGVVVIDWQQRYQIFFSCYE 269
           + L + + V +WQ     +F   +
Sbjct: 237 QKLPD-LHVTNWQDVGNPYFRALK 259


>gi|327481331|gb|AEA84641.1| lipoprotein releasing system transmembrane protein LolE
           [Pseudomonas stutzeri DSM 4166]
          Length = 415

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 79/270 (29%), Positives = 130/270 (48%), Gaps = 7/270 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N FIS  S  S IG+ +GV+A+I+V+SVMNGF+ +M  R+L
Sbjct: 2   MFRPISVFIGSRYTRAKRRNHFISFISLTSLIGLALGVLAMIMVLSVMNGFQREMSARIL 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  +  +  PL D+Q +A RL   P ++ + P    +  +S        + + GI 
Sbjct: 62  GMVPHATVIGE-QPLDDWQAVAARLSAHPQIVGMAPVTQLEGMLS-FKGSMQPIQISGID 119

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
                 +     R  G   +    G+ GVIIG   AR  G+ +GDK+ ++ P    +P G
Sbjct: 120 PQAEEQVSIVGERLVGGSLDALKPGEYGVIIGLMTARRFGLKLGDKLTLIVPEVSSSPGG 179

Query: 182 MGIRSKSYTVLGMFRMRFPDYDN--GMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           +  R +   V+G+F++   D D   GM++ +   AQ++  +   V G+ + + D      
Sbjct: 180 VTPRMQRLNVVGVFKVG-ADLDGSLGMIHRA-DAAQIHRWMPQQVQGVRLKLDDLYRAPD 237

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +   LG G  V DW       FS  +
Sbjct: 238 VAAQVQAALGEGYRVEDWSYTQGSLFSAMK 267


>gi|33592244|ref|NP_879888.1| lipoprotein releasing system transmembrane protein [Bordetella
           pertussis Tohama I]
 gi|33571889|emb|CAE41405.1| lipoprotein releasing system transmembrane protein [Bordetella
           pertussis Tohama I]
          Length = 410

 Score =  113 bits (282), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 75/259 (28%), Positives = 134/259 (51%), Gaps = 15/259 (5%)

Query: 21  KNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYP---- 76
           ++ FIS  +  S  G+ +GV ALIVV+SVMNGF++++  R+L +  H+   + Y P    
Sbjct: 11  RDRFISFIAATSMAGIALGVAALIVVLSVMNGFQKEVRDRMLSVLPHI---ELYIPGAAP 67

Query: 77  ---LVDYQFIANRLDFIPDVIKVLPFVSGQA-FVSGLSSGGSGVLVRGISNSDFSYLQNS 132
              L  ++  A      P+V    PFV+ Q   V G +    GV VRGI  +    + + 
Sbjct: 68  ERVLQQWRQFAQAARANPEVKGEAPFVAAQGMLVRGQAL--RGVQVRGIDPATEGNVSDI 125

Query: 133 FSRFY-GNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTV 191
             +   G +S+    G G ++G DLA  LG+  GD + +L+P G ++P G   R + +TV
Sbjct: 126 PRQMVSGKLSDLVAGGFGAVLGSDLADGLGVKTGDTVLMLAPQGSISPAGFAPRMRQFTV 185

Query: 192 LGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNG 251
           +G+F     +YD+ +V++  ++A   F  E+  +G+ + V D     +    + ++L   
Sbjct: 186 VGIFSSGHYEYDSTLVFIDDEDAAKVFR-ESGTAGVRLRVADMQRAPEVAAELTKVLPPY 244

Query: 252 VVVIDWQQRYQIFFSCYES 270
           V+  DW +  + +F+  ++
Sbjct: 245 VMAADWSRNNRTWFAAVQT 263


>gi|254468349|ref|ZP_05081755.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [beta proteobacterium KB13]
 gi|207087159|gb|EDZ64442.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [beta proteobacterium KB13]
          Length = 420

 Score =  113 bits (282), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 137/268 (51%), Gaps = 14/268 (5%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           V+ + L +  KN F+S   F S +G+ IGVMALIVVMSVMNGF  ++ KR+L    H+ +
Sbjct: 10  VSRKILINGSKNRFLSFIGFSSILGISIGVMALIVVMSVMNGFHFELKKRILDATSHIEV 69

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQ 130
                   +   +  ++  +  V  V P+VSG+  +S   S   GVLV+GI+       +
Sbjct: 70  TGGLDNQDEITQLIKKITDLKHVKAVSPYVSGEGLLSN-RSVNRGVLVKGIN----PQYE 124

Query: 131 NSFSRFYGNV---SNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRS 186
           N+ ++    V   S  F      +IIG DLAR LG+ IGD +++L P  + +P+G     
Sbjct: 125 NNVNQLLNKVVKGSKKFSSKPFEIIIGVDLARLLGVDIGDDVSLLIPKLNFSPIGNYPTI 184

Query: 187 KSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYF--NLENAVSGIEVFVKDPDAIEKTHENI 244
           K + ++G+F     ++D+ +  M  Q+AQ  F  N +   + +++ + D +       +I
Sbjct: 185 KKFNIVGIFDAGIYEFDSSLALMDYQDAQKIFFKNQKTKFTAMQIQLTDSNKTLNVESDI 244

Query: 245 VRILGN---GVVVIDWQQRYQIFFSCYE 269
            +IL        + +W  + + FFS  +
Sbjct: 245 KKILTELNINSFITNWTNKNKNFFSAIQ 272


>gi|254429920|ref|ZP_05043627.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Alcanivorax sp. DG881]
 gi|196196089|gb|EDX91048.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Alcanivorax sp. DG881]
          Length = 403

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 75/263 (28%), Positives = 131/263 (49%), Gaps = 20/263 (7%)

Query: 14  RYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQK 73
           RY  +  +N+FIS+ + IS +G+M+GV  LI V+SVMNGF  ++  R+LG+  H+ +  +
Sbjct: 4   RYTGARARNSFISVITLISALGLMLGVAVLITVLSVMNGFDRELQTRILGMVTHLSVHGR 63

Query: 74  YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS--------- 124
             P+ D+Q +ANR+D   ++    PFV  +  ++      +G L+ GI            
Sbjct: 64  -EPVQDWQALANRVDHHDEIQAAAPFVQLEGMLTH-RGNVAGSLINGIEPDAERKVSIVG 121

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGI 184
           DF + Q            +FD    +++G  LAR LG  +GDK+ ++ P   ++P G+  
Sbjct: 122 DFMH-QGELESLE---PGEFD----MVLGYGLARRLGAELGDKVTLVLPEATISPAGVMP 173

Query: 185 RSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENI 244
           R K +TV G+FR+R  + D+   Y+++ +A         V G+ + + D  +       +
Sbjct: 174 RFKRFTVTGIFRVR-AEVDSLYAYVNVADAAKLARQAGTVQGVRLKLNDLFSASNLGWTL 232

Query: 245 VRILGNGVVVIDWQQRYQIFFSC 267
            + LG      DW + +   F  
Sbjct: 233 QQELGPNYYTSDWTRSHGNLFQA 255


>gi|88608320|ref|YP_506036.1| putative permease [Neorickettsia sennetsu str. Miyayama]
 gi|88600489|gb|ABD45957.1| putative permease [Neorickettsia sennetsu str. Miyayama]
          Length = 407

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 83/266 (31%), Positives = 135/266 (50%), Gaps = 11/266 (4%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           + E+ +A+ YL S    +F  + +F+S IGV IGV +LIVV SVM+GF+ ++I  ++G++
Sbjct: 5   KLELELAFSYLISK---SFRGLVTFLSLIGVAIGVASLIVVTSVMDGFKAELISNIVGMS 61

Query: 66  GHVVI--QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           GHV I  Q+      D   + +    +P V KV+P +  +A +S       GVLVRG+  
Sbjct: 62  GHVNIWFQRSTNENEDVMRLRSLATGMPHVAKVVPALEARAIISN-ELTNVGVLVRGMEL 120

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
           +DF        +       DF+   G++IG  +A+ LG+++GD++  LS     T +G  
Sbjct: 121 NDFERESLVTEKIIQGKVADFE--DGIVIGTRMAKELGVNVGDEVRFLSASYTNTILGPI 178

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            R K   V  +F +   +YD+ +VYM    A  +F  E   + I  ++ DP       E 
Sbjct: 179 PRMKHLKVAAIFALGLVEYDSTLVYMPFNIASTFFRSEMNTASI--YLDDPYFASDVSER 236

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           I   L N + V +WQ     +F   +
Sbjct: 237 IKEKLPN-LHVTNWQDVGNPYFRALK 261


>gi|227015816|gb|ACP17913.1| putative lipoprotein releasing system transmembrane protein LolE
           [Pseudomonas nitroreducens]
          Length = 417

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 85/265 (32%), Positives = 141/265 (53%), Gaps = 10/265 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R++ F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLSVYIGTRYTRAKRRSHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRL-DFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVR 119
           G+  H  + + Y P+ D++ IA ++    P+V++V PF+  Q     LS+GG+   VL+ 
Sbjct: 61  GMVPHATV-ESYQPIGDWRGIAGQIKQQHPNVLEVAPFIQMQGL---LSAGGTVQKVLIN 116

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
            +  ++ S +      F          G+ G++IG   A+NLG+ IGDK+  ++P   VT
Sbjct: 117 AVDPNEESKVSIIDQFFKEGSLQSLKAGEFGILIGDKAAKNLGVKIGDKVTFIAPEVSVT 176

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENA-VSGIEVFVKDPDAI 237
           P GM  R K +TV+G F +   + D  +  + + +A     L++  V G+ + + D    
Sbjct: 177 PAGMFPRMKRFTVVGTFHVGAGELDGYVAMVHIDDAARMRRLKDGQVEGLRLKLDDLFQA 236

Query: 238 EKTHENIVRIL-GNGVVVIDWQQRY 261
            +T  +I R L GN     DW + +
Sbjct: 237 PRTAWDIARTLKGNDYFARDWTRSH 261


>gi|29654316|ref|NP_820008.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Coxiella burnetii RSA 493]
 gi|154706948|ref|YP_001424419.1| lipoprotein releasing system transmembrane protein [Coxiella
           burnetii Dugway 5J108-111]
 gi|161830817|ref|YP_001596715.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Coxiella burnetii RSA 331]
 gi|212212567|ref|YP_002303503.1| lipoprotein releasing system transmembrane protein [Coxiella
           burnetii CbuG_Q212]
 gi|29541583|gb|AAO90522.1| lipoprotein releasing system transmembrane protein [Coxiella
           burnetii RSA 493]
 gi|154356234|gb|ABS77696.1| lipoprotein releasing system transmembrane protein [Coxiella
           burnetii Dugway 5J108-111]
 gi|161762684|gb|ABX78326.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Coxiella burnetii RSA 331]
 gi|212010977|gb|ACJ18358.1| lipoprotein releasing system transmembrane protein [Coxiella
           burnetii CbuG_Q212]
          Length = 414

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 135/266 (50%), Gaps = 19/266 (7%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           V  RY  + R+N FIS  S +S +G+ +GV  LI V+SVMNGF  ++      +   V +
Sbjct: 9   VGLRYTRAKRRNHFISFISLVSMLGIALGVAVLITVLSVMNGFDYEIRTHFFALAPQVTV 68

Query: 71  Q-----QKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVS--GLSSGGSGVLVRGISN 123
                 +K +P +     +N     P+V+   PFV+G   +S  G+ SG +   V G+  
Sbjct: 69  MTGQNIEKTWPELQKTIASN-----PEVVASAPFVTGMGLLSNEGIVSGAT---VLGVVP 120

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    +     +  G   +  + G   +I+G+ LA  LG+SIGDK+++ +P    TP+G+
Sbjct: 121 SQEKKVSQLDGKLVGGKLSSLNPGSYNIILGRKLADQLGLSIGDKVSLFTPQTTTTPLGI 180

Query: 183 GIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
             + + +T+ G+F  +    +D G+ Y+++Q+    F+     SG+ + +K+    +   
Sbjct: 181 FPQFRRFTISGIFSTKSGFGFDAGIAYINMQDGFRLFS--QGASGLHIKIKNLYQAQSVT 238

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
           + + ++L    +V +W +++  FF  
Sbjct: 239 QQLQKLLPGEFIVTNWTEQFGSFFKA 264


>gi|254785842|ref|YP_003073271.1| lipoprotein-releasing system, transmembrane protein, LolE
           [Teredinibacter turnerae T7901]
 gi|237686773|gb|ACR14037.1| lipoprotein-releasing system, transmembrane protein, LolE
           [Teredinibacter turnerae T7901]
          Length = 418

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 130/256 (50%), Gaps = 6/256 (2%)

Query: 14  RYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQK 73
           RY+ + R+N FIS  S  +  G+ +GV ALIVV+SVMNGF  ++ +R+L +  H  +   
Sbjct: 16  RYIRAKRRNGFISFVSLFALGGMALGVFALIVVLSVMNGFDHELKQRLLRVVPHGFLSTS 75

Query: 74  YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQ--N 131
             PL ++Q +  ++   P++    P++ GQ  +S  +     + + GI     S +   N
Sbjct: 76  -TPLHNWQALGEKIASTPELKAFAPYIEGQGLLS-YAGNVKPIQIEGIDPQYESAISIVN 133

Query: 132 SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTV 191
            F    G+++       G+++G  +AR LG++ GDK+++  P   VTP G+  R+K +T+
Sbjct: 134 QF-MLVGDMAELKPGEYGIVMGSLIARFLGVTTGDKVSVTLPQVSVTPAGIFPRAKRFTL 192

Query: 192 LGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNG 251
           +G+F       D  +  + + +A+  F    AV G+ +   D     +  +++   LG+G
Sbjct: 193 VGVFEAG-AQVDQYLTLIHIDDAKTLFRTGGAVDGLHLKFDDIYRAPEAVQSLASRLGSG 251

Query: 252 VVVIDWQQRYQIFFSC 267
            V  DW Q     F  
Sbjct: 252 YVAKDWSQTQGSLFQA 267


>gi|163784865|ref|ZP_02179640.1| hypothetical protein HG1285_04248 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879866|gb|EDP73595.1| hypothetical protein HG1285_04248 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 405

 Score =  112 bits (280), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 69/250 (27%), Positives = 129/250 (51%), Gaps = 6/250 (2%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A RYL S +  A +S  S IS IG+ +GV AL++ ++V++GF+  + +++L    H VI
Sbjct: 7   IALRYLLSLKSKA-LSFMSLISLIGITVGVSALLITLAVLSGFQFGLKEKILQTTPHAVI 65

Query: 71  QQ---KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFS 127
            +   K++   +Y+ I  +     ++    PF+  QA  S +      + +RG+      
Sbjct: 66  MKIANKFWE-DEYKEILQKFKDFSEIQGSEPFIYSQALAS-VGKNVQSIFIRGVIPEKDK 123

Query: 128 YLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSK 187
            +     R      ++    K  +IGKDLA  L + +GDKIN++SP+G  TP+G   +  
Sbjct: 124 KIMAVDKRVIAGNFDELKNPKTAVIGKDLAFILDVDVGDKINLISPFGQKTPLGYMPKIM 183

Query: 188 SYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRI 247
              V+ +      +YD+  V ++L++AQ + N+   ++G+++ +KDP   +   E + +I
Sbjct: 184 QVKVVAIVDFGMYEYDSSYVSLNLKDAQKFLNMNGQITGVQLKLKDPYQAQVVKEKLEKI 243

Query: 248 LGNGVVVIDW 257
                +V  W
Sbjct: 244 FDFPYMVRTW 253


>gi|163857076|ref|YP_001631374.1| lipoprotein releasing system permease component [Bordetella petrii
           DSM 12804]
 gi|163260804|emb|CAP43106.1| lipoprotein releasing system permease component [Bordetella petrii]
          Length = 426

 Score =  112 bits (280), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 77/262 (29%), Positives = 135/262 (51%), Gaps = 27/262 (10%)

Query: 24  FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYP------- 76
           FIS  +  S  G+ +GV ALIVV+SVMNGF++++  R+L +  H+   + Y P       
Sbjct: 30  FISFIAATSMAGIALGVAALIVVLSVMNGFQKEVRDRMLSVLPHI---ELYIPGAVPERV 86

Query: 77  LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISN------SDFSY 128
           L  ++  A+  +  P+V    PFV+ QA    L+ G +  GV VRGI        SD   
Sbjct: 87  LEQWRQFADAAERNPEVKGAAPFVAAQAM---LARGQALRGVQVRGIDPVTEGQVSDIPR 143

Query: 129 LQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKS 188
              S     G +++    G GV++G DLA  LG+ +GD + +L+P G ++P G   R + 
Sbjct: 144 QMTS-----GKLADLKPGGFGVVLGSDLADGLGVQVGDTLLMLAPQGSISPAGFTPRMRQ 198

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL 248
           +TV+G F     +YD+ + ++  ++A   F  ++  +G+ + V+D     +    + + L
Sbjct: 199 FTVVGTFTSGHYEYDSSLAFVDDEDAARVFR-DSGTAGVRLRVQDMQRAPQVAAELSKTL 257

Query: 249 GNGVVVIDWQQRYQIFFSCYES 270
              V+  DW +  + +F+  ++
Sbjct: 258 PPYVMASDWSRNNRTWFAAVQT 279


>gi|33601281|ref|NP_888841.1| lipoprotein releasing system transmembrane protein [Bordetella
           bronchiseptica RB50]
 gi|33575716|emb|CAE32794.1| lipoprotein releasing system transmembrane protein [Bordetella
           bronchiseptica RB50]
          Length = 410

 Score =  111 bits (278), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 132/256 (51%), Gaps = 15/256 (5%)

Query: 24  FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYP------- 76
           FIS  +  S  G+ +GV ALIVV+SVMNGF++++  R+L +  H+   + Y P       
Sbjct: 14  FISFIAATSMAGIALGVAALIVVLSVMNGFQKEVRDRMLSVLPHI---ELYIPGAAPERV 70

Query: 77  LVDYQFIANRLDFIPDVIKVLPFVSGQA-FVSGLSSGGSGVLVRGISNSDFSYLQNSFSR 135
           L  ++  A      P+V    PFV+ Q   V G +    GV VRGI  +    + +   +
Sbjct: 71  LQQWRQFAQAARANPEVKGEAPFVAAQGMLVRGQAL--RGVQVRGIDPATEGNVSDIPRQ 128

Query: 136 FY-GNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGM 194
              G +S+    G G ++G DLA  LG+  GD + +L+P G ++P G   R + +TV+G+
Sbjct: 129 MVSGKLSDLVAGGFGAVLGSDLADGLGVKTGDTVLMLAPQGSISPAGFAPRMRQFTVVGI 188

Query: 195 FRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVV 254
           F     +YD+ +V++  ++A   F  E+  +G+ + V D     +    + ++L   V+ 
Sbjct: 189 FSSGHYEYDSTLVFIDDEDAAKVFR-ESGTAGVRLRVADMQRAPEVAAELTKVLPPYVMA 247

Query: 255 IDWQQRYQIFFSCYES 270
            DW +  + +F+  ++
Sbjct: 248 ADWSRNNRTWFAAVQT 263


>gi|254235960|ref|ZP_04929283.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
 gi|126167891|gb|EAZ53402.1| conserved hypothetical protein [Pseudomonas aeruginosa C3719]
          Length = 433

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 131/269 (48%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RY  + R+N +IS  S  S IG+ +GV+A+I+V+SVMNGF+++M  R+L
Sbjct: 20  MFRPLPFFIGLRYTRAKRRNHYISFISLTSMIGLALGVLAMIIVLSVMNGFQKEMRTRIL 79

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     PL D+Q +AN      +V+   PF   Q  +S        VLV GI 
Sbjct: 80  GMVPHATISAA-QPLDDWQTVANAALRHREVVGAAPFAELQGMLS-YKGNMLPVLVNGID 137

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
             +   +            +D   G+ G+++G+  AR   +++GDK+ ++ P     P G
Sbjct: 138 PQEERKVSIVGEHIVQGSLDDLKSGEFGIVLGEITARRFHVNVGDKLTLIVPEATSAPGG 197

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENA-VSGIEVFVKDPDAIEKT 240
           +  R + +T++ +F++   + DN +  + + +A     L+   V  + + +KD     + 
Sbjct: 198 ITPRMQRFTIVALFKVG-AELDNSLALIDIADAGQLLRLQPGQVPSVRLELKDLYQSPQV 256

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +V+ LG G    DW +     F+  +
Sbjct: 257 AAKVVKELGQGFRSSDWTRTQGSLFNAMK 285


>gi|15598182|ref|NP_251676.1| hypothetical protein PA2986 [Pseudomonas aeruginosa PAO1]
 gi|218890815|ref|YP_002439679.1| putative lipoprotein releasing system, permease protein
           [Pseudomonas aeruginosa LESB58]
 gi|254241691|ref|ZP_04935013.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|9949086|gb|AAG06374.1|AE004724_3 conserved hypothetical protein [Pseudomonas aeruginosa PAO1]
 gi|126195069|gb|EAZ59132.1| conserved hypothetical protein [Pseudomonas aeruginosa 2192]
 gi|218771038|emb|CAW26803.1| putative lipoprotein releasing system, permease protein
           [Pseudomonas aeruginosa LESB58]
          Length = 433

 Score =  111 bits (278), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 131/269 (48%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RY  + R+N +IS  S  S IG+ +GV+A+I+V+SVMNGF+++M  R+L
Sbjct: 20  MFRPLPFFIGLRYTRAKRRNHYISFISLTSMIGLALGVLAMIIVLSVMNGFQKEMRTRIL 79

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     PL D+Q +AN      +V+   PF   Q  +S        VLV GI 
Sbjct: 80  GMVPHATISAA-QPLDDWQTVANAALRHREVVGAAPFAELQGMLS-YKGNMLPVLVNGID 137

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
             +   +            +D   G+ G+++G+  AR   +++GDK+ ++ P     P G
Sbjct: 138 PQEERKVSIVGEHIVQGSLDDLKPGEFGIVLGEITARRFHVNVGDKLTLIVPEATSAPGG 197

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENA-VSGIEVFVKDPDAIEKT 240
           +  R + +T++ +F++   + DN +  + + +A     L+   V  + + +KD     + 
Sbjct: 198 ITPRMQRFTIVALFKVGA-ELDNSLALIDIADAGQLLRLQPGQVPSVRLELKDLYQSPQV 256

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +V+ LG G    DW +     F+  +
Sbjct: 257 AAKVVKELGQGFRSSDWTRTQGSLFNAMK 285


>gi|28198273|ref|NP_778587.1| lipoprotein releasing system transmembrane protein [Xylella
           fastidiosa Temecula1]
 gi|182680910|ref|YP_001829070.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Xylella fastidiosa M23]
 gi|32129712|sp|Q87EF5|LOLC_XYLFT RecName: Full=Lipoprotein-releasing system transmembrane protein
           lolC
 gi|28056343|gb|AAO28236.1| lipoprotein releasing system transmembrane protein [Xylella
           fastidiosa Temecula1]
 gi|182631020|gb|ACB91796.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Xylella fastidiosa M23]
 gi|307579378|gb|ADN63347.1| lipoprotein releasing system transmembrane protein [Xylella
           fastidiosa subsp. fastidiosa GB514]
          Length = 413

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 132/268 (49%), Gaps = 4/268 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F+   V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFNPLSVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
            ++ H  +  +  P+ D+Q         P V    P++  +A + G        ++RGI 
Sbjct: 61  QMSAHATVSAQGAPMHDWQHAVALAMTDPRVAGAAPYIESEALLQG--ERHQPAMMRGIV 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +  + +     +      +    G+  +++GK+LA  LG+ +GD + +L      TP+G
Sbjct: 119 PNQETKVSVLAQKLKVGSIDSLKPGEYNILLGKELALWLGVDVGDSVIVLLSQTQTTPVG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R K +TV G+F + + + D G+  +++++ Q    ++  V+G+ + + D D      
Sbjct: 179 TMPRMKRFTVSGLFEVGYNEIDRGLAVVNMEDMQKIMRMDG-VTGVRLKLHDMDHAWDVA 237

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            ++   L    +V DW +     +S  +
Sbjct: 238 SDLAVRLNGPYLVSDWTRENANLYSSLK 265


>gi|66045147|ref|YP_234988.1| hypothetical protein Psyr_1906 [Pseudomonas syringae pv. syringae
           B728a]
 gi|63255854|gb|AAY36950.1| Protein of unknown function DUF214 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330973218|gb|EGH73284.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 414

 Score =  111 bits (278), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 83/274 (30%), Positives = 138/274 (50%), Gaps = 15/274 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H VI     P+ D++ +A+     P+V   +PF   +     LS  GS   + + G
Sbjct: 61  GMVPHAVIAGS-TPVDDWKPLADAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQISG 116

Query: 121 ISNS---DFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGD 176
           +  +   + S +    +R  GN+  D   G+ GV++G   AR   +SIGDK+ ++ P   
Sbjct: 117 VDPALEHEVSIVTQHITR--GNL-EDLKPGEFGVVLGDITARRFRLSIGDKLTLIVPEVS 173

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPD 235
             P G+  R +  TV+G+F++   + D  M  +++ + AQ+     N V G+ + +KD  
Sbjct: 174 SAPGGITPRMQRLTVVGIFKVG-AELDGSMGLINIADAAQMQRWQPNQVQGVRLALKDLY 232

Query: 236 AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +    I   LG G    DW       FS  +
Sbjct: 233 KAPQVSTAIAAGLGEGYRADDWTHTQGSLFSAMK 266


>gi|298368788|ref|ZP_06980106.1| lipoprotein-releasing system transmembrane protein LolC [Neisseria
           sp. oral taxon 014 str. F0314]
 gi|298282791|gb|EFI24278.1| lipoprotein-releasing system transmembrane protein LolC [Neisseria
           sp. oral taxon 014 str. F0314]
          Length = 416

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 79/272 (29%), Positives = 136/272 (50%), Gaps = 12/272 (4%)

Query: 5   SRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGI 64
           +  E  +  RYL + ++N F+S  + +S  G+ +GVMALIVV+SVMNGF++++  ++L +
Sbjct: 2   ASLETWIGLRYLRAKKRNGFMSFITMVSIAGIALGVMALIVVLSVMNGFQKEIRGQLLNV 61

Query: 65  NGHVVIQQKYYPLVDYQFIANRLDFIP---DVIKVLPFVSGQAFVSGLSSGGS--GVLVR 119
             H  I   YY     +   N   F+    +V+   P+VS QA    L++ G   GV +R
Sbjct: 62  APHAEI--GYYDNGGGENWQNLRQFVKGKKEVLASAPYVSDQAL---LANAGEVRGVQIR 116

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
           GI   +   + +          ND   G   +I+G+ LA  LG   G K+ +++P G+VT
Sbjct: 117 GILPDEEKNVVDYGDNMPSGSFNDLKPGGFDIILGEGLAEALGTEKGGKVTVITPEGNVT 176

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + V+G+ +    + DN +    +++AQ+ + L   V G+ + +  P    
Sbjct: 177 PAGVVPRLKQFNVVGIVKTGVYEVDNSLALTHIKDAQVLYRLGENVGGLRLKLAHPQNAP 236

Query: 239 KTHENIVRI-LGNGVVVIDWQQRYQIFFSCYE 269
               N++     + V V DW    + +F   E
Sbjct: 237 DFIANLIPAGQQDKVWVRDWTFNNRSYFEAVE 268


>gi|146282982|ref|YP_001173135.1| lipoprotein releasing system, permease protein [Pseudomonas
           stutzeri A1501]
 gi|145571187|gb|ABP80293.1| lipoprotein releasing system, permease protein [Pseudomonas
           stutzeri A1501]
          Length = 431

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 75/262 (28%), Positives = 128/262 (48%), Gaps = 4/262 (1%)

Query: 2   SIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRV 61
           S+F    V +  RY  + R++ F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RV
Sbjct: 16  SMFRPLSVYIGARYTRARRRSLFVSFISLTSMIGLALGVLVMIVVLSVMNGFDHEMRTRV 75

Query: 62  LGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
           LG+  H  I+    P+ D+Q +  RL+    V+   PF+  Q  ++      + +L+  +
Sbjct: 76  LGMVPHATIESP-TPINDWQALGARLEQHAQVLASAPFIQSQGLLTH-QGQVTKILINAV 133

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
                  +      F     +D   G+ G++IG   A  LG+++GDKI  ++P   VTP 
Sbjct: 134 EPQAERQVSIIDQFFREGALDDLKPGEFGIVIGDKAAAKLGVAVGDKITFVAPEVTVTPA 193

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEK 239
           GM  R K +TV G+F +   + D  +   ++ + A+L     + V G+ +   D     +
Sbjct: 194 GMFPRMKRFTVTGIFHVGAGEIDGYVALANIADMARLQRWQPDQVQGLRLRFADLFQAPR 253

Query: 240 THENIVRILGNGVVVIDWQQRY 261
               +   LG+     DW + +
Sbjct: 254 IAWELAGQLGDDFYSRDWTRTH 275


>gi|107102535|ref|ZP_01366453.1| hypothetical protein PaerPA_01003599 [Pseudomonas aeruginosa PACS2]
          Length = 414

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 131/269 (48%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RY  + R+N +IS  S  S IG+ +GV+A+I+V+SVMNGF+++M  R+L
Sbjct: 1   MFRPLPFFIGLRYTRAKRRNHYISFISLTSMIGLALGVLAMIIVLSVMNGFQKEMRTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     PL D+Q +AN      +V+   PF   Q  +S        VLV GI 
Sbjct: 61  GMVPHATISAA-QPLDDWQTVANAALRHREVVGAAPFAELQGMLS-YKGNMLPVLVNGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
             +   +            +D   G+ G+++G+  AR   +++GDK+ ++ P     P G
Sbjct: 119 PQEERKVSIVGEHIVQGSLDDLKPGEFGIVLGEITARRFHVNVGDKLTLIVPEATSAPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEKT 240
           +  R + +T++ +F++   + DN +  + + +A     L+   V  + + +KD     + 
Sbjct: 179 ITPRMQRFTIVALFKVG-AELDNSLALIDIADAGQLLRLQPGQVPSVRLELKDLYQSPQV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +V+ LG G    DW +     F+  +
Sbjct: 238 AAKVVKELGQGFRSSDWTRTQGSLFNAMK 266


>gi|116050988|ref|YP_790187.1| hypothetical protein PA14_25450 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|115586209|gb|ABJ12224.1| putative lipoprotein releasing system, permease protein
           [Pseudomonas aeruginosa UCBPP-PA14]
          Length = 433

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 131/269 (48%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RY  + R+N +IS  S  S IG+ +GV+A+I+V+SVMNGF+++M  R+L
Sbjct: 20  MFRPLPFFIGLRYTRAKRRNHYISFISLTSMIGLALGVLAMIIVLSVMNGFQKEMRTRIL 79

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     PL D+Q +AN      +V+   PF   Q  +S        VLV GI 
Sbjct: 80  GMVPHATISAT-QPLDDWQTVANAALRHREVVGAAPFAELQGMLS-YKGNMLPVLVNGID 137

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
             +   +            +D   G+ G+++G+  AR   +++GDK+ ++ P     P G
Sbjct: 138 PQEERKVSIIGEHIVQGSLDDLKPGEFGIVLGEITARRFHVNVGDKLTLIVPEATSAPGG 197

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENA-VSGIEVFVKDPDAIEKT 240
           +  R + +T++ +F++   + DN +  + + +A     L+   V  + + +KD     + 
Sbjct: 198 ITPRMQRFTIVALFKVGA-ELDNSLALIDIADAGQLLRLQPGQVPSVRLELKDLYQSPQV 256

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +V+ LG G    DW +     F+  +
Sbjct: 257 AAKVVKELGQGFRSSDWTRTQGSLFNAMK 285


>gi|330897610|gb|EGH29029.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. japonica str. M301072PT]
          Length = 414

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 137/273 (50%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A+     P+V   +PF   +     LS  GS   ++ IS
Sbjct: 61  GMVPHAVIAGN-TPVDDWKPLADAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 115

Query: 123 NSDFSYLQNSFSRFYGNVS----NDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D   L++  S    +++     D   G+ GV++G   AR   +SIGDK+ ++ P    
Sbjct: 116 GVD-PALEHEVSIVTQHITRGSLEDLKPGEFGVVLGDITARRFRLSIGDKLTLIVPEVSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +  TV+G+F++    D   G+++++   AQ+     N V G+ + +KD   
Sbjct: 175 APGGITPRMQRLTVVGIFKVGAELDGSMGLIHIA-DAAQMQRWQPNQVQGVRLALKDLYK 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG G    DW       FS  +
Sbjct: 234 APQVSTAIAASLGEGYRADDWTHTQGSLFSAMK 266


>gi|153206738|ref|ZP_01945579.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Coxiella burnetii 'MSU Goat Q177']
 gi|165918572|ref|ZP_02218658.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Coxiella burnetii RSA 334]
 gi|212218438|ref|YP_002305225.1| lipoprotein releasing system transmembrane protein [Coxiella
           burnetii CbuK_Q154]
 gi|120577101|gb|EAX33725.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Coxiella burnetii 'MSU Goat Q177']
 gi|165917700|gb|EDR36304.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Coxiella burnetii RSA 334]
 gi|212012700|gb|ACJ20080.1| lipoprotein releasing system transmembrane protein [Coxiella
           burnetii CbuK_Q154]
          Length = 414

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/266 (27%), Positives = 134/266 (50%), Gaps = 19/266 (7%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           V  RY    R+N FIS  S +S +G+ +GV  LI V+SVMNGF  ++      +   V +
Sbjct: 9   VGLRYTRVKRRNHFISFISLVSMLGIALGVAVLITVLSVMNGFDYEIRTHFFALAPQVTV 68

Query: 71  Q-----QKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVS--GLSSGGSGVLVRGISN 123
                 +K +P +     +N     P+V+   PFV+G   +S  G+ SG +   V G+  
Sbjct: 69  MTGQNIEKTWPELQKTIASN-----PEVVASAPFVTGMGLLSNEGIVSGAT---VLGVVP 120

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           S    +     +  G   +  + G   +I+G+ LA  LG+SIGDK+++ +P    TP+G+
Sbjct: 121 SQEKKVSQLDGKLVGGKLSSLNPGSYNIILGRKLADQLGLSIGDKVSLFTPQTTTTPLGI 180

Query: 183 GIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
             + + +T+ G+F  +    +D G+ Y+++Q+    F+     SG+ + +K+    +   
Sbjct: 181 FPQFRRFTISGIFSTKSGFGFDAGIAYINMQDGFRLFS--QGASGLHIKIKNLYQAQSVT 238

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
           + + ++L    +V +W +++  FF  
Sbjct: 239 QQLQKLLPGEFIVTNWTEQFGSFFKA 264


>gi|157961371|ref|YP_001501405.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Shewanella pealeana ATCC 700345]
 gi|157846371|gb|ABV86870.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella pealeana ATCC 700345]
          Length = 407

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 86/265 (32%), Positives = 126/265 (47%), Gaps = 12/265 (4%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           + +RY  S + NAF S  +  S  G+++GV ALIVV SVMNG    + +R+LG    + +
Sbjct: 9   IGYRYWRSRKANAFASFITIFSVSGILLGVAALIVVSSVMNGLENQLKQRILGAVPQLTV 68

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQ 130
             +   + ++     +L  +P V    P +S QA V   S+ G+   V GI       L 
Sbjct: 69  HSQ-TAIENWPSQVEKLSQLPGVQGATPSISTQAMVQSPSNIGAA-QVYGIYPEQEKTLL 126

Query: 131 NSFSRFYGNVSNDFD---RGK-GVIIGKDLARNLGISIGDKINILSPYGDV-TPMGMGIR 185
           N+  R Y   S DFD    GK  VI+G +LAR L ++ GDKI ILS  G V TP+G    
Sbjct: 127 NTTKRVY---SGDFDALESGKYRVILGAELARTLDVAPGDKIRILSGDGVVYTPLGPVPS 183

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDPDAIEKTHENI 244
            + +TV G+F M     D  + Y+   +AQ L       V  + +++ DP    K    +
Sbjct: 184 QRKFTVAGVFEMG-SQVDATLAYVHHDDAQRLMRQKAGEVKELRLYLDDPFNAAKMAPEV 242

Query: 245 VRILGNGVVVIDWQQRYQIFFSCYE 269
           V      V   DW+  Y   F   +
Sbjct: 243 VAQFATPVTTTDWRDTYGHLFGAVK 267


>gi|262278133|ref|ZP_06055918.1| outer membrane lipoproteins ABC transporter membrane protein
           [Acinetobacter calcoaceticus RUH2202]
 gi|262258484|gb|EEY77217.1| outer membrane lipoproteins ABC transporter membrane protein
           [Acinetobacter calcoaceticus RUH2202]
          Length = 411

 Score =  111 bits (277), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 134/271 (49%), Gaps = 10/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  + +S +G+ +GV  LI V+SVMNGF  ++  RVL
Sbjct: 1   MFKPISLYIGLRYTRARRSNHFISFIALVSMVGLTLGVAVLITVLSVMNGFDRELKNRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+     +      L D+  +  R++  P V  V PF   Q  ++      +G++V GI 
Sbjct: 61  GMVPQATVSSTQI-LTDWPELVKRVEHHPHVTGVAPFTQLQGMLTA-QGQVAGIMVTGID 118

Query: 123 ---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
                + S +QN          +   +G+ G+++GKD+A +LG+ + D + ++ P    +
Sbjct: 119 PKYEKNVSIIQN---HIVAGSLDSLKKGEFGIVLGKDMADSLGLRLNDSVTLVLPEATPS 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + V+G+F +   + D+ + Y++L +A     L +   G+ + + D  A  
Sbjct: 176 PAGVVPRFKRFKVVGIFSVG-AEVDSMVGYIALYDASTLLRLPDGAQGVRLKLDDIFAAP 234

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           K  +++V+ L +     +W   +   F+  +
Sbjct: 235 KVADDLVKSLPSNFYATNWTYTHGNLFNAIQ 265


>gi|313108275|ref|ZP_07794307.1| putative lipoprotein releasing system, permease protein
           [Pseudomonas aeruginosa 39016]
 gi|310880809|gb|EFQ39403.1| putative lipoprotein releasing system, permease protein
           [Pseudomonas aeruginosa 39016]
          Length = 414

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 131/269 (48%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RY  + R+N +IS  S  S IG+ +GV+A+I+V+SVMNGF+++M  R+L
Sbjct: 1   MFRPLPFFIGLRYTRAKRRNHYISFISLTSMIGLALGVLAMIIVLSVMNGFQKEMRTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     PL D+Q +AN      +V+   PF   Q  +S        VLV GI 
Sbjct: 61  GMVPHATISAT-QPLDDWQTVANAALRHREVVGAAPFAELQGMLS-YKGNMLPVLVNGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
             +   +            +D   G+ G+++G+  AR   +++GDK+ ++ P     P G
Sbjct: 119 PQEERKVSIIGEHIVQGSLDDLKPGEFGIVLGEITARRFHVNVGDKLTLIVPEATSAPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEKT 240
           +  R + +T++ +F++   + DN +  + + +A     L+   V  + + +KD     + 
Sbjct: 179 ITPRMQRFTIVALFKVG-AELDNSLALIDIADAGQLLRLQPGQVPSVRLELKDLYQSPQV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +V+ LG G    DW +     F+  +
Sbjct: 238 AAKVVKELGQGFRSSDWTRAQGSLFNAMK 266


>gi|298486426|ref|ZP_07004487.1| Lipoprotein releasing system transmembrane protein lolC
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298159054|gb|EFI00114.1| Lipoprotein releasing system transmembrane protein lolC
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 378

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 139/273 (50%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A+     P+V   +PF   +     LS  GS   ++ IS
Sbjct: 61  GMVPHAVI-AGATPVDDWKPLADAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 115

Query: 123 NSDFSYLQNSFSRFYGNVS----NDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D + L++  S    +++     D   G+ GV++G   AR   +SIGDK+ ++ P    
Sbjct: 116 GVDPA-LEHEVSIVTQHITRGSLEDLKPGEFGVVLGDITARRFRLSIGDKLTLIVPEVSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +  TV+G+F++   + D  M  +++ + AQ+     N V G+ + +KD   
Sbjct: 175 APGGITPRLQRLTVVGIFKV-GAELDGSMGLINIADAAQMQRWQPNQVQGVRLALKDLYK 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG+G    DW       FS  +
Sbjct: 234 APQVSTAIAAGLGDGYRADDWTHTQGSLFSAMK 266


>gi|225851267|ref|YP_002731501.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Persephonella marina EX-H1]
 gi|225646531|gb|ACO04717.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Persephonella marina EX-H1]
          Length = 404

 Score =  110 bits (276), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 72/225 (32%), Positives = 124/225 (55%), Gaps = 3/225 (1%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A RYL S +  A +S  + IS +G+++GV AL++ ++VM+GF   + K++L  + H+VI
Sbjct: 7   IAIRYLMSLKTKA-LSFMTVISLLGIVVGVAALLITLAVMSGFLWGIKKKILETSPHIVI 65

Query: 71  QQKYYPLVDY-QFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYL 129
            +      +Y +F    L  I +++   PFV  QA  S  S+  S V VRG+       +
Sbjct: 66  FKISGNFTEYREFPEKYLKGISEIVDYQPFVYSQALASKDSTVIS-VTVRGVPPEKDRRI 124

Query: 130 QNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSY 189
                +      +     + VIIGKD+A  L + IGD I + SP+G  TP+G   + K  
Sbjct: 125 LGIDKKIIAGSYDSIKDDRNVIIGKDVALALNVWIGDSITLTSPFGRKTPLGYIPKVKKV 184

Query: 190 TVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP 234
            V G+      +YD+  + M+L+ AQ +F+++++V+GI++ + DP
Sbjct: 185 YVGGIIDFGMYEYDSTYIGMNLESAQRFFDMKDSVTGIQLKIDDP 229


>gi|296388521|ref|ZP_06877996.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas aeruginosa PAb1]
          Length = 414

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 131/269 (48%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RY  + R+N +IS  S  S IG+ +GV+A+I+V+SVMNGF+++M  R+L
Sbjct: 1   MFRPLPFFIGLRYTRAKRRNHYISFISLTSMIGLALGVLAMIIVLSVMNGFQKEMRTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     PL D+Q +AN      +V+   PF   Q  +S        VLV GI 
Sbjct: 61  GMVPHATISAT-QPLDDWQTVANAALRHREVVGAAPFAELQGMLS-YKGNMLPVLVNGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
             +   +            +D   G+ G+++G+  AR   +++GDK+ ++ P     P G
Sbjct: 119 PQEERKVSIIGEHIVQGSLDDLKPGEFGIVLGEITARRFHVNVGDKLTLIVPEATSAPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENA-VSGIEVFVKDPDAIEKT 240
           +  R + +T++ +F++   + DN +  + + +A     L+   V  + + +KD     + 
Sbjct: 179 VTPRMQRFTIVALFKVG-AELDNSLALIDIADAGQLLRLQPGQVPSVRLELKDLYQSPQV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +V+ LG G    DW +     F+  +
Sbjct: 238 AAKVVKELGQGFRSSDWTRTQGSLFNAMK 266


>gi|71899423|ref|ZP_00681582.1| Protein of unknown function DUF214 [Xylella fastidiosa Ann-1]
 gi|71730832|gb|EAO32904.1| Protein of unknown function DUF214 [Xylella fastidiosa Ann-1]
          Length = 413

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 131/268 (48%), Gaps = 4/268 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F+   V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFNPLSVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
            +  H  +  +  P+ D+Q         P V    P++  +A + G        ++RGI 
Sbjct: 61  QMAAHATVSAQGAPMHDWQHAVALAMTDPRVAGAAPYIESEALLQG--ERHQPAMMRGIV 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +  + +     +      +    G+  +++GK+LA  LG+ +GD + +L      TP+G
Sbjct: 119 PNQETKVSVLAQKLKVGSIDSLKPGEYNILLGKELALWLGVDVGDSVIVLLSQTQTTPVG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R K +TV G+F + + + D G+  +++++ Q    ++  V+G+ + + D D      
Sbjct: 179 TMPRMKRFTVSGLFEVGYNEIDRGLAVVNMEDMQKIMRMDG-VTGVRLKLHDMDHAWDVA 237

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            ++   L    +V DW +     +S  +
Sbjct: 238 SDLAVRLNGPYLVSDWTRENANLYSSLK 265


>gi|71275597|ref|ZP_00651882.1| Protein of unknown function DUF214 [Xylella fastidiosa Dixon]
 gi|71899494|ref|ZP_00681651.1| Protein of unknown function DUF214 [Xylella fastidiosa Ann-1]
 gi|170729595|ref|YP_001775028.1| lipoprotein releasing system transmembrane protein [Xylella
           fastidiosa M12]
 gi|71163488|gb|EAO13205.1| Protein of unknown function DUF214 [Xylella fastidiosa Dixon]
 gi|71730714|gb|EAO32788.1| Protein of unknown function DUF214 [Xylella fastidiosa Ann-1]
 gi|167964388|gb|ACA11398.1| lipoprotein releasing system transmembrane protein [Xylella
           fastidiosa M12]
          Length = 413

 Score =  110 bits (276), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 131/268 (48%), Gaps = 4/268 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F+   V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFNPLSVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
            +  H  +  +  P+ D+Q         P V    P++  +A + G        ++RGI 
Sbjct: 61  QMAAHATVSAQGAPMHDWQHAVALAMTDPRVAGAAPYIESEALLQG--ERHQPAMMRGIV 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +  + +     +      +    G+  +++GK+LA  LG+ +GD + +L      TP+G
Sbjct: 119 PNQEAKVSVLAQKLKVGSIDSLKPGEYNILLGKELALWLGVDVGDSVIVLLSQTQTTPVG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R K +TV G+F + + + D G+  +++++ Q    ++  V+G+ + + D D      
Sbjct: 179 TMPRMKRFTVSGLFEVGYNEIDRGLAVVNMEDMQKIMRMDG-VTGVRLKLHDMDHAWDVA 237

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            ++   L    +V DW +     +S  +
Sbjct: 238 SDLAVRLNGPYLVSDWTRENANLYSSLK 265


>gi|114569926|ref|YP_756606.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Maricaulis maris MCS10]
 gi|114340388|gb|ABI65668.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Maricaulis maris MCS10]
          Length = 443

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 74/279 (26%), Positives = 139/279 (49%), Gaps = 15/279 (5%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FS +E ++A+RYL S RK+  +++ ++ISF G+ + V  LI VMS+MNGFR ++  ++LG
Sbjct: 19  FSPYEFLLAFRYLRSRRKHGGVALIAWISFGGIALAVTGLIAVMSIMNGFRAELFSQLLG 78

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
              HV +  +  P  D   +   ++ +  V    P +SGQ   +      + + V  +  
Sbjct: 79  FQPHVYVDTREMPADDVDRLLLEIEAMTGVTSADPVISGQVMATS-DRYETFLQVLAVRP 137

Query: 124 SDFSYL------QNSFSR---FYGNVSNDFDRGKG----VIIGKDLARNLGISIGDKINI 170
            D + +      ++  SR    +G++S +F  G+     +++G  +AR LG+++GD++  
Sbjct: 138 QDLAEMDVIRSGEDPRSRTGLTHGDLS-EFGTGRNGGDVIVLGTGVARRLGVNVGDRVTF 196

Query: 171 LSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVF 230
           LS     +  G   + K+Y V  +        D+ + YM L++ QL+F   + V  I+V 
Sbjct: 197 LSARAAPSAFGARPQQKAYYVGAILAAGVSTIDDSLAYMPLEQGQLFFVRGDDVDLIQVR 256

Query: 231 VKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           + D +      + +  I G    V D+ +    FF+  +
Sbjct: 257 LDDAEQAPLYVDPVRAIAGPNAAVYDYTRLDPAFFNALQ 295


>gi|93005617|ref|YP_580054.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Psychrobacter cryohalolentis K5]
 gi|92393295|gb|ABE74570.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Psychrobacter cryohalolentis K5]
          Length = 411

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 126/237 (53%), Gaps = 14/237 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  S IS IG+ +GV  LI V+SVMNGF  ++  R+L
Sbjct: 1   MFRPLALFIGLRYTRAERSNGFISFISLISMIGLTLGVAVLITVLSVMNGFDRELKTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRG 120
           G+     +      + D++ +A+++   P+V+ V PF+  Q     L+S G  +G++V G
Sbjct: 61  GMVPQATVTSTEI-IGDWKQVADKIKEDPEVVAVAPFIQLQGM---LTSNGQVAGIMVTG 116

Query: 121 ISNSDFSYLQN----SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           +   D  Y +N    +     GN+    +   G+++G+ + ++LG+ +GDK+ ++ P   
Sbjct: 117 V---DPEYEKNVSIINEHMVEGNIDTLKNGEFGIVLGEGMVQSLGLQLGDKVTLVLPEAS 173

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
            +P G+  R K +T+ G+F +  P+ D+ M ++ + +A     L     GI + + D
Sbjct: 174 PSPAGVIPRFKRFTLTGIFSIS-PEVDSLMAFIPMGDAAKLLRLPEGAQGIRMKLHD 229


>gi|307611128|emb|CBX00772.1| hypothetical protein LPW_24761 [Legionella pneumophila 130b]
          Length = 385

 Score =  110 bits (275), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 34  IGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDV 93
           +G+ +GVM LI V+SVMNGF +++ +R  G+   + I      L D+  +  +++ IP +
Sbjct: 2   LGIGMGVMVLITVLSVMNGFDQEIHRRFFGMAPEITITGPDERLSDWPEVVKKVETIPGI 61

Query: 94  IKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIG 153
             + P+V  Q  ++        VL   +   + S    +     GN+ N   +  G+I+G
Sbjct: 62  KAIAPYVGSQGLLTHEGQVLPIVLTGILPEKEQSVTHLNKKLLAGNMDNL--KHFGIILG 119

Query: 154 KDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQ 212
           K LA +LG+ IGDK+ I+ P   VTP GM  R K +TV+G+F      ++D  + +++++
Sbjct: 120 KGLADSLGVMIGDKVTIMIPQATVTPAGMIPRFKRFTVVGVFSAGTGFNFDTKLAFINIE 179

Query: 213 EAQLYFNLE-NAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +AQ    ++ N VSGI++ + +     +    +  +LG G  V +W Q++  FF   +
Sbjct: 180 DAQKLMQMDKNDVSGIKMKINNVYKAPELSYELSDLLGEGYQVGNWTQQFGAFFEAVK 237


>gi|302184821|ref|ZP_07261494.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. syringae 642]
          Length = 414

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 138/273 (50%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A+     P+V   +PF   +     LS  GS   ++ IS
Sbjct: 61  GMVPHAVI-AGTTPVDDWKPLADAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 115

Query: 123 NSDFSYLQNSFSRFYGNVS----NDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D   L++  S    +++     D   G+ GV++G   AR   +SIGDK+ ++ P    
Sbjct: 116 GVD-PALEHEVSIVTQHITRGSLEDLKPGEFGVVLGDITARRFRLSIGDKLTLIVPEVSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +  TV+G+F++   + D  M  +++ + AQ+     N V G+ + +KD   
Sbjct: 175 APGGITPRLQRLTVVGIFKVG-AELDGSMGLINIADAAQMQRWQPNQVQGVRLALKDLYK 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG+G    DW       FS  +
Sbjct: 234 APQVSTAIAAGLGDGYRADDWTHTQGSLFSAMK 266


>gi|148767664|gb|ABR10824.1| lipoprotein releasing system transmembrane protein [Bartonella
           silvicola]
          Length = 150

 Score =  110 bits (274), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 64/150 (42%), Positives = 87/150 (58%)

Query: 17  FSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYP 76
             N+K+ F SI S IS  G+M+GV AL+VVM+VMNGFR +++ R+LG+NGH+V+Q     
Sbjct: 1   LPNKKHIFTSIISIISLTGIMLGVFALVVVMAVMNGFRTELLNRILGMNGHLVVQAISSD 60

Query: 77  LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRF 136
             +Y  + + L+ I  V   LP V GQA V G   GG+G LVRG+   D   L+      
Sbjct: 61  FSNYNSLISYLESINGVKFALPIVEGQALVQGNIGGGTGALVRGMRKRDLEKLETVSKNI 120

Query: 137 YGNVSNDFDRGKGVIIGKDLARNLGISIGD 166
                  FD+ +GV IG  LA  LG+ IG 
Sbjct: 121 KSGTLAQFDKEEGVAIGIGLAEKLGLRIGS 150


>gi|296107876|ref|YP_003619577.1| lipoprotein-releasing system permease protein [Legionella
           pneumophila 2300/99 Alcoy]
 gi|295649778|gb|ADG25625.1| lipoprotein-releasing system permease protein [Legionella
           pneumophila 2300/99 Alcoy]
          Length = 385

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 70/238 (29%), Positives = 126/238 (52%), Gaps = 4/238 (1%)

Query: 34  IGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDV 93
           +G+ +GVM LI V+SVMNGF +++ +R  G+   + I      L D+  +  +++ IP +
Sbjct: 2   LGIGMGVMVLITVLSVMNGFDQEIHRRFFGMAPEITITGPDERLSDWPEVVKKVETIPGI 61

Query: 94  IKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIG 153
             + P+V  Q  ++        VL   +   + S    +     GN+ N   +  G+I+G
Sbjct: 62  KAIAPYVGSQGLLTHEGQVLPIVLTGILPEKEQSVTHLNKKLLAGNMDNL--KHFGIILG 119

Query: 154 KDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQ 212
           K LA +LG+ IGDK+ I+ P   VTP GM  R K +TV+G+F      ++D  + +++++
Sbjct: 120 KGLADSLGVMIGDKVTIMIPQATVTPAGMIPRFKRFTVVGVFSAGTGFNFDTKLAFINIE 179

Query: 213 EAQLYFNLE-NAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +AQ    ++ N VSGI++ + +     +    +  +LG G  V +W Q++  FF   +
Sbjct: 180 DAQKLMQMDKNDVSGIKMKINNVYKAPELSYELSDLLGEGYQVGNWTQQFGAFFEAVK 237


>gi|289679734|ref|ZP_06500624.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. syringae FF5]
          Length = 414

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 137/273 (50%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A+     P+V   +PF   +     LS  GS   ++ IS
Sbjct: 61  GMVPHAVIAGN-TPVDDWKPLADAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 115

Query: 123 NSDFSYLQNSFSRFYGNVS----NDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D   L++  S    +++     D   G+ GV++G   AR   +SIGDK+ ++ P    
Sbjct: 116 GVD-PALEHEVSIVTQHITRGSLEDLKPGEFGVVLGDITARRFRLSIGDKLTLIVPEVSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +  TV+G+F++   + D  M  +++ + AQ+     N V G+ + +KD   
Sbjct: 175 APGGITPRMQRLTVVGIFKVG-AELDGSMGLINIADAAQMQRWQPNQVQGVRLALKDLYK 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG G    DW       FS  +
Sbjct: 234 APQVSTAIAAGLGEGYRADDWTHTQGSLFSAMK 266


>gi|15837678|ref|NP_298366.1| hypothetical protein XF1076 [Xylella fastidiosa 9a5c]
 gi|10720069|sp|Q9PEF2|LOLC_XYLFA RecName: Full=Lipoprotein-releasing system transmembrane protein
           lolC
 gi|9106026|gb|AAF83886.1|AE003944_3 conserved hypothetical protein [Xylella fastidiosa 9a5c]
          Length = 413

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 66/268 (24%), Positives = 130/268 (48%), Gaps = 4/268 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F+   V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFNPLSVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
            +  H  +  +  P+ D+Q         P V    P++  +A + G        ++RGI 
Sbjct: 61  QMAAHATVSAQGAPMHDWQHAVALAMTDPRVAGAAPYIESEALLQG--ERHQPAMMRGIV 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +    +     +      +    G+  +++GK+LA  LG+ +GD + +L      TP+G
Sbjct: 119 PNQEDKVSVLAQKLKVGSIDSLKPGEYNILLGKELALWLGVDVGDSVIVLLSQTQTTPVG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R K +TV G+F + + + D G+  +++++ Q    ++  V+G+ + + D D      
Sbjct: 179 TMPRMKRFTVSGLFEVGYNEIDRGLAVVNMEDMQKVMRMDG-VTGVRLKLHDMDHAWDVA 237

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            ++   L    +V DW +     +S  +
Sbjct: 238 RDLAVRLNGPYLVSDWTRENANLYSSLK 265


>gi|71065341|ref|YP_264068.1| ABC lipoprotein exporter, inner membrane subunit, LolE
           [Psychrobacter arcticus 273-4]
 gi|71038326|gb|AAZ18634.1| ABC lipoprotein exporter, inner membrane subunit, LolE
           [Psychrobacter arcticus 273-4]
          Length = 411

 Score =  110 bits (274), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 69/237 (29%), Positives = 126/237 (53%), Gaps = 14/237 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  S IS IG+ +GV  LI V+SVMNGF  ++  R+L
Sbjct: 1   MFRPLALFIGLRYTRAERSNGFISFISLISMIGLTLGVAVLITVLSVMNGFDRELKTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRG 120
           G+     +      + D++ +A+++   P+V+ V PF+  Q     L+S G  +G++V G
Sbjct: 61  GMVPQATVTSTEI-IGDWKQLADKIKEDPEVVAVAPFIQLQGM---LTSNGQVAGIMVTG 116

Query: 121 ISNSDFSYLQN----SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           +   D  Y +N    +     GN+    +   G+++G+ + ++LG+ +GDK+ ++ P   
Sbjct: 117 V---DPEYEKNVSIINEHMVEGNIDTLKNGEFGIVLGEGMVQSLGLQLGDKVTLVLPEAS 173

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
            +P G+  R K +T+ G+F +  P+ D+ M ++ + +A     L     GI + + D
Sbjct: 174 PSPAGVIPRFKRFTLTGIFSIS-PEVDSLMAFIPMGDAAKLLRLPEGAQGIRMKLND 229


>gi|134302513|ref|YP_001122483.1| LolC/E family lipoprotein releasing system ABC transporter
           transmembrane protein [Francisella tularensis subsp.
           tularensis WY96-3418]
 gi|134050290|gb|ABO47361.1| lipoprotein releasing system, ABC transporter, transmembrane
           protein, LolC/E family [Francisella tularensis subsp.
           tularensis WY96-3418]
          Length = 420

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 130/237 (54%), Gaps = 8/237 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY+ + ++N FISI S ISF+G+ +GV  LI VMSVMNGF + +  ++L
Sbjct: 1   MFKSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITVMSVMNGFDQQIKSKIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLD-FIPDVIKVLPFVSGQAFVSGLSSGGSG---VLV 118
            +   + + Q    + D+  +A  ++   P V  V P V  Q  +S  +SG S    V +
Sbjct: 61  MMVPPLKVYQLGGEVTDWPNLAKEVEKSTPSVTAVAPIVESQGLLSA-NSGSSTTAFVQI 119

Query: 119 RGISNS-DFSYLQNSFSRFYGNVSN-DFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           +GI        L  +     G +S+ D ++G  +++G  LA NLG+ +GDK+ ++ P   
Sbjct: 120 QGIEPKYQTKVLPIAEHIVDGKLSSLDDNQGYNIVLGSVLADNLGVKVGDKVTLIVPKIS 179

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           +TP GM  R K + V G+F + +  YD     +++++AQ  F   N+VS +++ VK+
Sbjct: 180 LTPAGMIPRIKQFRVSGIFSVSY-QYDAYYAMINIKDAQKVFETGNSVSSLQLSVKN 235


>gi|56707553|ref|YP_169449.1| lipoprotein releasing system, subunit C,putative membrane protein
           [Francisella tularensis subsp. tularensis SCHU S4]
 gi|110670024|ref|YP_666581.1| lipoprotein releasing system, subunit C,putative membrane protein
           [Francisella tularensis subsp. tularensis FSC198]
 gi|115314372|ref|YP_763095.1| lipoprotein ABC transporter ATP-binding protein [Francisella
           tularensis subsp. holarctica OSU18]
 gi|167009649|ref|ZP_02274580.1| lipoprotein releasing system, subunit C,putative membrane protein
           [Francisella tularensis subsp. holarctica FSC200]
 gi|224456621|ref|ZP_03665094.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Francisella tularensis subsp. tularensis MA00-2987]
 gi|290953374|ref|ZP_06557995.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Francisella tularensis subsp. holarctica URFT1]
 gi|295313378|ref|ZP_06803986.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Francisella tularensis subsp. holarctica URFT1]
 gi|54112849|gb|AAV29058.1| NT02FT1680 [synthetic construct]
 gi|56604045|emb|CAG45037.1| lipoprotein releasing system, subunit C,putative membrane protein
           [Francisella tularensis subsp. tularensis SCHU S4]
 gi|110320357|emb|CAL08420.1| lipoprotein releasing system, subunit C,putative membrane protein
           [Francisella tularensis subsp. tularensis FSC198]
 gi|115129271|gb|ABI82458.1| lipoprotein ABC superfamily ATP binding cassette transporter, ABC
           protein [Francisella tularensis subsp. holarctica OSU18]
 gi|282158708|gb|ADA78099.1| lipoprotein releasing system, subunit C,putative membrane protein
           [Francisella tularensis subsp. tularensis NE061598]
          Length = 420

 Score =  109 bits (273), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 130/237 (54%), Gaps = 8/237 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY+ + ++N FISI S ISF+G+ +GV  LI VMSVMNGF + +  ++L
Sbjct: 1   MFKSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITVMSVMNGFDQQIKSKIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLD-FIPDVIKVLPFVSGQAFVSGLSSGGSG---VLV 118
            +   + + Q    + D+  +A  ++   P V  V P V  Q  +S  +SG S    V +
Sbjct: 61  MMVPPLKVYQLGGEVTDWPNLAKEVEKSTPSVTAVAPIVESQGLLSA-NSGSSTTAFVQI 119

Query: 119 RGISNS-DFSYLQNSFSRFYGNVSN-DFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           +GI        L  +     G +S+ D ++G  +++G  LA NLG+ +GDK+ ++ P   
Sbjct: 120 QGIEPKYQTKVLPIAEHIVDGKLSSLDDNQGYNIVLGSVLADNLGVKVGDKVTLIVPKIS 179

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           +TP GM  R K + V G+F + +  YD     +++++AQ  F   N+VS +++ VK+
Sbjct: 180 LTPAGMIPRIKQFRVSGIFSVSY-QYDAYYAMINIKDAQKVFETGNSVSSLQLSVKN 235


>gi|293609881|ref|ZP_06692183.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828333|gb|EFF86696.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 411

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 134/271 (49%), Gaps = 10/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  + +S +G+ +GV  LI V+SVMNGF  ++  RVL
Sbjct: 1   MFKPISLYIGLRYTRARRSNHFISFIALVSMVGLTLGVAVLITVLSVMNGFDRELKNRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+     +      L D+  +  R++  P V  V PF   Q  ++      +G++V GI 
Sbjct: 61  GMVPQATVSSTQI-LTDWPELVKRVEHHPHVTGVAPFTQLQGMLTA-QGQVAGIMVTGID 118

Query: 123 ---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
                + S +QN          +   +G+ G+++GKD+A +LG+ + D + ++ P    +
Sbjct: 119 PKYEKNVSIIQN---HIVAGSLDSLKKGEFGIVLGKDMADSLGLRLNDSVTLVLPEATPS 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + V+G+F +   + D+ + Y++L +A     L +   G+ + + D  A  
Sbjct: 176 PAGVVPRFKRFKVVGIFSVG-AEVDSMVGYIALYDASTLLRLPDGAQGVRLKLDDIFAAP 234

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +  +++V+ L +     +W   +   F+  +
Sbjct: 235 QVADDLVKSLPSNFYATNWTYTHGNLFNAIQ 265


>gi|78047804|ref|YP_363979.1| ABC transporter-type lipoprotein-releasing protein [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|325928371|ref|ZP_08189566.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Xanthomonas perforans 91-118]
 gi|78036234|emb|CAJ23925.1| ABC transporter-type lipoprotein-releasing protein [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|325541247|gb|EGD12794.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Xanthomonas perforans 91-118]
          Length = 413

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 124/261 (47%), Gaps = 8/261 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFKPIPVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI- 121
            +  H  +  +  P+ D+Q         P V    P++  ++ + G        +VRG+ 
Sbjct: 61  QMAAHATVSAEGAPMRDWQHAVEVAMSDPRVAGAAPYIETESLLQGPRK--QPAIVRGVI 118

Query: 122 --SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
                  S L     +  G+V +       ++IGK+LA  LG+ +GD I +L      TP
Sbjct: 119 PAEEGKVSVLAKKMQQ--GSVDSLTPGSYNIVIGKELALWLGVDVGDSIVVLLSDTQATP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           +G   R K +TV G+F   + + D G+  +++Q+      ++  V+G+ + + D D    
Sbjct: 177 LGAMPRLKRFTVSGIFEAGYNEIDRGLAVVNMQDLARVLRMDG-VTGVRLRLHDMDQAWP 235

Query: 240 THENIVRILGNGVVVIDWQQR 260
              ++   L     V DW Q 
Sbjct: 236 VARDLAVKLHGPYRVSDWTQE 256


>gi|94499582|ref|ZP_01306119.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Oceanobacter sp. RED65]
 gi|94428336|gb|EAT13309.1| ABC-type transport system, involved in lipoprotein release,
           permease component [Oceanobacter sp. RED65]
          Length = 414

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 123/236 (52%), Gaps = 12/236 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +     + +  RY  + R+N FIS  S IS  G+ +GV  LI+V+SVMNGF  ++ +R+L
Sbjct: 1   MLKNLPIAIGLRYTRAKRRNHFISFISAISMAGLTLGVAVLILVLSVMNGFDRELRQRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  +  +   + ++Q +A ++    DV+   PF+  Q  +S      SGV+V GI 
Sbjct: 61  GMVPHAAVMGEKQGISNWQDVAAQIADRDDVLATAPFIQIQGMMS-YRGRVSGVMVTGIE 119

Query: 123 ---NSDFSYLQNSFSR--FYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
                  S L +   +  FY     D+    GV++G+ LAR LG+++GDK+ ++ P   +
Sbjct: 120 PEWEERVSILPDFIEQGDFYSLQPGDY----GVVMGELLARKLGVTLGDKVTLIMPEASL 175

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           TP G+  R K + V G+F +   + D    Y+++Q+A      + A  GI +   D
Sbjct: 176 TPAGLMPRLKRFEVTGVFAVG-AEVDANFAYINMQDAARLTRTDGA-QGIRLLTDD 229


>gi|70729343|ref|YP_259080.1| lipoprotein releasing system transmembrane protein LolC
           [Pseudomonas fluorescens Pf-5]
 gi|68343642|gb|AAY91248.1| lipoprotein releasing system transmembrane protein LolC
           [Pseudomonas fluorescens Pf-5]
          Length = 416

 Score =  109 bits (273), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 80/254 (31%), Positives = 129/254 (50%), Gaps = 11/254 (4%)

Query: 14  RYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQK 73
           RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVLG+  H  I+  
Sbjct: 12  RYTRAKRRNHFVSFISLTSMIGLALGVIVMIVVLSVMNGFDHEMRTRVLGMVPHATIESG 71

Query: 74  YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGISNSDFSYLQ- 130
             P+ D+Q +A+++   P V+ V PF   Q     L++ G    VL+  I       +  
Sbjct: 72  -EPISDWQSLADKVKQNPKVLAVAPFTQMQGL---LTNNGQVQKVLLNAIDPEQERQVSI 127

Query: 131 -NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSY 189
            + F +  G +        G++IG   A  LG+ +GDK+  ++P   VTP GM  R K +
Sbjct: 128 IDHFMQ-QGQLDALAPGSFGIVIGDKAATKLGVGLGDKLTFVAPEVTVTPAGMFPRMKRF 186

Query: 190 TVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL 248
           TV+G+F +   + D  +   +LQ+  +L+    + V G+ +   D     +T   I + L
Sbjct: 187 TVVGIFHVGAGEIDGYLGLTNLQDLGRLHRWKADQVQGLRLKFDDLFQAPRTAWEIAQQL 246

Query: 249 G-NGVVVIDWQQRY 261
           G N     DW + +
Sbjct: 247 GENHYYARDWTRTH 260


>gi|241668992|ref|ZP_04756570.1| ABC transporter, involved in lipoprotein release, permease
           component [Francisella philomiragia subsp. philomiragia
           ATCC 25015]
 gi|254877524|ref|ZP_05250234.1| ABC transporter [Francisella philomiragia subsp. philomiragia ATCC
           25015]
 gi|254843545|gb|EET21959.1| ABC transporter [Francisella philomiragia subsp. philomiragia ATCC
           25015]
          Length = 420

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 126/237 (53%), Gaps = 8/237 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY+ + ++N FISI S ISF+G+ +GV  LI VMSVMNGF + +  R+L
Sbjct: 1   MFRSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITVMSVMNGFDQQIKNRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLD-FIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
            +   + + Q    + D+  +A  ++   P V    P V  Q  +S  ++GGS      I
Sbjct: 61  MMVPPLKVYQMGGQVTDWLKLAKEVEKSAPSVTAAAPIVESQGLLSA-NNGGSTTAFVQI 119

Query: 122 SNSDFSYLQNSFS----RFYGNVSN-DFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
              +  Y             G +S+ D + G  +++G  LA +LG+S+GDK+ ++ P   
Sbjct: 120 QGIEPKYQTKVLPIGDHIIEGKLSSLDDNEGYNIVLGSALANSLGVSVGDKVTLIVPKIS 179

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           +TP GM  R K +TV G+F + +  YD     ++++ AQ  F   N+VS +++ +K+
Sbjct: 180 LTPAGMIPRIKQFTVSGIFSVSY-QYDAYYAMINIKNAQKVFETGNSVSSLQLGLKN 235


>gi|62261095|gb|AAX77959.1| unknown protein [synthetic construct]
          Length = 469

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 130/237 (54%), Gaps = 8/237 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY+ + ++N FISI S ISF+G+ +GV  LI VMSVMNGF + +  ++L
Sbjct: 41  MFKSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITVMSVMNGFDQQIKSKIL 100

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLD-FIPDVIKVLPFVSGQAFVSGLSSGGSG---VLV 118
            +   + + Q    + D+  +A  ++   P V  V P V  Q  +S  +SG S    V +
Sbjct: 101 MMVPPLKVYQLGGEVTDWPNLAKEVEKSTPSVTAVAPIVESQGLLSA-NSGSSTTAFVQI 159

Query: 119 RGISNS-DFSYLQNSFSRFYGNVSN-DFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           +GI        L  +     G +S+ D ++G  +++G  LA NLG+ +GDK+ ++ P   
Sbjct: 160 QGIEPKYQTKVLPIAEHIVDGKLSSLDDNQGYNIVLGSVLADNLGVKVGDKVTLIVPKIS 219

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           +TP GM  R K + V G+F + +  YD     +++++AQ  F   N+VS +++ VK+
Sbjct: 220 LTPAGMIPRIKQFRVSGIFSVSY-QYDAYYAMINIKDAQKVFETGNSVSSLQLSVKN 275


>gi|330502577|ref|YP_004379446.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas mendocina NK-01]
 gi|328916863|gb|AEB57694.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas mendocina NK-01]
          Length = 414

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 78/273 (28%), Positives = 135/273 (49%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S  S IG+ +GV+A+IVV+SVMNGF+++M  R+L
Sbjct: 1   MFRPLSIFIGARYTRAKRRNHFISFISLTSMIGLALGVLAMIVVLSVMNGFQKEMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVS--GLSSGGSGVLVRG 120
           G+  H ++     P+VD++ +A +    P V    P+   +  +S  GL      + + G
Sbjct: 61  GMVPHAMLYGA-EPVVDWRALAAKAMANPQVQAAAPYAELEGMLSHRGLM---QPIQIHG 116

Query: 121 ISNSD---FSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
           I  ++    S L     +  G++SN      GV+IG   AR  G+ +GDK+ ++ P    
Sbjct: 117 IDPAEEGKVSILPEHIRQ--GSLSNLLPGEFGVVIGDITARRFGLQVGDKLTLIIPEPSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPDA 236
            P G+  R +   V  +F++   + D+ +  +++ +A     L E  V GI + +KD   
Sbjct: 175 APGGVTPRMQRLNVAAVFKVGA-ELDSSLALINVADAAAMQRLPEGTVPGIRLALKDLYQ 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +  + ++  LG G    DW       FS  +
Sbjct: 234 APQVSKALLAELGAGYRADDWTHTQGSLFSAMK 266


>gi|89255884|ref|YP_513246.1| lipoprotein releasing system, subunit C,putative membrane protein
           [Francisella tularensis subsp. holarctica LVS]
 gi|156501867|ref|YP_001427932.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Francisella tularensis subsp. holarctica FTNF002-00]
 gi|254367245|ref|ZP_04983273.1| lipoprotein releasing system, subunit C, putative membrane protein
           [Francisella tularensis subsp. holarctica 257]
 gi|254368722|ref|ZP_04984735.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|254874371|ref|ZP_05247081.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
 gi|89143715|emb|CAJ78914.1| lipoprotein releasing system, subunit C,putative membrane protein
           [Francisella tularensis subsp. holarctica LVS]
 gi|134253063|gb|EBA52157.1| lipoprotein releasing system, subunit C, putative membrane protein
           [Francisella tularensis subsp. holarctica 257]
 gi|156252470|gb|ABU60976.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Francisella tularensis subsp. holarctica FTNF002-00]
 gi|157121643|gb|EDO65813.1| conserved hypothetical protein [Francisella tularensis subsp.
           holarctica FSC022]
 gi|254840370|gb|EET18806.1| conserved hypothetical protein [Francisella tularensis subsp.
           tularensis MA00-2987]
          Length = 434

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 130/237 (54%), Gaps = 8/237 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY+ + ++N FISI S ISF+G+ +GV  LI VMSVMNGF + +  ++L
Sbjct: 15  MFKSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITVMSVMNGFDQQIKSKIL 74

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLD-FIPDVIKVLPFVSGQAFVSGLSSGGSG---VLV 118
            +   + + Q    + D+  +A  ++   P V  V P V  Q  +S  +SG S    V +
Sbjct: 75  MMVPPLKVYQLGGEVTDWPNLAKEVEKSTPSVTAVAPIVESQGLLSA-NSGSSTTAFVQI 133

Query: 119 RGISNS-DFSYLQNSFSRFYGNVSN-DFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           +GI        L  +     G +S+ D ++G  +++G  LA NLG+ +GDK+ ++ P   
Sbjct: 134 QGIEPKYQTKVLPIAEHIVDGKLSSLDDNQGYNIVLGSVLADNLGVKVGDKVTLIVPKIS 193

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           +TP GM  R K + V G+F + +  YD     +++++AQ  F   N+VS +++ VK+
Sbjct: 194 LTPAGMIPRIKQFRVSGIFSVSY-QYDAYYAMINIKDAQKVFETGNSVSSLQLSVKN 249


>gi|293606104|ref|ZP_06688469.1| lipoprotein ABC superfamily ATP binding cassette transporter,
           permease protein [Achromobacter piechaudii ATCC 43553]
 gi|292815559|gb|EFF74675.1| lipoprotein ABC superfamily ATP binding cassette transporter,
           permease protein [Achromobacter piechaudii ATCC 43553]
          Length = 410

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 73/256 (28%), Positives = 130/256 (50%), Gaps = 15/256 (5%)

Query: 24  FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYP------- 76
           FIS  +  S  G+ +GV ALIVV+SVMNGF++++  R+L +  H+   + Y P       
Sbjct: 14  FISFIAASSMAGIALGVAALIVVLSVMNGFQKEVRDRMLSVLPHI---ELYIPGALPEQV 70

Query: 77  LVDYQFIANRLDFIPDVIKVLPFVSGQA-FVSGLSSGGSGVLVRGISNSDFSYLQNSFSR 135
           L  +Q  A   +  P+V    PFV+ Q   V G +    GV VRGI  +    + +   +
Sbjct: 71  LERWQQFATAAEQNPEVKAGAPFVAAQGMLVRGQAL--RGVQVRGIDPATEGNVSDLPRQ 128

Query: 136 FYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGM 194
                  D   G  GV++G +LA  LG+ +GD + +++P G ++P G   R + +TV+G+
Sbjct: 129 MVSGKLTDLKAGGFGVVLGNELADGLGVKVGDTLLMMAPQGSISPAGFAPRMRQFTVVGV 188

Query: 195 FRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVV 254
           F     +YD+ + ++  Q+A   F  E+  +G+ + + D     +    +  +L   V+ 
Sbjct: 189 FSSGHYEYDSSLAFVDNQDAARVFR-ESGTAGVRLRIADMQKAPEVANELKAVLPPYVMA 247

Query: 255 IDWQQRYQIFFSCYES 270
            DW +  + +F+  ++
Sbjct: 248 SDWSRNNRTWFAAVQT 263


>gi|294665033|ref|ZP_06730340.1| ABC transporter-type lipoprotein-releasing protein [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
 gi|292605190|gb|EFF48534.1| ABC transporter-type lipoprotein-releasing protein [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 10535]
          Length = 413

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 124/261 (47%), Gaps = 8/261 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFKPIPVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI- 121
            +  H  +  +  P+ D+Q         P V    P++  ++ + G        +VRG+ 
Sbjct: 61  QMAAHATVSAEGAPMRDWQHAVEVAMSDPRVAGAAPYIGTESLLQGPRK--QPAIVRGVI 118

Query: 122 --SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
                  S L     +  G+V +       ++IGK+LA  LG+ +GD I +L      TP
Sbjct: 119 PAEEGKVSVLAKKMQQ--GSVDSLTPGSYNIVIGKELALWLGVDVGDSIVVLLSDTQATP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           +G   R K +TV G+F   + + D G+  +++Q+      ++  V+G+ + + D D    
Sbjct: 177 LGAMPRLKRFTVSGIFEAGYNEIDRGLAVVNMQDLARVLRMDG-VTGVRLRLHDMDQAWP 235

Query: 240 THENIVRILGNGVVVIDWQQR 260
              ++   L     V DW Q 
Sbjct: 236 VARDLAVKLHGPYRVSDWTQE 256


>gi|328676565|gb|AEB27435.1| Lipoprotein releasing system transmembrane protein LolC
           [Francisella cf. novicida Fx1]
          Length = 420

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 128/236 (54%), Gaps = 6/236 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY+ + ++N FISI S ISF+G+ +GV  LI VMSVMNGF + +  ++L
Sbjct: 1   MFKSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITVMSVMNGFDQQIKSKIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLD-FIPDVIKVLPFVSGQAFVSGLSSGGSG--VLVR 119
            +   + + Q    + D+  +A  ++   P V  V P V  Q  +S  S G +   V ++
Sbjct: 61  MMVPPLKVYQLGGEVTDWPNLAKEVEKSTPSVTAVAPIVESQGLLSANSRGSTTAFVQIQ 120

Query: 120 GISNS-DFSYLQNSFSRFYGNVSN-DFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
           GI        L  +     G +S+ D ++G  +++G  LA +LG+ +GDK+ ++ P   +
Sbjct: 121 GIEPKYQTKVLPIAEHIVDGKLSSLDDNQGYNIVLGSVLADDLGVKVGDKVTLIVPKISL 180

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           TP GM  R K + V G+F + +  YD     ++++ AQ  F   N+VS +++ VK+
Sbjct: 181 TPAGMIPRIKQFRVSGIFSVSY-QYDAYYAMINIKNAQKVFETGNSVSSLQLSVKN 235


>gi|118497101|ref|YP_898151.1| ABC transporter, involved in lipoprotein release, permease
           component [Francisella tularensis subsp. novicida U112]
 gi|194323398|ref|ZP_03057175.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Francisella tularensis subsp. novicida FTE]
 gi|208778894|ref|ZP_03246240.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Francisella novicida FTG]
 gi|118423007|gb|ABK89397.1| ABC transporter, involved in lipoprotein release, permease
           component [Francisella novicida U112]
 gi|194322253|gb|EDX19734.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Francisella tularensis subsp. novicida FTE]
 gi|208744694|gb|EDZ90992.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Francisella novicida FTG]
          Length = 420

 Score =  109 bits (272), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 130/237 (54%), Gaps = 8/237 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY+ + ++N FISI S ISF+G+ +GV  LI VMSVMNGF + +  ++L
Sbjct: 1   MFKSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITVMSVMNGFDQQIKSKIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLD-FIPDVIKVLPFVSGQAFVSGLSSGGSG---VLV 118
            +   + + Q    + D+  +A  ++   P V  V P V  Q  +S  +SGGS    V +
Sbjct: 61  MMVPPLKVYQLGGEVTDWPNLAKEVEKSTPSVTAVAPIVESQGLLSA-NSGGSTTAFVQI 119

Query: 119 RGISNS-DFSYLQNSFSRFYGNVSN-DFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           +GI        L  +     G +S+ D ++G  +++G  LA +LG+ +GDK+ ++ P   
Sbjct: 120 QGIEPKYQTKVLPIAEHIVDGKLSSLDDNQGYNIVLGSVLADDLGVKVGDKVTLIVPKIS 179

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           +TP GM  R K + V G+F + +  YD     ++++ AQ  F   N+VS +++ VK+
Sbjct: 180 LTPAGMIPRIKQFRVSGIFSVSY-QYDAYYAMINIKNAQKVFETGNSVSSLQLSVKN 235


>gi|24373810|ref|NP_717853.1| lipoprotein releasing system transmembrane protein LolE [Shewanella
           oneidensis MR-1]
 gi|24348205|gb|AAN55297.1|AE015667_7 lipoprotein releasing system transmembrane protein LolE [Shewanella
           oneidensis MR-1]
          Length = 410

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 82/270 (30%), Positives = 130/270 (48%), Gaps = 9/270 (3%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RF + V +RY  + + NAF S  +  +  G+ +GV ALIVV SVMNG    + +R+LG  
Sbjct: 4   RFPLYVGYRYWRARKANAFASFITLFAVSGIFLGVAALIVVSSVMNGLEGQLKQRILGAV 63

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
             + +  K  PL D+   A +L  +P V  V P VS QA V   ++    V V G+    
Sbjct: 64  PQLTVYTK-APLSDWTIAAEKLTMLPGVQGVTPSVSTQAMVQS-AANIRAVQVFGVFPEL 121

Query: 126 FSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV-TPMGMG 183
              L       Y    ++   G+  VI+G +LAR L +S GD + +LS  G V +P+G  
Sbjct: 122 AEKLSAVAQHTYSGAFSELTSGQYQVILGSELARQLKVSPGDTVRLLSGDGVVYSPLGPV 181

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDP---DAIEK 239
              + + V  +F M     D G+ Y+  Q+A+ L     + ++ + +++ DP    A+ K
Sbjct: 182 PSQRKFLVSAVFEMG-SQVDAGVAYVHYQDAKRLMRQPSDEINQLRLYLNDPFTAPALAK 240

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             + I+   G      DW+  Y   FS  +
Sbjct: 241 DVQQILTAQGIEATTSDWRDTYGHLFSAVK 270


>gi|289624088|ref|ZP_06457042.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289648580|ref|ZP_06479923.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|330869877|gb|EGH04586.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 414

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 137/273 (50%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A+     P+V   +PF   +     LS  GS   ++ IS
Sbjct: 61  GMVPHAVIAGA-TPVDDWKPLADAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 115

Query: 123 NSDFSYLQNSFSRFYGNVS----NDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D   L++  S    +++     D   G+ GV++G   AR   +SIGDK+ ++ P    
Sbjct: 116 GVD-PALEHEVSIVTQHITRGSLEDLKPGEFGVVLGDITARRFRLSIGDKLTLIVPEVSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +  TV+G+F++   + D  M  +++ + AQ+     N V G+ + +KD   
Sbjct: 175 APGGITPRLQRLTVVGIFKVG-AELDGSMGLINIADAAQMQRWQPNQVQGVRLALKDLYK 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG G    DW       FS  +
Sbjct: 234 APQVSTAIAAGLGAGYHADDWTHTQGSLFSAMK 266


>gi|254373928|ref|ZP_04989410.1| conserved hypothetical protein [Francisella novicida GA99-3548]
 gi|151571648|gb|EDN37302.1| conserved hypothetical protein [Francisella novicida GA99-3548]
          Length = 434

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 130/237 (54%), Gaps = 8/237 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY+ + ++N FISI S ISF+G+ +GV  LI VMSVMNGF + +  ++L
Sbjct: 15  MFKSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITVMSVMNGFDQQIKSKIL 74

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLD-FIPDVIKVLPFVSGQAFVSGLSSGGSG---VLV 118
            +   + + Q    + D+  +A  ++   P V  V P V  Q  +S  +SGGS    V +
Sbjct: 75  MMVPPLKVYQLGGEVTDWPNLAKEVEKSTPSVTAVAPIVESQGLLSA-NSGGSTTAFVQI 133

Query: 119 RGISNS-DFSYLQNSFSRFYGNVSN-DFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           +GI        L  +     G +S+ D ++G  +++G  LA +LG+ +GDK+ ++ P   
Sbjct: 134 QGIEPKYQTKVLPIAEHIVDGKLSSLDDNQGYNIVLGSVLADDLGVKVGDKVTLIVPKIS 193

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           +TP GM  R K + V G+F + +  YD     ++++ AQ  F   N+VS +++ VK+
Sbjct: 194 LTPAGMIPRIKQFRVSGIFSVSY-QYDAYYAMINIKNAQKVFETGNSVSSLQLSVKN 249


>gi|257484403|ref|ZP_05638444.1| lipoprotein releasing system transmembrane protein LolE
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|330889112|gb|EGH21773.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. mori str. 301020]
 gi|330986256|gb|EGH84359.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331013185|gb|EGH93241.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 414

 Score =  109 bits (272), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 137/273 (50%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A+     P+V   +PF   +     LS  GS   ++ IS
Sbjct: 61  GMVPHAVI-AGATPVDDWKPLADAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 115

Query: 123 NSDFSYLQNSFSRFYGNVS----NDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D   L++  S    +++     D   G+ GV++G   AR   +SIGDK+ ++ P    
Sbjct: 116 GVD-PALEHEVSIVTQHITRGSLEDLKPGEFGVVLGDITARRFRLSIGDKLTLIVPEVSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +  TV+G+F++   + D  M  +++ + AQ+     N V G+ + +KD   
Sbjct: 175 APGGITPRLQRLTVVGIFKVG-AELDGSMGLINIADAAQMQRWQPNQVQGVRLALKDLYK 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG G    DW       FS  +
Sbjct: 234 APQVSTAIAAGLGAGYHADDWTHTQGSLFSAMK 266


>gi|187931356|ref|YP_001891340.1| ABC transporter, involved in lipoprotein release, permease
           component [Francisella tularensis subsp. mediasiatica
           FSC147]
 gi|187712265|gb|ACD30562.1| ABC transporter, involved in lipoprotein release, permease
           component [Francisella tularensis subsp. mediasiatica
           FSC147]
          Length = 420

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 130/237 (54%), Gaps = 8/237 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY+ + ++N FISI S ISF+G+ +GV  LI VMSVMNGF + +  ++L
Sbjct: 1   MFKSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITVMSVMNGFDQQIKSKIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLD-FIPDVIKVLPFVSGQAFVSGLSSGGSG---VLV 118
            +   + + Q    + D+  +A  ++   P V  V P V  Q  +S  +SG S    V +
Sbjct: 61  MMVPPLKVYQLGGEVTDWPNLAKEVEKSTPSVTAVAPIVESQGLLSA-NSGSSTTAFVQI 119

Query: 119 RGISNS-DFSYLQNSFSRFYGNVSN-DFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           +GI        L  +     G +S+ D ++G  +++G  LA NLG+ +GDK+ ++ P   
Sbjct: 120 QGIEPKYQTKVLPIAEHIVDGKLSSLDDNQGYNIVLGSVLADNLGVKVGDKVTLIVPKIS 179

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           +TP GM  R K + V G+F + +  YD     +++++AQ  F   N+VS +++ VK+
Sbjct: 180 LTPAGMIPRIKQFRVSGIFSVSY-QYDVYYAMINIKDAQKVFETGNSVSSLQLSVKN 235


>gi|184159176|ref|YP_001847515.1| ABC transporter [Acinetobacter baumannii ACICU]
 gi|183210770|gb|ACC58168.1| ABC-type transport system [Acinetobacter baumannii ACICU]
          Length = 418

 Score =  108 bits (271), Expect = 5e-22,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 134/271 (49%), Gaps = 10/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  + +S +G+ +GV  LI V+SVMNGF  ++  RVL
Sbjct: 8   MFKPISLYIGLRYTRARRSNHFISFIALVSMVGLTLGVAVLITVLSVMNGFDRELKNRVL 67

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+     +      L D+  +  R++  P V  V PF   Q  ++      +G++V GI 
Sbjct: 68  GMVPQATVSSTQI-LTDWPELVKRVENHPHVTGVAPFTQLQGMLTA-QGQVAGIMVTGID 125

Query: 123 ---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
                + S +QN          +   +G+ G+++GKD+A +LG+ + D + ++ P    +
Sbjct: 126 PKYEKNVSIIQN---HIVAGSLDSLKKGEFGIVLGKDMADSLGLRLNDSVTLVLPEATPS 182

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + V+G+F +   + D+ + Y++L +A     L +   G+ + + D  A  
Sbjct: 183 PAGVVPRFKRFKVVGIFSVG-AEVDSMVGYIALYDASTLLRLPDGAQGVRLKLDDIFAAP 241

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +  ++IV+ L +     +W   +   F+  +
Sbjct: 242 QVADDIVKNLPSNFYATNWTYTHGNLFNAIQ 272


>gi|239501007|ref|ZP_04660317.1| ABC-type transport system [Acinetobacter baumannii AB900]
 gi|294836597|ref|ZP_06781280.1| ABC-type transport system [Acinetobacter sp. 6013113]
 gi|294840709|ref|ZP_06785392.1| ABC-type transport system [Acinetobacter sp. 6014059]
 gi|294860832|ref|ZP_06798601.1| ABC-type transport system [Acinetobacter sp. 6013150]
 gi|301346981|ref|ZP_07227722.1| ABC-type transport system [Acinetobacter baumannii AB056]
 gi|301510507|ref|ZP_07235744.1| ABC-type transport system [Acinetobacter baumannii AB058]
 gi|301597094|ref|ZP_07242102.1| ABC-type transport system [Acinetobacter baumannii AB059]
          Length = 426

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 134/271 (49%), Gaps = 10/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  + +S +G+ +GV  LI V+SVMNGF  ++  RVL
Sbjct: 16  MFKPISLYIGLRYTRARRSNHFISFIALVSMVGLTLGVAVLITVLSVMNGFDRELKNRVL 75

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+     +      L D+  +  R++  P V  V PF   Q  ++      +G++V GI 
Sbjct: 76  GMVPQATVSSTQI-LTDWPELVKRVENHPHVTGVAPFTQLQGMLTA-QGQVAGIMVTGID 133

Query: 123 ---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
                + S +QN          +   +G+ G+++GKD+A +LG+ + D + ++ P    +
Sbjct: 134 PKYEKNVSIIQN---HIVAGSLDSLKKGEFGIVLGKDMADSLGLRLNDSVTLVLPEATPS 190

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + V+G+F +   + D+ + Y++L +A     L +   G+ + + D  A  
Sbjct: 191 PAGVVPRFKRFKVVGIFSVG-AEVDSMVGYIALYDASTLLRLPDGAQGVRLKLDDIFAAP 249

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +  ++IV+ L +     +W   +   F+  +
Sbjct: 250 QVADDIVKNLPSNFYATNWTYTHGNLFNAIQ 280


>gi|330808521|ref|YP_004352983.1| Liporotein ABC transporter, permease component [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327376629|gb|AEA67979.1| Liporotein ABC transporter, permease component [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 414

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 79/271 (29%), Positives = 128/271 (47%), Gaps = 9/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N F+S  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLSIFIGTRYTRAKRRNRFVSFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I     P+ D+Q +A      P+V   +PF   +     LS  GS   + + G
Sbjct: 61  GMVPHATI-VGVNPIDDWQPVAAAALKNPEVTAAVPFTEMEGM---LSHKGSMQPIQISG 116

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +  +    +            +    G+ GV+IG+  AR   +++GDKI ++ P     P
Sbjct: 117 VDPAQEGKVSIVAQHIVQGRLDALKPGEFGVVIGEITARRFRLNVGDKITLIVPEVSTAP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIE 238
            G+  R +   V+G+F++   + D  M  + L + AQ+     N V  + + VKD  A  
Sbjct: 177 GGITPRMQRLNVVGVFKVG-AELDGSMALIHLADAAQMQHWQPNQVQSVRLAVKDLYAAP 235

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           K   +I   LG      DW       FS  +
Sbjct: 236 KVSGDIATGLGAAYKADDWTHTQGSLFSAMK 266


>gi|212704561|ref|ZP_03312689.1| hypothetical protein DESPIG_02621 [Desulfovibrio piger ATCC 29098]
 gi|212671960|gb|EEB32443.1| hypothetical protein DESPIG_02621 [Desulfovibrio piger ATCC 29098]
          Length = 410

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 81/268 (30%), Positives = 138/268 (51%), Gaps = 7/268 (2%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ VA RYLFS RK  FI I S +S +GV +GV AL+VV+ V NG   DM  +++G N 
Sbjct: 5   FELFVALRYLFSRRKQTFIYIISIMSILGVALGVGALVVVLGVYNGLTTDMRDKIIGANA 64

Query: 67  HVVIQQKYYPLVDYQF--IANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
           H ++   Y P    Q   +  R++ +  V    PF+  +  +S  + G  G+++RGI   
Sbjct: 65  HGIVMS-YVPAAFQQHPDLVQRVEAVEHVRGATPFIYTEVMLSA-AGGVKGLVLRGIDPE 122

Query: 125 DFSYLQNSFSRFYGNVSNDFDR--GKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
               + +           D  R    G++IG++LA+ LGI +G ++N+LSP G+    G 
Sbjct: 123 SAPKVLSMLREIRRGSVADLKREGTPGIVIGEELAKRLGIGLGSRVNLLSPSGEKGATGY 182

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENA-VSGIEVFVKDPDAIEKTH 241
             R + + V+G+F+    +YD  + ++ L+ A+    L +  ++GIE+ V D    +   
Sbjct: 183 SPRIRPFEVVGIFKTGMFEYDATLAFVDLKAARDILGLPDGFLTGIEIMVDDVYKADAIA 242

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +++   LG+   V  W +     F+  +
Sbjct: 243 QSVQDTLGSPFYVRHWMEMNANLFAALK 270


>gi|70729345|ref|YP_259082.1| lipoprotein releasing system transmembrane protein LolE
           [Pseudomonas fluorescens Pf-5]
 gi|68343644|gb|AAY91250.1| lipoprotein releasing system transmembrane protein LolE
           [Pseudomonas fluorescens Pf-5]
          Length = 414

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 75/269 (27%), Positives = 128/269 (47%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N F+S  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLSIFIGTRYTRAKRRNRFVSFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     P+ D+Q +A      P+V   +PF   +  +S        + + GI 
Sbjct: 61  GMVPHATI-VGVKPIDDWQPVAAAALKNPEVTAAVPFTEMEGMLS-YKGAMQPIQISGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +    +             D   G+ GV+IG+  AR   +++GDK+ ++ P     P G
Sbjct: 119 PAQEGKVSIVAQHIVQGSLQDLKPGEFGVVIGEITARRFRLNVGDKLTLIVPEVSTAPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           +  R +   V+G+F++    D   G+++++   A++     N V  + + VKD  A  K 
Sbjct: 179 ITPRMQRLNVVGVFKVGAELDGSMGLIHVA-DAAEMQHWQPNQVQSVRLAVKDLYAAPKV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +I + LG      DW       FS  +
Sbjct: 238 SADIAKGLGADFRADDWTHTQGSLFSAMK 266


>gi|169795040|ref|YP_001712833.1| outer membrane lipoproteins ABC transporter membrane protein
           [Acinetobacter baumannii AYE]
 gi|260556523|ref|ZP_05828741.1| lipoprotein releasing system, transmembrane protein LolE
           [Acinetobacter baumannii ATCC 19606]
 gi|169147967|emb|CAM85830.1| transport protein of outer membrane lipoproteins (ABC superfamily,
           membrane) [Acinetobacter baumannii AYE]
 gi|260409782|gb|EEX03082.1| lipoprotein releasing system, transmembrane protein LolE
           [Acinetobacter baumannii ATCC 19606]
          Length = 411

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 134/271 (49%), Gaps = 10/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  + +S +G+ +GV  LI V+SVMNGF  ++  RVL
Sbjct: 1   MFKPISLYIGLRYTRARRSNHFISFIALVSMVGLTLGVAVLITVLSVMNGFDRELKNRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+     +      L D+  +  R++  P V  V PF   Q  ++      +G++V GI 
Sbjct: 61  GMVPQATVSSTQI-LTDWPELVKRVENHPHVTGVAPFTQLQGMLTA-QGQVAGIMVTGID 118

Query: 123 ---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
                + S +QN          +   +G+ G+++GKD+A +LG+ + D + ++ P    +
Sbjct: 119 PKYEKNVSIIQN---HIVAGSLDSLKKGEFGIVLGKDMADSLGLRLNDSVTLVLPEATPS 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + V+G+F +   + D+ + Y++L +A     L +   G+ + + D  A  
Sbjct: 176 PAGVVPRFKRFKVVGIFSVG-AEVDSMVGYIALYDASTLLRLPDGAQGVRLKLDDIFAAP 234

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +  ++IV+ L +     +W   +   F+  +
Sbjct: 235 QVADDIVKNLPSNFYATNWTYTHGNLFNAIQ 265


>gi|330954503|gb|EGH54763.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae Cit 7]
          Length = 414

 Score =  108 bits (271), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 82/273 (30%), Positives = 137/273 (50%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A+     P+V   +PF   +     LS  GS   ++ IS
Sbjct: 61  GMVPHAVI-AGTTPVDDWKPLADAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 115

Query: 123 NSDFSYLQNSFSRFYGNVS----NDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D   L++  S    +++     D   G+ GV++G   AR   ++IGDK+ ++ P    
Sbjct: 116 GVD-PALEHEVSIVTQHITRGSLEDLKPGEFGVVLGDITARRFRLTIGDKLTLIVPEVSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +  TV+G+F++   + D  M  +++ + AQ+     N V G+ + +KD   
Sbjct: 175 APGGITPRLQRLTVVGIFKVG-AELDGSMGLINIADAAQMQRWQPNQVQGVRLALKDLYK 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG G    DW       FS  +
Sbjct: 234 APQVSTAIAAGLGEGYRADDWTHTQGSLFSAMK 266


>gi|187478024|ref|YP_786048.1| lipoprotein releasing system, transmembrane protein [Bordetella
           avium 197N]
 gi|115422610|emb|CAJ49135.1| lipoprotein releasing system, transmembrane protein [Bordetella
           avium 197N]
          Length = 426

 Score =  108 bits (271), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 75/256 (29%), Positives = 132/256 (51%), Gaps = 15/256 (5%)

Query: 24  FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYP------- 76
           FIS  +  S  G+ +GV ALIVV+SVMNGF++++  R+L +  H+   + Y P       
Sbjct: 30  FISFIAASSMAGIALGVAALIVVLSVMNGFQKEVRDRMLSVLPHI---ELYIPGALPERV 86

Query: 77  LVDYQFIANRLDFIPDVIKVLPFVS-GQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSR 135
           L  +Q   +     P+VI   PFV+ G   V G S     V VRGI  +    + +   +
Sbjct: 87  LDQWQQFGDAARKNPEVIGEAPFVAAGAMLVRGQSL--HAVQVRGIDPALEGKVSDLPKQ 144

Query: 136 F-YGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGM 194
              G +S+    G GV++G +LA N+G+  GD + +L+P G ++P G   R + +TV+G 
Sbjct: 145 MVTGKLSDLKPGGFGVVLGNELADNMGVKTGDTLLMLAPQGSISPAGFAPRMRQFTVVGT 204

Query: 195 FRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVV 254
           F     +YD+ + ++  ++A   F  ++  +G+ + V D     +    + R+L   V+ 
Sbjct: 205 FSSGHYEYDSSLAFIDDEDAAKVFR-DSGTAGVRLRVADMQRAPEVAAELTRVLPPYVMA 263

Query: 255 IDWQQRYQIFFSCYES 270
            DW +  + +F+  ++
Sbjct: 264 SDWSRNNRTWFAAVQT 279


>gi|15606709|ref|NP_214089.1| hypothetical protein aq_1585 [Aquifex aeolicus VF5]
 gi|2983943|gb|AAC07492.1| hypothetical protein aq_1585 [Aquifex aeolicus VF5]
          Length = 394

 Score =  108 bits (270), Expect = 7e-22,   Method: Compositional matrix adjust.
 Identities = 77/259 (29%), Positives = 136/259 (52%), Gaps = 11/259 (4%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           V  RYLF  + ++     +F+SF G+ + V A+I+ + V +GF++++  ++L    H+VI
Sbjct: 7   VVLRYLFHAKGSSLF--MTFMSFFGIFLSVNAIILTLGVFSGFQDELKNKILSKTPHLVI 64

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQ 130
               Y   + + I   L+   +V   L FV   AF+S      SG +++ +S     Y  
Sbjct: 65  T--LYSDYERERIKEVLEKEKEVEYFLSFVVYNAFLS------SGEVIQSVSVKAIDYKD 116

Query: 131 NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYT 190
             F +F      +    KG+I+GK +A   G+ +GD+++++SP+G  TP G+  + K + 
Sbjct: 117 GEFQKFIKRFLTE-GGTKGLILGKGIAEVFGLLVGDEVSLISPFGIRTPTGVIPKVKKFR 175

Query: 191 VLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGN 250
           V G+F     D D  +VYM+L++A+ +F  +  V+  EV++KDP   +   E + + LG 
Sbjct: 176 VGGIFYTGSYDKDYAVVYMNLKDAKEFFKRDYGVNFTEVYIKDPYRADIVKEKVKKELGE 235

Query: 251 GVVVIDWQQRYQIFFSCYE 269
            VVV  W    +  F+  E
Sbjct: 236 RVVVRSWIDLNKPLFNALE 254


>gi|260549325|ref|ZP_05823545.1| ABC-type transport system [Acinetobacter sp. RUH2624]
 gi|260407731|gb|EEX01204.1| ABC-type transport system [Acinetobacter sp. RUH2624]
          Length = 418

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 71/271 (26%), Positives = 134/271 (49%), Gaps = 10/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  + +S +G+ +GV  LI V+SVMNGF  ++  RVL
Sbjct: 8   MFKPISLYIGLRYTRARRSNHFISFIALVSMVGLTLGVAVLITVLSVMNGFDRELKNRVL 67

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+     +      L D+  +  R++  P V  V PF   Q  ++      +G++V GI 
Sbjct: 68  GMVPQATVSSTQI-LTDWPELIKRVENHPHVTGVAPFTQLQGMLTA-QGQVAGIMVTGID 125

Query: 123 ---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
                + S +QN          +   +G+ G+++GKD+A +LG+ + D + ++ P    +
Sbjct: 126 PKYEKNVSIIQN---HIVAGSLDSLKKGEFGIVLGKDMADSLGLRLNDSVTLVLPEATPS 182

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + V+G+F +   + D+ + Y++L +A     L +   G+ + + D  A  
Sbjct: 183 PAGVVPRFKRFKVVGIFSVG-AEVDSMVGYIALYDASTLLRLPDGAQGVRLKMDDIFAAP 241

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +  ++IV+ L +     +W   +   F+  +
Sbjct: 242 QVADDIVKNLPSNFYATNWTYTHGNLFNAIQ 272


>gi|152988493|ref|YP_001347547.1| hypothetical protein PSPA7_2175 [Pseudomonas aeruginosa PA7]
 gi|150963651|gb|ABR85676.1| conserved hypothetical protein [Pseudomonas aeruginosa PA7]
          Length = 414

 Score =  108 bits (269), Expect = 9e-22,   Method: Compositional matrix adjust.
 Identities = 72/269 (26%), Positives = 130/269 (48%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RY  + R+N +IS  S  S IG+ +GV+A+I+V+SVMNGF+++M  R+L
Sbjct: 1   MFRPLPFFIGLRYTRAKRRNHYISFISLTSMIGLALGVLAMIIVLSVMNGFQKEMRTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     PL D+Q +A       +V+   PF   Q  +S        VLV GI 
Sbjct: 61  GMVPHATISAA-QPLDDWQTVAAAALKHREVVGAAPFAELQGMLS-YKGNMLPVLVNGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
             +   +            +D   G+ G+++G+  AR   +++GDK+ ++ P     P G
Sbjct: 119 PQEERKVSIVGEHIVQGSLDDLKPGEFGIVLGEITARRFHVNVGDKLTLIVPEATSAPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENA-VSGIEVFVKDPDAIEKT 240
           +  R + +T++ +F++   + DN +  + + +A     L+   V  + + +KD     + 
Sbjct: 179 ITPRMQRFTIVALFKVG-AELDNSLALVDIADAGQLLRLQPGQVPSVRLELKDLYQSPQV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              +V+ LG G    DW +     F+  +
Sbjct: 238 AAKVVKELGQGFRSSDWTRTQGSLFNAMK 266


>gi|328675642|gb|AEB28317.1| Lipoprotein releasing system transmembrane protein LolC
           [Francisella cf. novicida 3523]
          Length = 420

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 129/237 (54%), Gaps = 8/237 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY+ + ++N FISI S ISF+G+ +GV  LI VMSVMNGF + +  ++L
Sbjct: 1   MFKSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITVMSVMNGFDQQIKSKIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLD-FIPDVIKVLPFVSGQAFVSGLSSGGSG---VLV 118
            +   + + Q    + D+  +A  ++     V  V P V  Q  +S  +SGGS    V +
Sbjct: 61  MMVPPLKVYQLGGEVTDWPTLAKEVEKSTSSVTAVAPIVESQGLLSA-NSGGSTTAFVQI 119

Query: 119 RGISNS-DFSYLQNSFSRFYGNVSN-DFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           +GI        L  +     G +S+ D ++G  +++G  LA NLG+ +GDK+ ++ P   
Sbjct: 120 QGIEPKYQTKVLPIAEHIVDGKLSSLDDNQGYNIVLGSVLADNLGVKVGDKVTLIVPKIS 179

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           +TP GM  R K + V G+F + +  YD     ++++ AQ  F   N+VS +++ VK+
Sbjct: 180 LTPAGMIPRIKQFRVSGIFSVSY-QYDAYYAMINIKNAQKVFETGNSVSSLQLSVKN 235


>gi|325920382|ref|ZP_08182313.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Xanthomonas gardneri ATCC 19865]
 gi|325549129|gb|EGD20052.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Xanthomonas gardneri ATCC 19865]
          Length = 422

 Score =  108 bits (269), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 125/261 (47%), Gaps = 8/261 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 10  MFKPIPVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 69

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
            +  H  +     P+ D+Q         P +    P++  ++ + G        +VRGI 
Sbjct: 70  QMAAHATVSADGAPMRDWQNAVEVATADPRIAGAAPYIETESLLQGPRK--QPAIVRGII 127

Query: 123 NSD---FSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
            ++    S L     +  G+V +       ++IGK+LA  LG+ +GD I +L      TP
Sbjct: 128 PAEEGKVSVLAKKMQQ--GSVDSLTPGSYNIVIGKELAIWLGVDVGDSIVVLLSDTQATP 185

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           +G   R K +TV G+F   + + D G+  +++Q+      ++  V+G+ + + D D    
Sbjct: 186 LGAMPRLKRFTVSGIFEAGYNEIDRGLAVVNMQDLARVLRMDG-VTGVRLRLHDMDQAWT 244

Query: 240 THENIVRILGNGVVVIDWQQR 260
              ++   L     V DW Q 
Sbjct: 245 VARDLAIKLHGPYRVSDWTQE 265


>gi|254491410|ref|ZP_05104589.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylophaga thiooxidans DMS010]
 gi|224462888|gb|EEF79158.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Methylophaga thiooxydans DMS010]
          Length = 368

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 67/226 (29%), Positives = 115/226 (50%), Gaps = 10/226 (4%)

Query: 50  MNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGL 109
           MNGF +++ +R+LG+  H  I  +   L D+Q +   L   PD++   PFV GQA +S  
Sbjct: 1   MNGFEKELKERILGMTSHAFITGQDGTLSDWQQLQASLQDNPDLVDSAPFVEGQAMLSQ- 59

Query: 110 SSGGSGVLVRGISNSDFSYLQNSFSRF-----YGNVSNDFDRGKGVIIGKDLARNLGISI 164
            S   G LVRGI       L+ + S        G +    D   G+++GKDLA  +G++ 
Sbjct: 60  GSRVRGTLVRGIDVE----LEKTVSTIGDKVIQGELEALTDGSFGIVLGKDLAIAMGVAT 115

Query: 165 GDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAV 224
           GDKI +++P+   TP G+  R K  TV+G+F +   +YD+ +  M++ +A   F +   V
Sbjct: 116 GDKITLITPHVSPTPAGVIPRLKRLTVVGVFEIGMYEYDSSLAIMNITDAAKLFKIPGKV 175

Query: 225 SGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES 270
           +G+ +   D     +   N+++ +       DW  ++  FF   ++
Sbjct: 176 TGLRLEFDDVFKAPQLLRNVMQDVSTQYRGADWTYQHANFFRALKT 221


>gi|254456043|ref|ZP_05069472.1| ABC transporter [Candidatus Pelagibacter sp. HTCC7211]
 gi|207083045|gb|EDZ60471.1| ABC transporter [Candidatus Pelagibacter sp. HTCC7211]
          Length = 411

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 78/273 (28%), Positives = 143/273 (52%), Gaps = 20/273 (7%)

Query: 5   SRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGI 64
           S  E  + +R+L + +K+ F++I S  SFIG+ +GV  LI+VMSVMNGFR ++I +++G 
Sbjct: 3   STLEKEITFRFLKARKKDGFLNIISIFSFIGISLGVAVLIIVMSVMNGFRTELINKIVGF 62

Query: 65  NGHVVIQ--------QKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGV 116
           N H+ ++        Q      + + I+N + F           SG+A +   ++   G+
Sbjct: 63  NSHITVKSYEENGINQNKLKNNNLKLISNDIIFSN---------SGEAIILK-NNTSKGI 112

Query: 117 LVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           ++RG  + DFS L    ++ +  + +  D    + IG +L+ +L + IGDKI ++SP G 
Sbjct: 113 VLRGYKSDDFSKLTIIKNKKFKGIRSHLDEN-SISIGNELSFSLDLKIGDKITLMSPSGV 171

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
            T +G   + K + V  +F     D+DN +  ++L     +F  E     +E+++K+P+ 
Sbjct: 172 ETIIGSMPKQKIFKVTSIFNSGLADFDNNIALINLDTLDDFFGFEKKDRNLEIYLKNPNN 231

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           IE T + IV+ + +   +  W    +  FS  +
Sbjct: 232 IE-TQKQIVQEIFDQEFIYTWADMNKSLFSALK 263


>gi|21231570|ref|NP_637487.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66768309|ref|YP_243071.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|188991448|ref|YP_001903458.1| ABC transporter-type lipoprotein-releasing protein [Xanthomonas
           campestris pv. campestris str. B100]
 gi|21113256|gb|AAM41411.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           campestris pv. campestris str. ATCC 33913]
 gi|66573641|gb|AAY49051.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           campestris pv. campestris str. 8004]
 gi|167733208|emb|CAP51406.1| ABC transporter-type lipoprotein-releasing protein [Xanthomonas
           campestris pv. campestris]
          Length = 416

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 65/259 (25%), Positives = 124/259 (47%), Gaps = 4/259 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 4   MFKPIPVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 63

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
            +  H  +  +  P+ D++         P +    P++  ++ + G        +VRG+ 
Sbjct: 64  QMAAHATVSAEGAPMQDWRHAVEVASADPRIAGAAPYIETESLLQGPRK--QPAIVRGVI 121

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            S+ + +     +      +    G   ++IGK+LA  LG+ +GD I +L      TP+G
Sbjct: 122 PSEEAKVSVLAKKMQQGSVDSLTPGSYNIVIGKELALWLGVDVGDSIVVLLSDTQATPLG 181

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R K +TV G+F   + + D G+  +++++      ++  V+G+ + + D D      
Sbjct: 182 AMPRLKRFTVSGIFEAGYNEIDRGLAVVNMEDLARVLRMDG-VTGVRLRLHDMDQAFTVA 240

Query: 242 ENIVRILGNGVVVIDWQQR 260
            ++   L     V DW Q 
Sbjct: 241 RDLALKLRGPYRVSDWTQE 259


>gi|229589096|ref|YP_002871215.1| putative lipoprotein releasing system, membrane protein
           [Pseudomonas fluorescens SBW25]
 gi|229360962|emb|CAY47822.1| putative lipoprotein releasing system, membrane protein
           [Pseudomonas fluorescens SBW25]
          Length = 414

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 126/269 (46%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N F+S  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLSIFIGTRYTRAKRRNRFVSFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     P+ D+Q +A      P+V   +PF       S        + + GI 
Sbjct: 61  GMVPHATI-VGVNPINDWQPVAAAAMKNPEVTAAVPFTQMDGMFS-YKGAMQPIEISGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +    +            +D   G+ GV++G+  AR   +++GDK+ ++ P     P G
Sbjct: 119 PAQEGKVSIVAQHIVRGKLDDLKPGEFGVVVGEITARRFRLNVGDKLTLIVPEISTAPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFP-DYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           +  R +   V+G+F++    D    M++M+   A++     N V  + + VKD  A  K 
Sbjct: 179 ITPRMQRLNVVGIFKVGAELDGSMAMIHMA-DAAEIQHWQPNQVQSVRLAVKDLYAAPKV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +I   LG G    DW       FS  +
Sbjct: 238 SADIAASLGAGYKPDDWTHTQGSLFSAMK 266


>gi|294624870|ref|ZP_06703527.1| ABC transporter-type lipoprotein-releasing protein [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
 gi|292600829|gb|EFF44909.1| ABC transporter-type lipoprotein-releasing protein [Xanthomonas
           fuscans subsp. aurantifolii str. ICPB 11122]
          Length = 413

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 123/261 (47%), Gaps = 8/261 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFKPIPVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI- 121
            +  H  +  +  P+ D+Q         P V    P++  ++ + G        +VRG+ 
Sbjct: 61  QMAAHATVSAEGAPMRDWQHAVEVAMSDPRVAGAAPYIETESLLQGPRK--QPAIVRGVI 118

Query: 122 --SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
                  S L     +  G+V +       ++IGK+L   LG+ +GD I +L      TP
Sbjct: 119 PAEEGKVSVLAKKMQQ--GSVDSLTPGSYNIVIGKELGLWLGVDVGDSIVVLLSDTQATP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           +G   R K +TV G+F   + + D G+  +++Q+      ++  V+G+ + + D D    
Sbjct: 177 LGAMPRLKRFTVSGIFEAGYNEIDRGLAVVNMQDLARVLRMDG-VTGVRLRLHDMDQAWP 235

Query: 240 THENIVRILGNGVVVIDWQQR 260
              ++   L     V DW Q 
Sbjct: 236 VARDLAVKLHGPYRVSDWTQE 256


>gi|114047311|ref|YP_737861.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Shewanella sp. MR-7]
 gi|113888753|gb|ABI42804.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella sp. MR-7]
          Length = 410

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 131/270 (48%), Gaps = 9/270 (3%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RF + V +RY  + + NAF S  +  +  G+ +GV ALIVV SVMNG    + +R+LG  
Sbjct: 4   RFPLYVGYRYWRARKANAFASFITLFAVSGIFLGVAALIVVSSVMNGLEGQLKQRILGAV 63

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
             + +  +  PL D+   A++L  +P V  V P VS QA V   ++    V V G+    
Sbjct: 64  PQLTVVTE-TPLSDWTIPADKLKALPGVQGVTPSVSTQAMVQS-AANIRAVQVFGVFPEL 121

Query: 126 FSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV-TPMGMG 183
              L       Y    N+   G+  VI+G +LAR L +S GD + +LS  G V +P+G  
Sbjct: 122 AEKLSMVAQHTYSGAFNELTSGQYKVILGSELARQLKVSPGDTVRLLSGDGVVYSPLGPV 181

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDP---DAIEK 239
              + + V  +F M     D G+ Y+  Q+A+ L     + ++ + +++ DP    A+ K
Sbjct: 182 PSQRKFLVSAVFEMG-SQVDAGVAYIHYQDAKRLMRQPSDEINQLRLYLSDPFMAPALAK 240

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             + ++   G      DW+  Y   FS  +
Sbjct: 241 DVKQVLTQQGIEATTSDWRDTYGHLFSAVK 270


>gi|254372466|ref|ZP_04987955.1| conserved hypothetical protein [Francisella tularensis subsp.
           novicida GA99-3549]
 gi|151570193|gb|EDN35847.1| conserved hypothetical protein [Francisella novicida GA99-3549]
          Length = 434

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 129/237 (54%), Gaps = 8/237 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY+ + ++N FISI S ISF+G+ +GV  LI VMSVMNGF + +  ++L
Sbjct: 15  MFKSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITVMSVMNGFDQQIKSKIL 74

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLD-FIPDVIKVLPFVSGQAFVSGLSSGGSG---VLV 118
            +   + + Q    + D+  +A  ++   P V    P V  Q  +S  +SGGS    V +
Sbjct: 75  MMVPPLKVYQLGGEVTDWPNLAKEVEKSTPSVTAAAPIVESQGLLSA-NSGGSTTAFVQI 133

Query: 119 RGISNS-DFSYLQNSFSRFYGNVSN-DFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
           +GI        L  +     G +S+ D ++G  +++G  LA +LG+ +GDK+ ++ P   
Sbjct: 134 QGIEPKYQTKVLPIAEHIVDGKLSSLDDNQGYNIVLGSVLADDLGVKVGDKVTLIVPKIS 193

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           +TP GM  R K + V G+F + +  YD     ++++ AQ  F   N+VS +++ VK+
Sbjct: 194 LTPAGMIPRIKQFRVSGIFSVSY-QYDAYYAMINIKNAQKVFETGNSVSSLQLSVKN 249


>gi|113970070|ref|YP_733863.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Shewanella sp. MR-4]
 gi|117920730|ref|YP_869922.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Shewanella sp. ANA-3]
 gi|113884754|gb|ABI38806.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella sp. MR-4]
 gi|117613062|gb|ABK48516.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella sp. ANA-3]
          Length = 410

 Score =  107 bits (268), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 81/270 (30%), Positives = 131/270 (48%), Gaps = 9/270 (3%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RF + V +RY  + + NAF S  +  +  G+ +GV ALIVV SVMNG    + +R+LG  
Sbjct: 4   RFPLYVGYRYWRARKANAFASFITLFAVSGIFLGVAALIVVSSVMNGLEGQLKQRILGAV 63

Query: 66  GHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
             + +  +  PL D+   A++L  +P V  V P VS QA V   ++    V V G+    
Sbjct: 64  PQLTVVTE-APLSDWTIPADKLKALPGVQGVTPSVSTQAMVQS-AANIRAVQVFGVFPEL 121

Query: 126 FSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV-TPMGMG 183
              L       Y    N+   G+  VI+G +LAR L +S GD + +LS  G V +P+G  
Sbjct: 122 AEKLSMVAQHTYSGAFNELTSGQYKVILGSELARQLKVSPGDTVRLLSGDGVVYSPLGPV 181

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDP---DAIEK 239
              + + V  +F M     D G+ Y+  Q+A+ L     + ++ + +++ DP    A+ K
Sbjct: 182 PSQRKFLVSAVFEMG-SQVDAGVAYIHYQDAKRLMRQPSDEINQLRLYLSDPFMAPALAK 240

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             + ++   G      DW+  Y   FS  +
Sbjct: 241 DVKQVLTQQGIEATTSDWRDTYGHLFSAVK 270


>gi|262368626|ref|ZP_06061955.1| outer membrane lipoproteins ABC transporter membrane protein
           [Acinetobacter johnsonii SH046]
 gi|262316304|gb|EEY97342.1| outer membrane lipoproteins ABC transporter membrane protein
           [Acinetobacter johnsonii SH046]
          Length = 411

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/271 (27%), Positives = 131/271 (48%), Gaps = 10/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  + +S IG+ +GV  LI V+SVMNGF  ++  RVL
Sbjct: 1   MFKPISLYIGLRYTRARRSNHFISFIALVSMIGLTLGVAVLITVLSVMNGFDRELKTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+     +      L D+  +A +++    V  V PF   Q  ++      +G++V GI 
Sbjct: 61  GMIPQATVSSTQI-LTDWPELAKKIETKEHVTGVAPFTQLQGMLTA-QGQVAGIMVTGIE 118

Query: 123 ---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
                  S +Q+      G + N   +G+ G+++GK +   LG+ + D + ++ P    +
Sbjct: 119 PQYEKKVSIIQDHMVE--GGIDN-LKKGEFGIVLGKQMTDALGLGLNDSVTLVLPEATPS 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + ++G+F +   + D+ M Y++L +A     L +   GI + + D  A  
Sbjct: 176 PAGVVPRFKRFKIVGIFSIG-AEVDSMMGYIALNDASTLLRLPDGAQGIRLKLDDIFAAP 234

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           K  + IV  L +G    +W   +   FS  +
Sbjct: 235 KVADEIVMDLPSGFYASNWTYTHGNLFSAIQ 265


>gi|169632696|ref|YP_001706432.1| outer membrane lipoproteins ABC transporter membrane protein
           [Acinetobacter baumannii SDF]
 gi|169151488|emb|CAP00244.1| transport protein of outer membrane lipoproteins (ABC superfamily,
           membrane) [Acinetobacter baumannii]
          Length = 411

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 70/271 (25%), Positives = 134/271 (49%), Gaps = 10/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  + +S +G+ +GV  LI V+SVMNGF  ++  RVL
Sbjct: 1   MFKPISLYIGLRYTRARRSNHFISFIALVSMVGLTLGVAVLITVLSVMNGFDRELKNRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+     +      L D+  +  R++  P +  V PF   Q  ++      +G++V GI 
Sbjct: 61  GMVPQATVSSTQI-LTDWPELVKRVENHPHMTGVAPFTQLQGMLTA-QGQVAGIMVTGID 118

Query: 123 ---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
                + S +QN          +   +G+ G+++GKD+A +LG+ + D + ++ P    +
Sbjct: 119 PKYEKNVSIIQN---HIVAGSLDSLKKGEFGIVLGKDMADSLGLRLNDSVTLVLPEATPS 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + V+G+F +   + D+ + Y++L +A     L +   G+ + + D  A  
Sbjct: 176 PAGVVPRFKRFKVVGIFSVG-AEVDSMVGYIALYDASTLLRLPDGAQGVRLKLDDIFAAP 234

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +  ++IV+ L +     +W   +   F+  +
Sbjct: 235 QVADDIVKNLPSNFYATNWTYTHGNLFNAIQ 265


>gi|50085711|ref|YP_047221.1| outer membrane lipoproteins ABC transporter membrane protein
           [Acinetobacter sp. ADP1]
 gi|11345437|gb|AAG34708.1|AF320001_1 putative integral membrane protein [Acinetobacter sp. BD413]
 gi|49531687|emb|CAG69399.1| transport protein of outer membrane lipoproteins (ABC superfamily,
           membrane) [Acinetobacter sp. ADP1]
          Length = 411

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 74/271 (27%), Positives = 133/271 (49%), Gaps = 10/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  + +S IG+ +GV  LI V+SVMNGF  ++  RVL
Sbjct: 1   MFKPISLYIGLRYTRARRSNHFISFIALVSMIGLTLGVAVLITVLSVMNGFDRELKNRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+     I      L ++  +A +++    V+ V PF   Q  ++      +G++V GI 
Sbjct: 61  GMVPQATISSTQI-LTNWPELAKKVEGHKHVVGVAPFTQLQGMLTA-QGQVAGIMVSGID 118

Query: 123 ---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
                  S +QN      G++ N   +G+ G+++GK +   LG+ + D + ++ P    +
Sbjct: 119 PQYEKKVSIIQNHM--VAGSIDN-LKKGEFGIVLGKQMTDALGLGLNDNVTLVLPEATPS 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + ++G+F +   + D+ M Y++L +A     L +   GI + + D  A  
Sbjct: 176 PAGVVPRFKRFKIVGIFSIG-AEVDSMMGYIALNDASTLLRLPDGAQGIRLKLDDIFAAP 234

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +  ++IVR L       +W   +   FS  +
Sbjct: 235 QVADDIVRTLPPNFYASNWTYTHGNLFSAIQ 265


>gi|90408102|ref|ZP_01216272.1| hypothetical protein PCNPT3_08165 [Psychromonas sp. CNPT3]
 gi|90310788|gb|EAS38903.1| hypothetical protein PCNPT3_08165 [Psychromonas sp. CNPT3]
          Length = 408

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/271 (29%), Positives = 131/271 (48%), Gaps = 11/271 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  S R NAF+S  S  S  G+ +GV+ALI V+SVMNGF  ++  R+L
Sbjct: 1   MFYPLSLFIGLRYTKSKRNNAFVSFVSLFSTGGITLGVLALITVLSVMNGFESELKTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG-SGVLVRGI 121
           G   HV +      L  ++++   L+  PDV    P VS  A +  LS+    GV V GI
Sbjct: 61  GAVPHVSVSNNAQLLTKWEYLLPILENNPDVRAADPMVSSDAII--LSNKNIQGVHVDGI 118

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGD-VTP 179
               +S      S   G +S   + GK  +++G  L R L + +GDK+ ++S  G   TP
Sbjct: 119 YPQRYSSQVLMNSMLPGTLSR-LEAGKYRILMGDRLGRLLSVDVGDKVRVVSARGSRFTP 177

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPDAIE 238
           +G     + +TV G F +   D D  ++ M   +A     + +N ++ I +++ DP  IE
Sbjct: 178 LGRLPSERKFTVAGFFSVG-SDVDQNLILMHATDASKLIRIAKNNITDIRLYLNDPFDIE 236

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
                    L   + + DW+  +   F+  +
Sbjct: 237 SWTPP---TLDASLALTDWRSTHGELFAAVK 264


>gi|320324797|gb|EFW80869.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320329163|gb|EFW85160.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330881536|gb|EGH15685.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. glycinea str. race 4]
          Length = 414

 Score =  107 bits (267), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 82/273 (30%), Positives = 136/273 (49%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A+     P+V   +PF   +     LS  GS   ++ IS
Sbjct: 61  GMVPHAVIAGA-TPVDDWKPLADAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 115

Query: 123 NSDFSYLQNSFSRFYGNVS----NDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D   L++  S    +++     D   G+ GV++G   AR   +SIGDK+ ++ P    
Sbjct: 116 GVD-PALEHEVSIVTQHITRGSLEDLKPGEFGVVLGDITARRFRLSIGDKLTLIVPEVSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +   V+G+F++   + D  M  +++ + AQ+     N V G+ + +KD   
Sbjct: 175 APGGITPRLQRLAVVGIFKVG-AELDGSMGLINIADAAQMQRWQPNQVQGVRLALKDLYK 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG G    DW       FS  +
Sbjct: 234 APQVSTAIAAGLGAGYHADDWTHTQGSLFSAMK 266


>gi|190573782|ref|YP_001971627.1| putative lipoprotein releasing system transmembrane protein
           [Stenotrophomonas maltophilia K279a]
 gi|190011704|emb|CAQ45323.1| putative lipoprotein releasing system transmembrane protein
           [Stenotrophomonas maltophilia K279a]
          Length = 413

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 132/263 (50%), Gaps = 12/263 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFKPIPVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRSRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
            +  H  I +   P+ D+  + +     P V    P++  Q+ +SG      G +++GI 
Sbjct: 61  QMTAHTTISRDGEPMPDWMRVVDVARKDPRVAGAAPYIEIQSMISGPRV--QGAIIQGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSN-DFDRGK----GVIIGKDLARNLGISIGDKINILSPYGDV 177
            +    L+   S     V+   +D  K     V++GK+LA  LG+ +GD++ +       
Sbjct: 119 PA----LEPKVSVIDKKVTKGSYDSLKPGSFNVLLGKELAVWLGVDVGDQVLVTFAEVQG 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           TP G   R K +TV G+F   + + D G+ + ++Q+ +     + A +G+ + + D D  
Sbjct: 175 TPAGAVPRMKRFTVSGIFEAGYNEVDRGVGFANMQDLERVLRSDGA-TGVRLKLHDMDRS 233

Query: 238 EKTHENIVRILGNGVVVIDWQQR 260
            +   ++ + LG    V DW Q+
Sbjct: 234 LEVGVDLAQSLGGAYRVSDWTQQ 256


>gi|227015814|gb|ACP17911.1| putative LolC/E family lipoprotein releasing system [Pseudomonas
           nitroreducens]
          Length = 415

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 75/275 (27%), Positives = 133/275 (48%), Gaps = 16/275 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N +IS  S  S IG+ +GV+A+IVV+SVMNGF+++M  R+L
Sbjct: 1   MFRPLSVFIGTRYTRAKRRNHYISFISLTSMIGLALGVLAMIVVLSVMNGFQKEMRSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPF--VSGQAFVSGLSSGGSGVLVRG 120
           G+  H V+QQ   PL D+Q +A      P ++  +P+  V G     G+      + V G
Sbjct: 61  GMVPHAVLQQAGGPLDDWQRVAEVAKKNPQIVGAVPYTEVDGMLSYKGMM---QPIEVDG 117

Query: 121 ISNSDFSYLQNSFS-----RFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYG 175
           +  +    L+   S       +G + +      GV+IG+  AR   + +GD + ++ P  
Sbjct: 118 VDPA----LETQVSIIGQHMVHGRLEDLKASEFGVVIGEITARRFHVGVGDSLLLIVPEP 173

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDP 234
              P G+  R +   V+G+F++   + D+ +  + + +A      +   V  + + +KD 
Sbjct: 174 STAPGGITPRMQRLNVVGIFKVG-AELDSTLALIHVDDAASLMRWQPGQVQSVRIALKDL 232

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    I + LG+G   +DW       FS  +
Sbjct: 233 FQAPEVGAAIAKQLGDGYRSVDWTHTQGSLFSAMK 267


>gi|240080669|ref|ZP_04725212.1| LolC [Neisseria gonorrhoeae FA19]
 gi|240118016|ref|ZP_04732078.1| LolC [Neisseria gonorrhoeae PID1]
 gi|240123570|ref|ZP_04736526.1| LolC [Neisseria gonorrhoeae PID332]
          Length = 394

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/253 (28%), Positives = 131/253 (51%), Gaps = 15/253 (5%)

Query: 25  ISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIA 84
           +S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  H  I        D++ + 
Sbjct: 1   MSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAPHAEIGYIDNTDTDWRNLL 60

Query: 85  NRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNSDFSYL-----QNSFSRFY 137
              +    ++   P+VS QA    L++ G   GV +RGI  S+   +     +    +F 
Sbjct: 61  RFAENRKGILAAAPYVSNQAL---LANAGEIRGVQIRGILPSEERKVVEYGDKMPAGKFE 117

Query: 138 GNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRM 197
             +  +FD    +I+G  LA  LG  +G K+ +++P G+VTP G+  R K +TV+G+ + 
Sbjct: 118 DLIPGEFD----IILGVGLAEALGAEVGGKVTVITPEGNVTPAGIVPRLKQFTVVGLVKT 173

Query: 198 RFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIEKTHENIVRILGNGVVVID 256
              + DN +    +Q+A++ + L+  V+G+ + + DP +A   T   I     + V V D
Sbjct: 174 GVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPALTATLIPEAQRDTVWVRD 233

Query: 257 WQQRYQIFFSCYE 269
           W    + +F   E
Sbjct: 234 WTYSNRSYFEAVE 246


>gi|239998980|ref|ZP_04718904.1| LolC [Neisseria gonorrhoeae 35/02]
 gi|240016545|ref|ZP_04723085.1| LolC [Neisseria gonorrhoeae FA6140]
 gi|240112966|ref|ZP_04727456.1| LolC [Neisseria gonorrhoeae MS11]
 gi|240125752|ref|ZP_04738638.1| LolC [Neisseria gonorrhoeae SK-92-679]
 gi|240128274|ref|ZP_04740935.1| LolC [Neisseria gonorrhoeae SK-93-1035]
          Length = 394

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/253 (28%), Positives = 131/253 (51%), Gaps = 15/253 (5%)

Query: 25  ISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIA 84
           +S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  H  I        D++ + 
Sbjct: 1   MSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAPHAEIGYIDNTDTDWRNLL 60

Query: 85  NRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNSDFSYL-----QNSFSRFY 137
              +    ++   P+VS QA    L++ G   GV +RGI  S+   +     +    +F 
Sbjct: 61  RFAENRKGILAAAPYVSNQAL---LANAGEIRGVQIRGILPSEERKVVEYGDKMPAGKFE 117

Query: 138 GNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRM 197
             +  +FD    +I+G  LA  LG  +G K+ +++P G+VTP G+  R K +TV+G+ + 
Sbjct: 118 DLIPGEFD----IILGVGLAEALGAEVGGKVTVITPEGNVTPAGVVPRLKQFTVVGLVKT 173

Query: 198 RFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIEKTHENIVRILGNGVVVID 256
              + DN +    +Q+A++ + L+  V+G+ + + DP +A   T   I     + V V D
Sbjct: 174 GVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPALTATLIPEAQRDTVWVRD 233

Query: 257 WQQRYQIFFSCYE 269
           W    + +F   E
Sbjct: 234 WTYSNRSYFEAVE 246


>gi|71083601|ref|YP_266320.1| ABC transporter [Candidatus Pelagibacter ubique HTCC1062]
 gi|91761978|ref|ZP_01263943.1| ABC transporter [Candidatus Pelagibacter ubique HTCC1002]
 gi|71062714|gb|AAZ21717.1| ABC transporter [Candidatus Pelagibacter ubique HTCC1062]
 gi|91717780|gb|EAS84430.1| ABC transporter [Candidatus Pelagibacter ubique HTCC1002]
          Length = 410

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 78/265 (29%), Positives = 137/265 (51%), Gaps = 5/265 (1%)

Query: 5   SRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGI 64
           S  E  +  RYL + +K+ F++I S  SFIG+ +GV  LI+VMSVMNGFR ++I +++G 
Sbjct: 3   SALEKEITLRYLKTRKKDGFLNIISIFSFIGISLGVAVLIIVMSVMNGFRSELINKIVGF 62

Query: 65  NGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
           N HV ++     +   +  +  L  I    +++   SG+A V    +   G+++RG S  
Sbjct: 63  NAHVTVKPYETSINLEKLNSENLKLISK--ELILSNSGEAIVIS-KNYTKGLILRGYSRE 119

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGI 184
           +F  L           SN   +   + IGK+L+ NL +S+GDK++I+SP G  T +G   
Sbjct: 120 NFLKLDVVKKGNLIGKSNQLTKN-SISIGKELSFNLDLSVGDKVSIMSPVGIETIIGSLP 178

Query: 185 RSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENI 244
           R +++ +  +F     D+D  + +++L+  + +F+ +     +E+++  P  IE+    I
Sbjct: 179 RQETFIIRSIFDSGLADFDANIAFINLETLENFFSFKKEDRNLEIYLNKPSNIEEAKNKI 238

Query: 245 VRILGNGVVVIDWQQRYQIFFSCYE 269
             I  N  V   W       FS  +
Sbjct: 239 QEIFKNEFVY-SWADMNSSLFSALK 262


>gi|240014110|ref|ZP_04721023.1| LolC [Neisseria gonorrhoeae DGI18]
 gi|240115720|ref|ZP_04729782.1| LolC [Neisseria gonorrhoeae PID18]
 gi|240121672|ref|ZP_04734634.1| LolC [Neisseria gonorrhoeae PID24-1]
          Length = 394

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 73/253 (28%), Positives = 131/253 (51%), Gaps = 15/253 (5%)

Query: 25  ISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIA 84
           +S  + +S  G+ +GV ALIVV+SVMNGF++++  ++L +  H  I        D++ + 
Sbjct: 1   MSFITMVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAPHAEIGYIDNTDTDWRNLL 60

Query: 85  NRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNSDFSYL-----QNSFSRFY 137
              +    ++   P+VS QA    L++ G   GV +RGI  S+   +     +    +F 
Sbjct: 61  RFAENRKGILAAAPYVSNQAL---LANAGEIRGVQIRGILPSEERKVVEYGDKMPAGKFE 117

Query: 138 GNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRM 197
             +  +FD    +I+G  LA  LG  +G K+ +++P G+VTP G+  R K +TV+G+ + 
Sbjct: 118 DLIPGEFD----IILGIGLAEALGAEVGGKVTVITPEGNVTPAGIVPRLKQFTVVGLVKT 173

Query: 198 RFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIEKTHENIVRILGNGVVVID 256
              + DN +    +Q+A++ + L+  V+G+ + + DP +A   T   I     + V V D
Sbjct: 174 GVYEVDNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPALTATLIPEAQRDTVWVRD 233

Query: 257 WQQRYQIFFSCYE 269
           W    + +F   E
Sbjct: 234 WTYSNRSYFEAVE 246


>gi|304322125|ref|YP_003855768.1| hypothetical protein PB2503_12944 [Parvularcula bermudensis
           HTCC2503]
 gi|303301027|gb|ADM10626.1| hypothetical protein PB2503_12944 [Parvularcula bermudensis
           HTCC2503]
          Length = 429

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 80/272 (29%), Positives = 134/272 (49%), Gaps = 8/272 (2%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           F RFE  VA RYL + R+ A +S+ + I+F G+M+ V  LIVVMSV  GFR +++ ++L 
Sbjct: 14  FGRFEWSVARRYLGATRRGAGVSLITLIAFSGIMLSVATLIVVMSVFQGFRVNLLSQLLS 73

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +NGHV +Q      VD     +R++ +  V +  P +  + ++ G   G S     GI+ 
Sbjct: 74  VNGHVFVQNTES--VDRAQQISRIEDLTFVKRATPVLRIETYLVG-PRGQSAAQTIGITA 130

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRG----KGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
            D   +++          + F  G    + V IG  L+R LG S+GD I+ ++  G  TP
Sbjct: 131 EDLRAIEDIADGVRAGSLDTFGAGETGQREVAIGVGLSRLLGASVGDVISAITAGGAETP 190

Query: 180 MGMGIRSK-SYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
            G    ++  Y V  +F +    +D   +Y+ L++AQ +      V+ IE+ + DP   +
Sbjct: 191 FGRTPTTQIQYRVGAIFSVGNSFFDQYYMYLPLEQAQRFARRPGEVTEIELRISDPLTPD 250

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYES 270
                I    G    + DW+ R    F+  ++
Sbjct: 251 LVLPAIQAAAGEAAYLSDWRDRNADLFNAVQA 282


>gi|254480794|ref|ZP_05094041.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [marine gamma proteobacterium HTCC2148]
 gi|214039377|gb|EEB80037.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [marine gamma proteobacterium HTCC2148]
          Length = 420

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 71/266 (26%), Positives = 132/266 (49%), Gaps = 3/266 (1%)

Query: 5   SRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGI 64
           + +   +  RY FS ++N F S+ + +S +G+++GV +LI V+SVMNGF  ++  R+L +
Sbjct: 9   TNYAAFIGLRYSFSRKRNRFTSVIALVSMLGMVLGVTSLITVLSVMNGFGGELRGRILSL 68

Query: 65  NGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQA-FVSGLSSGGSGVLVRGISN 123
             H  ++     + ++Q +A +++ +  V+ V P++S +  F +G +  G GVL      
Sbjct: 69  VPHGFVESPSGGISEWQPLAKKIESMESVLAVSPYISDKVIFANGRTLRG-GVLTAIDPA 127

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
            +    +   +   G++ +    G  V++G  +AR L + +GDK+ +  P   VTP+G+ 
Sbjct: 128 MEARVSRIPEAMISGSLDSLAQPGFSVVLGASMARILRVRVGDKLEVTVPRLTVTPLGVF 187

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHEN 243
            RSK  TV G+F +     D    Y+SL   Q        V G+++   D  +  +T   
Sbjct: 188 PRSKRLTVTGVFEVG-AQPDTYQAYISLPSGQKLLGPRTGVDGLQLKTVDLYSAPQTMLA 246

Query: 244 IVRILGNGVVVIDWQQRYQIFFSCYE 269
           +   +   + V DW Q     F   +
Sbjct: 247 VAASIPANMKVKDWSQTQGSLFQAVK 272


>gi|237797697|ref|ZP_04586158.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331020547|gb|EGI00604.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 414

 Score =  107 bits (266), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 137/273 (50%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A      P+V   +PF   +     LS  GS   ++ IS
Sbjct: 61  GMVPHAVIAGN-TPVGDWKPLAAAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 115

Query: 123 NSDFSYLQNSFSRFYGNVS----NDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D   L++  S    +++     D   G+ GV++G   AR   ++IGDK+ ++ P    
Sbjct: 116 GVD-PALEHEVSIVTQHITRGSIEDLKPGEFGVVLGDLTARRFRLTIGDKLTLIVPEVSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +  TV+G+F++   + D  M  +++ + AQ+     + V G+ + +KD   
Sbjct: 175 APGGITPRMQRLTVVGIFKVG-AELDGSMGLINIADAAQMQRWQPDQVQGVRLALKDLYK 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG+G    DW       FS  +
Sbjct: 234 APQVSTAIAAGLGDGYHADDWTHTQGSLFSAMK 266


>gi|104782716|ref|YP_609214.1| lipoprotein releasing system transmembrane protein LolE
           [Pseudomonas entomophila L48]
 gi|95111703|emb|CAK16427.1| Lipoprotein releasing system transmembrane protein LolE
           [Pseudomonas entomophila L48]
          Length = 414

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 129/269 (47%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  RVL
Sbjct: 1   MFRPLPLFIGARYTRAKRRNHFISFISMTSMIGLSLGVLAMIVVLSVMNGFQREMSSRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I  +  PL D++ +A+  +  P V+   P    +  +S        + V GI 
Sbjct: 61  GLVPHASILGE-QPLDDWRKVASAAEGSPAVLAAAPLTELEGMLS-YKGAMQPIQVAGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            ++   +             D   G+ GV+IG+  AR   ++ GDK+ ++ P     P G
Sbjct: 119 PAEEGKVSIVTQHIVQGSLQDLVPGEYGVVIGELTARRFRLNTGDKLTLIVPEISKEPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEA-QLYFNLENAVSGIEVFVKDPDAIEKT 240
           +  R +  TV+G+F++   + D    Y+ + +A ++       V G+ + ++D  A  + 
Sbjct: 179 ITPRMQRLTVVGIFKVG-AELDGSQAYIHVADAGEMQRWAPGQVQGVRLKLQDLYAAPQV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + I   LG G    DW       FS  +
Sbjct: 238 SKAIAAGLGEGYRADDWSHTQGSLFSAMK 266


>gi|330967931|gb|EGH68191.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 317

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 136/273 (49%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A      P+V   +PF   +     LS  GS   ++ IS
Sbjct: 61  GMVPHAVI-AGAKPVDDWKPLAAAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 115

Query: 123 NSDFSYLQNSFSRFYGNVSN----DFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D   L++  S    +++     D   G+ GV++G   AR   ++IGDK+ ++ P    
Sbjct: 116 GVD-PALEHEVSIVTQHITRGSLADLKPGEFGVVLGDLTARRFRLTIGDKLTLIVPEVSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +  TV+G+F++   + D  M  +++ + AQ+     + V G+ + +KD   
Sbjct: 175 APGGITPRLQRLTVVGIFKVGA-ELDGSMGLINIADAAQMQRWQPDQVQGVRLALKDLYK 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG G    DW       FS  +
Sbjct: 234 APQVSTAIAAGLGEGYHADDWTHTQGSLFSAMK 266


>gi|262277282|ref|ZP_06055075.1| ABC transporter [alpha proteobacterium HIMB114]
 gi|262224385|gb|EEY74844.1| ABC transporter [alpha proteobacterium HIMB114]
          Length = 407

 Score =  106 bits (264), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/268 (28%), Positives = 136/268 (50%), Gaps = 14/268 (5%)

Query: 5   SRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGI 64
           ++ E+++  RYL    K+ F+ + S  SFIG+M+GV  LI+VMSVMNGFR D++ ++LG 
Sbjct: 3   NKAEILIISRYLKPKNKDGFLRVISNFSFIGIMLGVATLIIVMSVMNGFRIDLLDKLLGY 62

Query: 65  NGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
             H+  Q K    ++ + I N        I  L  V+    +    +   GVLV+  S +
Sbjct: 63  QPHISFQSKGKYNLEKESIINFAKKNNFKISDLNLVNNSEALILTQNKNYGVLVKSFSKN 122

Query: 125 ---DFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
              D  +L+NS  +  G V+ +     G+ +G +LA  L + +GD + +LS   + TP G
Sbjct: 123 EIKDIYFLKNSIVK--GKVNEN-----GIGVGLELASKLSLGVGDNLTLLSNNTETTPFG 175

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
           +  +  ++ V  +F     ++DN  +  +L +++ + N EN    IE+ + +PD      
Sbjct: 176 ILPKQFNFKVSFIFNTGMYEFDNNFLISNLDQSKFFSNKENE---IEIRINNPDN-SNNF 231

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            N+++   N  ++  W    + FF   +
Sbjct: 232 TNVLKQKYNDRLIYSWVDSNKTFFDALK 259


>gi|226943587|ref|YP_002798660.1| lipoprotein releasing system, hypothetical protein [Azotobacter
           vinelandii DJ]
 gi|226718514|gb|ACO77685.1| Lipoprotein releasing system, transmembrane protein [Azotobacter
           vinelandii DJ]
          Length = 416

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 80/265 (30%), Positives = 127/265 (47%), Gaps = 11/265 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLSVFIGLRYTGAKRRNHFVSFISLTSMIGLALGVLVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRG 120
           G+  H  I+    P+ D++ +A +    P V+ V PF   Q     L+  G    VL+  
Sbjct: 61  GMVPHATIESP-VPIDDWRSLAAQARTHPQVVAVAPFTQVQGL---LTHDGQVQKVLINA 116

Query: 121 ISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           +  +   ++     F R  G ++     G G++IG   A  LG+ IGD++  ++P   VT
Sbjct: 117 VDPALEPHVSIIGDFFR-QGGLAALQPGGFGILIGDKAAAKLGVGIGDRVTFIAPEVAVT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P GM  R K +TV G+F +   + D  +    L +  +L       V G+ +   D    
Sbjct: 176 PAGMFPRMKRFTVQGIFHVGAGELDGYVAMAHLDDIGRLQRWKSGQVQGLRLRFADLFQA 235

Query: 238 EKTHENIV-RILGNGVVVIDWQQRY 261
            +T   I  R+ G      DW + +
Sbjct: 236 PRTAWAIAERLKGGDFYARDWTRSH 260


>gi|330878582|gb|EGH12731.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 414

 Score =  106 bits (264), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 136/273 (49%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A      P+V   +PF   +     LS  GS   ++ IS
Sbjct: 61  GMVPHAVI-AGTKPVDDWEPLAAAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 115

Query: 123 NSDFSYLQNSFSRFYGNVSN----DFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D   L++  S    +++     D   G+ GV++G   AR   ++IGDK+ ++ P    
Sbjct: 116 GVD-PALEHEVSIVTQHITRGSLADLKPGEFGVVLGDLTARRFRLTIGDKLTLIVPEVSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +  TV+G+F++   + D  M  +++ + AQ+     + V G+ + +KD   
Sbjct: 175 APGGITPRLQRLTVVGIFKVG-AELDGSMGLINIADAAQMQRWQPDQVQGVRLALKDLYK 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG G    DW       FS  +
Sbjct: 234 APQVSTAIAAGLGEGYHADDWTHTQGSLFSAMK 266


>gi|254523972|ref|ZP_05136027.1| lipoprotein releasing system transmembrane protein
           [Stenotrophomonas sp. SKA14]
 gi|219721563|gb|EED40088.1| lipoprotein releasing system transmembrane protein
           [Stenotrophomonas sp. SKA14]
          Length = 413

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 132/263 (50%), Gaps = 12/263 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFKPIPVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRSRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
            +  H  I +   P+ D+  + +     P V    P++  Q+ +SG      G +++GI 
Sbjct: 61  QMTAHTTISRDGEPMPDWMRVVDIASKDPRVAGAAPYIEIQSMISGPRV--QGAIIQGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSN-DFDRGK----GVIIGKDLARNLGISIGDKINILSPYGDV 177
            +    L+   S     V+   +D  K     +++GK+LA  LG+ +GD++ +       
Sbjct: 119 PA----LEPKVSVIDKKVTKGSYDSLKPGSFNLLLGKELAIWLGVDVGDQVLVTFAEVQG 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           TP G   R K +TV G+F   + + D G+ + ++Q+ +     + A +G+ + + D D  
Sbjct: 175 TPAGAVPRMKRFTVSGIFEAGYNEVDRGVGFANMQDLERVLRSDGA-TGVRLKLHDMDRS 233

Query: 238 EKTHENIVRILGNGVVVIDWQQR 260
            +   ++ + LG    V DW Q+
Sbjct: 234 LEVGVDLAQSLGGAYRVSDWTQQ 256


>gi|226226986|ref|YP_002761092.1| lipoprotein releasing system transmembrane protein LolC
           [Gemmatimonas aurantiaca T-27]
 gi|226090177|dbj|BAH38622.1| lipoprotein releasing system transmembrane protein LolC
           [Gemmatimonas aurantiaca T-27]
          Length = 416

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 82/277 (29%), Positives = 131/277 (47%), Gaps = 12/277 (4%)

Query: 4   FSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL- 62
            +R E+ +AWRYL S R +  +S+ S I+  GV++GV ALIV+M VM G + DM +++L 
Sbjct: 1   MTRLELSIAWRYLRSRRGSRLLSLISVIAIGGVLVGVSALIVIMGVMTGMQTDMREKILV 60

Query: 63  -GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
              +  V+       +  +Q +  ++   P V+   PFVS Q  V  LS   +G  V G+
Sbjct: 61  GSPDVRVLPYGDDMRMTGWQPLLEKVRVFPGVVSAAPFVSTQGLVRNLSGYMTGTAVVGL 120

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGK------GVIIGKDLARNLGISIGDKINILSPYG 175
             ++      +  R +  V  DF   +      G  +GK LA  L    GD I +L   G
Sbjct: 121 VGANEPGADVTSIRKH-IVLGDFSLAREGVSLPGAALGKFLASKLNAFPGDTIVLLGAAG 179

Query: 176 -DVTPMGMGI--RSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
            D+      I  R+ S  V G+F     +YD+  +++ L  AQ +  L + V+GIE    
Sbjct: 180 LDMNAATGAIVPRADSVVVAGVFETGMYEYDDAYLFLPLAAAQRFAGLGDDVTGIEARTT 239

Query: 233 DPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           D        +++   L   V  +DWQ+  + FF   +
Sbjct: 240 DRWQTPAIADSLEVSLNAPVRAVDWQENNRSFFQALK 276


>gi|213967348|ref|ZP_03395496.1| lipoprotein releasing system transmembrane protein LolE
           [Pseudomonas syringae pv. tomato T1]
 gi|301381686|ref|ZP_07230104.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. tomato Max13]
 gi|302058444|ref|ZP_07249985.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. tomato K40]
 gi|302131151|ref|ZP_07257141.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|213927649|gb|EEB61196.1| lipoprotein releasing system transmembrane protein LolE
           [Pseudomonas syringae pv. tomato T1]
 gi|331019548|gb|EGH99604.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 414

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 136/273 (49%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPLFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A      P+V   +PF   +     LS  GS   ++ IS
Sbjct: 61  GMVPHAVIAGA-KPVDDWKPLAEAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 115

Query: 123 NSDFSYLQNSFSRFYGNVSN----DFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D   L++  S    +++     D   G+ GV++G   AR   ++IGDK+ ++ P    
Sbjct: 116 GVD-PALEHEVSIVTQHITRGSLADLKPGEFGVVLGDLTARRFRLTIGDKLTLIVPEVSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +  TV+G+F++   + D  M  +++ + AQ+     + V G+ + +KD   
Sbjct: 175 APGGITPRLQRLTVVGIFKVG-AELDGSMGLINIADAAQMQRWQPDQVQGVRLALKDLYK 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG G    DW       FS  +
Sbjct: 234 APQVSTAIASGLGEGYHADDWTHTQGSLFSAMK 266


>gi|257454425|ref|ZP_05619687.1| lipoprotein releasing system transmembrane protein LolC
           [Enhydrobacter aerosaccus SK60]
 gi|257448191|gb|EEV23172.1| lipoprotein releasing system transmembrane protein LolC
           [Enhydrobacter aerosaccus SK60]
          Length = 426

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 75/272 (27%), Positives = 130/272 (47%), Gaps = 10/272 (3%)

Query: 2   SIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRV 61
           ++F    + +  RY  + R N FIS  S IS +G+ +GV  LI V+SVMNGF  ++  R+
Sbjct: 15  AMFRPLALFLGLRYTRAERSNRFISFISLISMVGLTLGVAVLITVLSVMNGFDRELKSRI 74

Query: 62  LG-INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLV 118
           LG +    V   +  P  D+Q +A  +   P V  V PF+  Q     L++ G  +G++V
Sbjct: 75  LGMVPQATVTASEIIP--DWQTLAQTIQKNPKVEAVAPFIQLQGM---LTANGQVAGIMV 129

Query: 119 RGISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
            GI  S    +            +    G+  ++IGK +A +LG+  GD + ++ P    
Sbjct: 130 TGIEPSYEKKVSIIHQHMESGSVDSLKAGQFDIVIGKQMADSLGVKQGDMVTLVLPEASP 189

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           +P G+  R K +TV G++ +  P+ +N M ++ + +A     L     GI + +KD  A 
Sbjct: 190 SPAGVIPRFKRFTVTGVYDIS-PEVNNIMAFIPMNDAATLLRLPAGAQGIRMKLKDLFAA 248

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +  +    +  N ++  DW   +   F   +
Sbjct: 249 PQVAQQAASLAPNMLMPSDWTSTHGNLFGAIQ 280


>gi|317406528|gb|EFV86728.1| lipoprotein releasing system [Achromobacter xylosoxidans C54]
          Length = 426

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 70/255 (27%), Positives = 127/255 (49%), Gaps = 13/255 (5%)

Query: 24  FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYP------- 76
           FIS  +  S  G+ +GV ALIVV+SVMNGF++++  R+L +  H+   + Y P       
Sbjct: 30  FISFIAASSMAGIALGVAALIVVLSVMNGFQKEVRDRMLSVLPHI---ELYIPGAAPERV 86

Query: 77  LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRF 136
           L  +Q  A+     P+V    PFV+ Q  V        GV VRGI  +    + +   + 
Sbjct: 87  LEQWQQFADAAKRNPEVKAGAPFVAAQGMVV-RGQALRGVQVRGIDPATEGNVSDLPRQM 145

Query: 137 YGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMF 195
                 D   G  GV++G +LA  +G+ +GD + +L+P G ++P G   R + +TV+G+F
Sbjct: 146 VAGKLADLKPGGFGVVLGNELADGMGVKVGDTLLMLAPQGSISPAGFAPRMRQFTVVGVF 205

Query: 196 RMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVI 255
                +YD+ + ++  ++A   F  ++  +G+ + + D          +  +L   V+  
Sbjct: 206 SSGHYEYDSSLAFVDNEDAAKVFR-DSGTAGVRLRIADMQKAPDVAAELRNVLPPYVMAS 264

Query: 256 DWQQRYQIFFSCYES 270
           DW +  + +F+  ++
Sbjct: 265 DWSRNNRTWFAAVQT 279


>gi|28869314|ref|NP_791933.1| lipoprotein releasing system transmembrane protein LolE
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|28852555|gb|AAO55628.1| lipoprotein releasing system transmembrane protein LolE
           [Pseudomonas syringae pv. tomato str. DC3000]
          Length = 427

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 136/273 (49%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 14  MFRPLPLFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 73

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A      P+V   +PF   +     LS  GS   ++ IS
Sbjct: 74  GMVPHAVIAGA-KPVDDWKPLAEAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 128

Query: 123 NSDFSYLQNSFSRFYGNVSN----DFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D   L++  S    +++     D   G+ GV++G   AR   ++IGDK+ ++ P    
Sbjct: 129 GVD-PALEHEVSIVTQHITRGSLADLKPGEFGVVLGDLTARRFRLTIGDKLTLIVPEVSS 187

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +  TV+G+F++   + D  M  +++ + AQ+     + V G+ + +KD   
Sbjct: 188 APGGITPRLQRLTVVGIFKVG-AELDGSMGLINIADAAQMQRWQPDQVQGVRLALKDLYK 246

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG G    DW       FS  +
Sbjct: 247 APQVSTAIASGLGEGYHADDWTHTQGSLFSAMK 279


>gi|695785|emb|CAA58844.1| orf4 [Zymomonas mobilis]
          Length = 203

 Score =  105 bits (263), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 70/195 (35%), Positives = 103/195 (52%), Gaps = 7/195 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           I S +E I+A RYL   +  AFI + + IS + V +GV ALI+VMSVMNGFR ++  +++
Sbjct: 2   ILSAYERIIARRYLLPGKGEAFIFLVASISLLAVTLGVAALIIVMSVMNGFRAELFDKIV 61

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           GIN H VIQ     L +++ I       P V   +P +  Q  +   +    GVL+RG++
Sbjct: 62  GIN-HAVIQGYNGELANWRPILEATRKTPGVTSAIPLIE-QPLIDH-AGRVEGVLLRGMA 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +D +      S       N+   G   VIIG  LA  LGI  GD I+++SP G  TP+G
Sbjct: 119 LNDVNNNNLIRSNIREGHLNELKAGSNNVIIGIRLAEQLGIHAGDDISLISPAGQTTPLG 178

Query: 182 MGIRSKSYTVLGMFR 196
              + +   + G  R
Sbjct: 179 ---QCQELCLTGSLR 190


>gi|21242820|ref|NP_642402.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           axonopodis pv. citri str. 306]
 gi|21108306|gb|AAM36938.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           axonopodis pv. citri str. 306]
          Length = 413

 Score =  105 bits (262), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 125/261 (47%), Gaps = 8/261 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFKPIPVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
            +  H  +  +  P+ D+Q           V    P++  ++ + G        +VRG+ 
Sbjct: 61  QMAAHATVSAEGAPMRDWQHAVEVAMSDSRVAGAAPYIETESLLQGPRK--QPAIVRGVI 118

Query: 123 NSD---FSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
            ++    S L     +  G+V +       ++IGK+LA  LG+ +GD I +L      TP
Sbjct: 119 PAEEGKVSVLAKKMQQ--GSVDSLTPGSYNIVIGKELALWLGVDVGDSIVVLLSDTQATP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           +G   R K +TV G+F   + + D G+  +++Q+      ++  V+G+ + + D D    
Sbjct: 177 LGAMPRLKRFTVSGIFEAGYNEIDRGLAVVNMQDLARVLRMDG-VTGVRLRLHDMDQAWP 235

Query: 240 THENIVRILGNGVVVIDWQQR 260
              ++   L     V DW Q 
Sbjct: 236 VARDLAVRLHGPYRVSDWTQE 256


>gi|262373141|ref|ZP_06066420.1| lipoprotein releasing system, transmembrane protein LolE
           [Acinetobacter junii SH205]
 gi|262313166|gb|EEY94251.1| lipoprotein releasing system, transmembrane protein LolE
           [Acinetobacter junii SH205]
          Length = 411

 Score =  105 bits (262), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 72/271 (26%), Positives = 131/271 (48%), Gaps = 10/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  + +S IG+ +GV  LI V+SVMNGF  ++  RVL
Sbjct: 1   MFKPISLYIGLRYTRARRSNHFISFIALVSMIGLTLGVAVLITVLSVMNGFDRELKNRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+     +      L D+  +  +++  P V  V PF   Q  ++      +G++V GI 
Sbjct: 61  GMVPQATVSSTQI-LTDWPELVKKVEDHPHVTGVAPFTQLQGMLTA-QGQVAGIMVTGIE 118

Query: 123 ---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
                  S +QN      GN+     +G+ G+++GKD+   LG+ + D + ++ P    +
Sbjct: 119 PEYEKKVSIIQNHM--VAGNL-GALKKGEFGIVLGKDMTDALGLGLNDSVTLVLPEATPS 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + ++G+F +   + D+ + Y++L +A     L +   G+ + + D  A  
Sbjct: 176 PAGVVPRFKRFKIVGIFSVG-AEVDSMVGYIALNDASTLLRLPDGAQGVRLKLDDIFAAP 234

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           K  + IV  L +     +W   +   F+  +
Sbjct: 235 KVADEIVSQLPSNFYASNWTYTHGNLFNAIQ 265


>gi|325277323|ref|ZP_08142948.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas sp. TJI-51]
 gi|324097513|gb|EGB95734.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas sp. TJI-51]
          Length = 413

 Score =  105 bits (262), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 76/269 (28%), Positives = 126/269 (46%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGARYTRAKRRNHFISFISMTSMIGLSLGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     PL D+  +A+     P V+   P    +  +S        + V GI 
Sbjct: 61  GLVPHAAI-LGVQPLDDWHKVADAALQNPAVMAAAPITEMEGMLS-YKGAMQPIQVSGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            ++ S +             D   G+ GV+IG+  AR   ++ GDK+ ++ P     P G
Sbjct: 119 PAEESKVSIVGQHIVQGRLQDLQPGEFGVVIGELTARRFRLNTGDKLTLIVPEISKEPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEA-QLYFNLENAVSGIEVFVKDPDAIEKT 240
           +  R +  TV+G+F++   + D    Y+ + +A Q+       V G+ + + D  A  + 
Sbjct: 179 ITPRMQRLTVVGIFKVG-AELDGSQAYIHMADAGQMQRWAPGQVQGVRLKLHDLYAAPQV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + I   LG+     DW       FS  +
Sbjct: 238 SKAIAAGLGDAYRADDWSHTQGSLFSAMK 266


>gi|319786915|ref|YP_004146390.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Pseudoxanthomonas suwonensis 11-1]
 gi|317465427|gb|ADV27159.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Pseudoxanthomonas suwonensis 11-1]
          Length = 413

 Score =  105 bits (262), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 123/259 (47%), Gaps = 4/259 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+NAFIS  S  S IG+ +GV  LI  M+VM+GF++++  R+L
Sbjct: 1   MFRPVPVAIGLRYLRAKRRNAFISFISLASIIGIALGVTVLITTMAVMSGFQKEIRDRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
               H  +     P+ ++Q   +     P V    P+V  +A +SG        +VRG++
Sbjct: 61  QFAAHATVSASGEPMREWQQALDVASRDPRVAGAAPYVETEALLSGPRK--QPAMVRGVT 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +    +     +      +    G   +++G++LA  LG+ +GD + ++ P    +PMG
Sbjct: 119 PALEDTVSEIGHKLKSGEEDSLAPGSYNILLGQELALWLGVEVGDPVLVMLPEFQGSPMG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
              R K + V G+F     + D G+  + +++ Q    ++  V+G+ + + D +      
Sbjct: 179 AMPRYKRFIVSGIFEAGHNEIDRGLAVVHMEDLQRVLRMDG-VTGVRLKLHDLNQSYAVA 237

Query: 242 ENIVRILGNGVVVIDWQQR 260
            ++   L     V DW Q 
Sbjct: 238 RDLALQLPGFYRVSDWMQE 256


>gi|161870078|ref|YP_001599248.1| lipoprotein releasing system transmembrane protein lolC [Neisseria
           meningitidis 053442]
 gi|161595631|gb|ABX73291.1| Lipoprotein releasing system transmembrane protein lolC [Neisseria
           meningitidis 053442]
          Length = 389

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 72/248 (29%), Positives = 129/248 (52%), Gaps = 15/248 (6%)

Query: 30  FISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDF 89
            +S  G+ +GV ALIVV+SVMNGF++++  ++L +  H  I        D++ +    + 
Sbjct: 1   MVSIAGIALGVTALIVVLSVMNGFQKEIRGQLLNVAPHAEIGYIDNTDTDWRNLLRFTEN 60

Query: 90  IPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNSDFSYL-----QNSFSRFYGNVSN 142
              ++   P+VS QA    L++ G   GV +RGI  S+   +     +    +F   +  
Sbjct: 61  RKGILAAAPYVSNQAL---LANAGEIRGVQMRGILPSEERKVVEYGDKMPAGKFEDLIPG 117

Query: 143 DFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDY 202
           +FD    +I+G  LA  LG  +G+K+ +++P G+VTP G+  R K +TV+G+ +    + 
Sbjct: 118 EFD----IILGVGLAEALGAEVGNKVTVITPEGNVTPAGVVPRLKQFTVVGLVKTGVYEV 173

Query: 203 DNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP-DAIEKTHENIVRILGNGVVVIDWQQRY 261
           DN +    +Q+A++ + L+  V+G+ + + DP +A   T   I     + V V DW    
Sbjct: 174 DNSLAMTHIQDARVLYRLDKEVAGLRLKLADPQNAPALTATLIPEAQRDTVWVRDWTFSN 233

Query: 262 QIFFSCYE 269
           + +F   E
Sbjct: 234 RSYFEAVE 241


>gi|58696954|ref|ZP_00372446.1| ABC transporter, permease protein [Wolbachia endosymbiont of
           Drosophila simulans]
 gi|58536811|gb|EAL60037.1| ABC transporter, permease protein [Wolbachia endosymbiont of
           Drosophila simulans]
          Length = 364

 Score =  105 bits (261), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 70/226 (30%), Positives = 120/226 (53%), Gaps = 13/226 (5%)

Query: 49  VMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSG 108
           +MNGFR  ++  +LGI+GH+ +        DY  ++  ++ IP ++K  P  + Q  +  
Sbjct: 1   MMNGFRAKLLDSILGIDGHINVYFDRNINSDYYAVSKSIERIPGILKATPMTNDQVII-- 58

Query: 109 LSSGG-SGVLVRGISNSDF---SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISI 164
           +++G  +G +VRG+S  D    + + N+     G+V   FD  +G+IIG  LA  L +  
Sbjct: 59  VANGKIAGSVVRGVSTKDLLDSTAVTNNV--IIGDVKK-FD--EGIIIGARLAEALNVDY 113

Query: 165 GDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAV 224
           GD+I  +S       +G   R K Y V+ +F M   +YDN ++YM L+ AQ +FN +N++
Sbjct: 114 GDEITFISSEEFDALLGEMPRMKKYKVIAIFDMGMFEYDNTLIYMPLKSAQAFFNYKNSI 173

Query: 225 SGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES 270
             IEV V D    +K  + I + +  G+    WQ +   +FS  ++
Sbjct: 174 KNIEVLVDDVTRADKLADAIEKEI--GMEAESWQSQQSHYFSALKT 217


>gi|167623546|ref|YP_001673840.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Shewanella halifaxensis HAW-EB4]
 gi|167353568|gb|ABZ76181.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella halifaxensis HAW-EB4]
          Length = 407

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 79/265 (29%), Positives = 128/265 (48%), Gaps = 12/265 (4%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           + +RY  + + NAF S  +  +  G+++GV ALIVV SVMNG    + +R+LG    + +
Sbjct: 9   IGYRYWRARKSNAFASFITIFAVSGILLGVAALIVVSSVMNGLEGQLKQRILGAVPQLTV 68

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQ 130
             +   +VD+     +L+ +P +I   P ++ QA V   S+ G+   + GI       L 
Sbjct: 69  HSQTA-IVDWPEQVAKLNGLPGIIGATPSITTQAMVQSPSNIGAA-QIYGIYPEQEKSLP 126

Query: 131 NSFSRFYGNVSNDFD---RGK-GVIIGKDLARNLGISIGDKINILSPYGDV-TPMGMGIR 185
           N+  + Y   S DFD    GK  +I+G +LAR L +  GDKI +LS  G V TP+G    
Sbjct: 127 NTTKQVY---SGDFDALESGKYRIILGAELARMLDVVPGDKIRVLSGDGVVYTPLGPVPS 183

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDPDAIEKTHENI 244
            + +TV G+F M     D  + Y+   +AQ L       +  + +++ DP    K    +
Sbjct: 184 QRKFTVAGVFEMG-SQVDATLAYVHHDDAQRLMRQKAGEIKELRLYLDDPFNAAKIAPEV 242

Query: 245 VRILGNGVVVIDWQQRYQIFFSCYE 269
           +      V   DW+  Y   F   +
Sbjct: 243 IDQFAVPVTTTDWRDTYGHLFGAVK 267


>gi|167626561|ref|YP_001677061.1| lipoprotein release ABC transporter permease [Francisella
           philomiragia subsp. philomiragia ATCC 25017]
 gi|167596562|gb|ABZ86560.1| ABC transporter, involved in lipoprotein release, permease
           component [Francisella philomiragia subsp. philomiragia
           ATCC 25017]
          Length = 420

 Score =  105 bits (261), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 125/237 (52%), Gaps = 8/237 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY+ + ++N FISI S ISF+G+ +GV  LI VMSVMNGF + +  R+L
Sbjct: 1   MFRSLPLFIGLRYIRAKKRNRFISIISAISFLGISLGVAVLITVMSVMNGFDQQIKNRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIP-DVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
            +   + + Q    + D+  +A  ++     V    P V  Q  +S  ++GGS      I
Sbjct: 61  MMVPPLKVYQMGGQVTDWPKLAKEVEKSALGVTAAAPIVESQGLLSA-NNGGSTTAFVQI 119

Query: 122 SNSDFSYLQNSFS----RFYGNVSN-DFDRGKGVIIGKDLARNLGISIGDKINILSPYGD 176
              +  Y             G +S+ D + G  +++G  LA +LG+S+GDK+ ++ P   
Sbjct: 120 QGIEPKYQTKVLPIGDHIIEGKLSSLDDNEGYNIVLGSALANSLGVSVGDKVTLIVPKIS 179

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
           +TP GM  R K +TV G+F + +  YD     ++++ AQ  F   N+VS +++ +K+
Sbjct: 180 LTPAGMIPRIKQFTVSGVFSVSY-QYDAYYAMINIKNAQKVFETGNSVSSLQLGLKN 235


>gi|220916313|ref|YP_002491617.1| protein of unknown function DUF214 [Anaeromyxobacter dehalogenans
           2CP-1]
 gi|219954167|gb|ACL64551.1| protein of unknown function DUF214 [Anaeromyxobacter dehalogenans
           2CP-1]
          Length = 655

 Score =  105 bits (261), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 81/285 (28%), Positives = 134/285 (47%), Gaps = 35/285 (12%)

Query: 16  LFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGH-VVIQQKY 74
           LF   +     + + IS  GV IGV AL VV+SVM+GF  D+ K++LG   H +V+    
Sbjct: 236 LFHRPRMPATLLMTLISIGGVAIGVWALTVVLSVMSGFEADLKKKILGHTAHGMVLSYGQ 295

Query: 75  YPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGI----------- 121
               D++ I   +  +  V    PF+  +     LS+G   +G +++GI           
Sbjct: 296 DDFGDWRRIRETVLGVRGVEAATPFLYNEVM---LSTGQNLTGAILKGIDVKTIGSVTDL 352

Query: 122 ----SNSDFSYLQNSFSRFYGNVSNDFDRG------------KGVIIGKDLARNLGISIG 165
                +    +L+            + D G             G++IG++LA  L + +G
Sbjct: 353 PASVQDGRLEWLEAPAEIPLPREGGNGDAGAAPERPRPGRPLPGIVIGRELAHALRVFVG 412

Query: 166 DKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVS 225
           D++N++SP+GD+ P G   +S+ + V  +F     +YD+   Y+SL EAQ +F +E  V+
Sbjct: 413 DQVNLVSPFGDLGPGGPQPKSRPFRVAAVFYSGMYEYDSKFAYISLPEAQRFFGVET-VT 471

Query: 226 GIEVFVKDPDAIEKTHENIVRILGNGVV-VIDWQQRYQIFFSCYE 269
           G+EV V+D DA       +V  LG       DW +  +  FS  +
Sbjct: 472 GLEVKVRDADAARSVMGRVVFALGGWPYRAKDWGELNRSLFSALQ 516


>gi|71735481|ref|YP_274092.1| lipoprotein releasing system transmembrane protein LolE
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|71556034|gb|AAZ35245.1| lipoprotein releasing system transmembrane protein LolE
           [Pseudomonas syringae pv. phaseolicola 1448A]
          Length = 414

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 135/273 (49%), Gaps = 13/273 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+ +FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGMRYTRAKRRKSFISFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H VI     P+ D++ +A+     P+V   +PF   +     LS  GS   ++ IS
Sbjct: 61  GMVPHAVIAGA-TPVDDWKPLADAALKNPEVTAAVPFTDMEGM---LSYKGSMQPIQ-IS 115

Query: 123 NSDFSYLQNSFSRFYGNVS----NDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
             D   L++  S    +++     D   G+ GV++G   AR   +SIGDK+ ++ P    
Sbjct: 116 GVD-PALEHEVSIVTQHITRGSLEDLKPGEFGVVLGDITARRFRLSIGDKLTLIVPEVSS 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
            P G+  R +   V+ +F++   + D  M  +++ + AQ+     N V G+ + +KD   
Sbjct: 175 APGGITPRLQRLAVVSIFKVG-AELDGSMGLINIADAAQMQRWQPNQVQGVRLALKDLYK 233

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +    I   LG G    DW       FS  +
Sbjct: 234 APQVSTAIAAGLGAGYHADDWTHTQGSLFSAMK 266


>gi|330428034|gb|AEC19368.1| lipoprotein releasing system, transmembrane protein [Pusillimonas
           sp. T7-7]
          Length = 423

 Score =  104 bits (260), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 68/255 (26%), Positives = 128/255 (50%), Gaps = 13/255 (5%)

Query: 24  FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYP------- 76
           F+S  +  S  G+ +GV ALIVV+SVMNGF+  +  R+L +  H+   + Y P       
Sbjct: 27  FVSFIAASSMAGIALGVAALIVVLSVMNGFQSQVRDRMLSVLPHI---ELYVPRMAPEQV 83

Query: 77  LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRF 136
           L +++ IA+     P+V    PFV+ Q  +       SGV +RGI+    S + +   + 
Sbjct: 84  LSEWRQIADSAKKNPEVQGTAPFVAAQGMIVR-GEALSGVQIRGIAPDLESDVSDVAGQM 142

Query: 137 YGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMF 195
                +    G   +++G  LA ++G+ +GD + +L+P G ++P G   R + +TV G+F
Sbjct: 143 ISGQLDTLTSGSYSIVLGNQLANSVGVGVGDTVLVLAPQGSISPAGFTPRMRQFTVSGLF 202

Query: 196 RMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVI 255
              + +YD  + +++ ++A   F  ++  SG+ + + D        + +  +L   V   
Sbjct: 203 SSGYYEYDASLAFINYEDAARVFR-DSGASGVRLRIADMQQAPLVAQALRDVLPPYVHAQ 261

Query: 256 DWQQRYQIFFSCYES 270
           DW Q  + +F+  ++
Sbjct: 262 DWTQNNRTWFAAVQT 276


>gi|194365319|ref|YP_002027929.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Stenotrophomonas maltophilia R551-3]
 gi|194348123|gb|ACF51246.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Stenotrophomonas maltophilia R551-3]
          Length = 413

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 70/263 (26%), Positives = 132/263 (50%), Gaps = 12/263 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFKPLPVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRSRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
            +  H  I +   P+ D+  + +     P V    P++  Q+ +SG      G +++GI 
Sbjct: 61  QMTAHTTISRDGEPMPDWMRVVDVARKDPRVAGAAPYIEIQSMISGPRV--QGAIIQGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSN-DFDRGK----GVIIGKDLARNLGISIGDKINILSPYGDV 177
            +    L+   S     V+   +D  K     +++GK+LA  LG+ +GD++ +       
Sbjct: 119 PA----LEPKVSVIDKKVTKGSYDSLKPGSFNLLLGKELAIWLGVDVGDQVLVTFAEVQG 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           TP G   R K +TV G+F   + + D G+ + ++++ +     + A +G+ + + D D  
Sbjct: 175 TPAGAVPRMKRFTVSGLFEAGYNEVDRGVGFANMKDLERVLRSDGA-TGVRLKLHDMDRS 233

Query: 238 EKTHENIVRILGNGVVVIDWQQR 260
            +   ++ + LG    V DW Q+
Sbjct: 234 LEVGVDLAQNLGGAYRVSDWTQQ 256


>gi|311107117|ref|YP_003979970.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Achromobacter xylosoxidans A8]
 gi|310761806|gb|ADP17255.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Achromobacter xylosoxidans A8]
          Length = 426

 Score =  104 bits (259), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 70/256 (27%), Positives = 131/256 (51%), Gaps = 15/256 (5%)

Query: 24  FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYP------- 76
           FIS  +  S  G+ +GV ALIVV+SVMNGF++++  R+L +  H+   + Y P       
Sbjct: 30  FISFIAASSMAGIALGVAALIVVLSVMNGFQKEVRDRMLSVLPHI---ELYIPGAAPERV 86

Query: 77  LVDYQFIANRLDFIPDVIKVLPFVSGQA-FVSGLSSGGSGVLVRGISNSDFSYLQNSFSR 135
           L  +Q  A+  +  P+V    PFV+ Q   V G +    GV VRGI       + +   +
Sbjct: 87  LERWQEFASAAEKNPEVKAGAPFVAAQGMLVRGQAL--RGVQVRGIDPQTEGNVSDLPRQ 144

Query: 136 FYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGM 194
                  D   G  GV++G +LA  +G+ +GD + +++P G ++P G   R + +TV+G+
Sbjct: 145 MVSGKLTDLKPGSFGVVLGNELADGMGVKLGDTLLMMAPQGSISPAGFTPRMRQFTVVGV 204

Query: 195 FRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVV 254
           F     +YD+ + ++  ++A   F  ++  +G+ + V D     +    + ++L   ++ 
Sbjct: 205 FSSGHYEYDSSLAFVDDEDAARVFR-DSGTAGVRLRVADMQRAPEVAAELQKVLPPYMMA 263

Query: 255 IDWQQRYQIFFSCYES 270
            DW +  + +F+  ++
Sbjct: 264 SDWSRNNRTWFAAVKT 279


>gi|126174617|ref|YP_001050766.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Shewanella baltica OS155]
 gi|125997822|gb|ABN61897.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella baltica OS155]
          Length = 410

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 134/273 (49%), Gaps = 17/273 (6%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           F   + +RY  + + NAF S  +  +  G+ +GV ALIVV SVMNG    + +R+LG   
Sbjct: 5   FPFYIGYRYWRARKANAFASFITLFAVSGIFLGVAALIVVSSVMNGLEGQLKQRILGAVP 64

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI----S 122
            + +  +  PLVD+   A+ L  +P V+ V P VS QA V   +S    V V G+    +
Sbjct: 65  QLTVYSE-APLVDWTEQASALKALPGVLGVTPSVSTQAMVQSAAS-IRAVQVYGVFPELA 122

Query: 123 NSDFSYLQNSFS-RFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV-TPM 180
               S  Q+++S  F    S D+     VI+G +LAR L ++ GD + +LS  G V +P+
Sbjct: 123 EKLSSVAQHTYSGAFEQLTSGDYK----VILGSELARQLKVAPGDTVRLLSGDGVVYSPL 178

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDP---DA 236
           G     + + V G+F M     D G+ Y+  Q+A+ L      A+  + +++ DP    A
Sbjct: 179 GPVPSQRKFLVSGIFEMG-SQVDAGVAYIHYQDAKRLMRQPSEAIDQLRLYLADPFSAPA 237

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    ++I+   G      DW+  Y   F   +
Sbjct: 238 LAPKVQDILAKQGVKATTSDWRDTYGHLFGAVK 270


>gi|304408991|ref|ZP_07390612.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella baltica OS183]
 gi|307302994|ref|ZP_07582749.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella baltica BA175]
 gi|304352812|gb|EFM17209.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella baltica OS183]
 gi|306913354|gb|EFN43776.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella baltica BA175]
          Length = 410

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 134/273 (49%), Gaps = 17/273 (6%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           F   + +RY  + + NAF S  +  +  G+ +GV ALIVV SVMNG    + +R+LG   
Sbjct: 5   FPFYIGYRYWRARKANAFASFITLFAVSGIFLGVAALIVVSSVMNGLEGQLKQRILGAVP 64

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI----S 122
            + +  +  PLVD+   A+ L  +P V+ V P VS QA V   +S    V V G+    +
Sbjct: 65  QLTLYSE-APLVDWTEQASALKALPGVLGVTPSVSTQAMVQSATS-IRAVQVYGVFPELA 122

Query: 123 NSDFSYLQNSFS-RFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV-TPM 180
               S  Q+++S  F    S D+     VI+G +LAR L ++ GD + +LS  G V +P+
Sbjct: 123 EKLSSVAQHTYSGAFEQLTSGDYK----VILGSELARQLKVAPGDTVRLLSGDGVVYSPL 178

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDP---DA 236
           G     + + V G+F M     D G+ Y+  Q+A+ L      A+  + +++ DP    A
Sbjct: 179 GPVPSQRKFLVSGIFEMG-SQVDAGVAYIHYQDAKRLMRQPSEAIDQLRLYLADPFSAPA 237

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    ++I+   G      DW+  Y   F   +
Sbjct: 238 LAPKVQDILAKQGVKATTSDWRDTYGHLFGAVK 270


>gi|330829924|ref|YP_004392876.1| lipoprotein releasing system transmembrane protein LolE [Aeromonas
           veronii B565]
 gi|328805060|gb|AEB50259.1| Lipoprotein releasing system transmembrane protein LolE [Aeromonas
           veronii B565]
          Length = 411

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 84/269 (31%), Positives = 138/269 (51%), Gaps = 15/269 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  S R N F+S  S  S  G+ IGV AL+VV+SVMNGF   +  R+L
Sbjct: 5   LFQPLSLAIGLRYAGSKRSNRFVSFISLFSTFGIAIGVAALMVVISVMNGFEGQLKGRIL 64

Query: 63  GINGHVVIQQKYYPL-VDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVR 119
           G+  HVV+  +   +  D Q + + L  +P V+   P +  +     L S G  +GV V+
Sbjct: 65  GVIPHVVVTNQAGRIDADPQGLPD-LAKLPHVVASAPMLDSEGM---LQSPGQLTGVSVQ 120

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGD-V 177
           GI  + +       S+  G   +    G   +++G+ +AR L +SIGD++ ++   G   
Sbjct: 121 GIDPAKWPKDDILHSQMLGGRLDTLQAGHYRIVLGQGVARRLNVSIGDQVRLILTEGTRF 180

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPDA 236
           TP G     + +TV G+F +   D DN +  ++L +AQ    L    V GI +++ DP A
Sbjct: 181 TPFGRVPAQRLFTVSGIFGVGA-DVDNQIALIALGDAQRLLRLPPETVGGIRLWLDDPFA 239

Query: 237 IEKTHENIVRILGNGVVVIDW-QQRYQIF 264
            +   E I   L +G++  DW ++R ++F
Sbjct: 240 AD---EVIKTPLPDGLLWQDWRRERGELF 265


>gi|153000913|ref|YP_001366594.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Shewanella baltica OS185]
 gi|151365531|gb|ABS08531.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella baltica OS185]
          Length = 410

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 134/273 (49%), Gaps = 17/273 (6%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           F   + +RY  + + NAF S  +  +  G+ +GV ALIVV SVMNG    + +R+LG   
Sbjct: 5   FPFYIGYRYWRARKANAFASFITLFAVSGIFLGVAALIVVSSVMNGLEGQLKQRILGAVP 64

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI----S 122
            + +  +  PLVD+   A+ L  +P V+ V P VS QA V   +S    V V G+    +
Sbjct: 65  QLTLYSE-APLVDWTEQASALKALPGVLGVTPSVSTQAMVQSAAS-IRAVQVYGVFPELA 122

Query: 123 NSDFSYLQNSFS-RFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV-TPM 180
               S  Q+++S  F    S D+     VI+G +LAR L ++ GD + +LS  G V +P+
Sbjct: 123 EKLSSVAQHTYSGAFEQLTSGDYK----VILGSELARQLKVAPGDTVRLLSGDGVVYSPL 178

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDP---DA 236
           G     + + V G+F M     D G+ Y+  Q+A+ L      A+  + +++ DP    A
Sbjct: 179 GPVPSQRKFLVSGIFEMG-SQVDAGVAYIHYQDAKRLMRQPSEAIDQLRLYLADPFSAPA 237

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    ++I+   G      DW+  Y   F   +
Sbjct: 238 LAPKVQDILAKQGVKATTSDWRDTYGHLFGAVK 270


>gi|86157506|ref|YP_464291.1| hypothetical protein Adeh_1079 [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774017|gb|ABC80854.1| protein of unknown function DUF214 [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 655

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/284 (29%), Positives = 139/284 (48%), Gaps = 34/284 (11%)

Query: 16  LFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGH-VVIQQKY 74
           LF   +     + + IS  GV IGV AL VV+SVM+GF  D+ K++LG   H +V+    
Sbjct: 237 LFHRPRMPATLLMTLISIGGVAIGVWALTVVLSVMSGFEADLKKKILGHTAHGMVLSYGQ 296

Query: 75  YPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGI------SNSDF 126
               D++ I   +  +  V    PF+  +     LS+G   +G +++GI      S +D 
Sbjct: 297 DDFGDWRRIRETVLGVRGVEAATPFLYNEVM---LSTGQNLTGAILKGIDVKTIGSVTDL 353

Query: 127 -SYLQNSFSRFY---------------GNVSNDFDRG----KGVIIGKDLARNLGISIGD 166
            + +Q+    +                G  + +  R      G++IG++LA  L + +GD
Sbjct: 354 PASVQDGRLEWLDAPAEIPLPRDGGEAGGAAPERPRPGRPLPGIVIGRELAHALRVFVGD 413

Query: 167 KINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSG 226
           ++N++SP+GD+ P G   +S+ + V  +F     +YD+   Y+SL EAQ +F +E  V+G
Sbjct: 414 QVNLVSPFGDLGPGGPQPKSRPFRVAAVFYSGMYEYDSKFAYISLAEAQRFFGVET-VTG 472

Query: 227 IEVFVKDPDAIEKTHENIVRILGNGVV-VIDWQQRYQIFFSCYE 269
           +EV V+D DA       +V  LG       DW +  +  FS  +
Sbjct: 473 LEVKVRDADAARSVMGRVVFALGGWPYRAKDWGELNRSLFSALQ 516


>gi|217973130|ref|YP_002357881.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella baltica OS223]
 gi|217498265|gb|ACK46458.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella baltica OS223]
          Length = 410

 Score =  103 bits (258), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 134/273 (49%), Gaps = 17/273 (6%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           F   + +RY  + + NAF S  +  +  G+ +GV ALIVV SVMNG    + +R+LG   
Sbjct: 5   FPFYIGYRYWRARKANAFASFITLFAVSGIFLGVAALIVVSSVMNGLEGQLKQRILGAVP 64

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI----S 122
            + +  +  PLVD+   A+ L  +P V+ V P VS QA V   +S    V V G+    +
Sbjct: 65  QLTLYSE-APLVDWTEQASALKALPGVLGVTPSVSTQAMVQSAAS-IRAVQVYGVFPELA 122

Query: 123 NSDFSYLQNSFS-RFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV-TPM 180
               S  Q+++S  F    S D+     VI+G +LAR L ++ GD + +LS  G V +P+
Sbjct: 123 EKLSSVAQHTYSGAFEQLTSGDYK----VILGSELARQLKVAPGDTVRLLSGDGVVYSPL 178

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDP---DA 236
           G     + + V G+F M     D G+ Y+  Q+A+ L      A+  + +++ DP    A
Sbjct: 179 GPVPSQRKFLVSGVFEMG-SQVDAGVAYIHYQDAKRLMRQPSEAIDQLRLYLADPFSAPA 237

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    ++I+   G      DW+  Y   F   +
Sbjct: 238 LAPKVQDILAKQGVQATTSDWRDTYGHLFGAVK 270


>gi|77460078|ref|YP_349585.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas fluorescens Pf0-1]
 gi|77384081|gb|ABA75594.1| putative lipoprotein releasing system, membrane protein
           [Pseudomonas fluorescens Pf0-1]
          Length = 414

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 128/271 (47%), Gaps = 9/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N F+S  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLSIFIGTRYTRAKRRNRFVSFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVS--GLSSGGSGVLVRG 120
           G+  H  I     P+ D+Q +A      P+V   +PF   +  +S  G+      + + G
Sbjct: 61  GMVPHATI-VGVKPIDDWQPVAAAAMKNPEVTAAVPFTEMEGMLSYKGMM---QPIQISG 116

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTP 179
           +  +    +            +    G+ GV++G+  AR   +++GDKI ++ P     P
Sbjct: 117 VDPAQEGKVSIVAQHIVQGRLDALKPGEFGVVLGEITARRFRLNVGDKITLIVPEVSTAP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIE 238
            G+  R +   V+G+F++   + D  M  + + +A    + E N V  + + VKD  A  
Sbjct: 177 GGITPRMQRLNVVGVFKVG-AELDGSMGLIHVSDAATMQHWEPNQVQSVRLAVKDLYAAP 235

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           K   +I   LG      DW       FS  +
Sbjct: 236 KVSSDIASGLGADFKADDWTHTQGSLFSAMK 266


>gi|160875621|ref|YP_001554937.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Shewanella baltica OS195]
 gi|160861143|gb|ABX49677.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella baltica OS195]
 gi|315267809|gb|ADT94662.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella baltica OS678]
          Length = 410

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 83/273 (30%), Positives = 134/273 (49%), Gaps = 17/273 (6%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           F   + +RY  + + NAF S  +  +  G+ +GV ALIVV SVMNG    + +R+LG   
Sbjct: 5   FPFYIGYRYWRARKANAFASFITLFAVSGIFLGVAALIVVSSVMNGLEGQLKQRILGAVP 64

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI----S 122
            + +  +  PLVD+   A+ L  +P V+ V P VS QA V   +S    V V G+    +
Sbjct: 65  QLTLYSE-APLVDWTEQASALKALPGVLGVTPSVSTQAMVQSAAS-IRAVQVYGVFPELA 122

Query: 123 NSDFSYLQNSFS-RFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV-TPM 180
               S  Q+++S  F    S D+     VI+G +LAR L ++ GD + +LS  G V +P+
Sbjct: 123 EKLSSVAQHTYSGAFEQLTSGDYK----VILGSELARQLKVAPGDTVRLLSGDGVVYSPL 178

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDP---DA 236
           G     + + V G+F M     D G+ Y+  Q+A+ L       +S + +++ DP    A
Sbjct: 179 GPVPSQRKFLVSGIFEMG-SQVDAGVAYIHYQDAKRLMRQPSKEISQLRLYLADPFSAPA 237

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +    ++I+   G      DW+  Y   F   +
Sbjct: 238 LAPKVQDILAKQGLKATTSDWRDTYGHLFGAVK 270


>gi|262375598|ref|ZP_06068831.1| lipoprotein releasing system, transmembrane protein LolE
           [Acinetobacter lwoffii SH145]
 gi|262309852|gb|EEY90982.1| lipoprotein releasing system, transmembrane protein LolE
           [Acinetobacter lwoffii SH145]
          Length = 413

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/273 (26%), Positives = 131/273 (47%), Gaps = 10/273 (3%)

Query: 1   MSIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKR 60
           M +F    + +  +Y  + R N FIS  + +S IG+ +GV  LI V+SVMNGF  ++  R
Sbjct: 1   MVMFKPISLYIGLKYTRARRSNHFISFIALVSMIGLTLGVAVLITVLSVMNGFDRELKNR 60

Query: 61  VLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           VLG+     +      L ++  +A +++    V  V PF   Q  ++      +G++V G
Sbjct: 61  VLGMIPQATVSSTQI-LTNWPELAKQIEQHEHVQGVAPFTQLQGMLTA-QGQVAGIMVSG 118

Query: 121 IS---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGD 176
           I        S +QN      GN+ +   +G+ G+++GK +   +G+ + D I ++ P   
Sbjct: 119 IEPEYEKKVSIIQNHMVE--GNI-DSLKKGEFGIVLGKQMTDAMGVGLNDNITLVLPEAT 175

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDA 236
            +P G+  R K + V+G+F +   + D+ M Y++L +A     L +   G+ + + D   
Sbjct: 176 PSPAGVVPRFKRFKVVGIFSIG-AEVDSMMGYIALNDASTLLRLPDGAQGVRMKLDDIFL 234

Query: 237 IEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +  + IVR L       DW   +   FS  +
Sbjct: 235 APQVSQEIVRDLPANFYASDWTYTHGNLFSAIQ 267


>gi|146329236|ref|YP_001210109.1| ABC-type lipoprotein releasing system protein LolC [Dichelobacter
           nodosus VCS1703A]
 gi|146232706|gb|ABQ13684.1| ABC-type lipoprotein releasing system protein LolC [Dichelobacter
           nodosus VCS1703A]
          Length = 415

 Score =  103 bits (257), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 68/265 (25%), Positives = 129/265 (48%), Gaps = 8/265 (3%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           + +RY ++ R + F+ + + ++ +G+ IG+ ALIVV+SVMNG    +  ++L +   V +
Sbjct: 8   IGFRYSYARRGSQFVGLNAILAIVGIAIGIAALIVVLSVMNGVMVQVRDKMLSMTAQVSL 67

Query: 71  QQ----KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           +     +  PL D+      L  I  +    P++ GQ  + G      GV+++GI  +  
Sbjct: 68  RSYSDDRMVPL-DFD-PKPYLSPITKIHAWAPYIQGQGLI-GDGQSFQGVVLQGIDPTKE 124

Query: 127 SYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIR 185
             + ++F++           G+ G+I+GK +A  L   +GDKI ++ P    +  G+  R
Sbjct: 125 DKVSSTFAQLDEATRARLVAGEYGIILGKGMAEVLDAHLGDKITVIVPQVTASAAGLLPR 184

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIV 245
            K +T+LG F      +DN M ++ + +A     L + +SG  + + DP       + I 
Sbjct: 185 LKRFTLLGTFSSGHYQFDNQMAWIHIADASKLLQLPDGISGYHIRIDDPMHAPLIRDQIQ 244

Query: 246 RILGNGVVVIDWQQRYQIFFSCYES 270
             L  G+   DW +    +FS  ++
Sbjct: 245 PHLPYGIFASDWSRDQSSYFSAVQT 269


>gi|331000226|ref|ZP_08323910.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Parasutterella excrementihominis YIT 11859]
 gi|329572392|gb|EGG54045.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Parasutterella excrementihominis YIT 11859]
          Length = 377

 Score =  103 bits (257), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 65/233 (27%), Positives = 120/233 (51%), Gaps = 8/233 (3%)

Query: 41  MALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFI-PDVIKVLPF 99
           MALI+V+SVMNGF++++  ++L +  H  +     P+ D+Q  A  L    P++I   PF
Sbjct: 1   MALIIVLSVMNGFQKEVRDKMLSVLSHAEVLSIGAPIPDWQKTAAELKKQQPEIIGAAPF 60

Query: 100 VSGQAFVSGLSSGGS--GVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDL 156
           + GQ     L+SG +  GV + GI     S + +          +D   G+  +I+G DL
Sbjct: 61  LRGQGL---LTSGTNVRGVQLNGIDPETESQVSDVAKNMKIGRLSDLKPGEFKIILGTDL 117

Query: 157 ARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQL 216
           AR LG+  G+K+N++ P G  TP G   R + +TV G+F     ++D+ M +++L +A+ 
Sbjct: 118 ARMLGVIPGEKVNVMVPQGQFTPAGTMPRMRQFTVAGVFNSGHYEFDSAMSFINLTDAEK 177

Query: 217 YFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +    GI + + +     +    +   +  G++  DW ++ + +F+  +
Sbjct: 178 LMRTQTP-GGIRLKLSNMQDAPRVAAELNNQMPPGLLATDWSRQNRTWFAAVQ 229


>gi|225874329|ref|YP_002755788.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidobacterium capsulatum ATCC 51196]
 gi|225793502|gb|ACO33592.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Acidobacterium capsulatum ATCC 51196]
          Length = 410

 Score =  103 bits (256), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 77/279 (27%), Positives = 134/279 (48%), Gaps = 24/279 (8%)

Query: 6   RFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGIN 65
           RFE+ +A RYL + R+ A + + + IS +GV +GV +LI+ +S+  G R D+   +L   
Sbjct: 2   RFELFIAARYLRAKRRQAVVGVITAISVVGVAVGVASLIIALSITTGMRRDLQGSLLSST 61

Query: 66  GHVVIQQKYYP-LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
             V + +     + +++ +  RL  +P V    P +     +S     G+G +++GI   
Sbjct: 62  ADVDLTRTMSDGIQNWEPLLARLRELPHVTAAAPGLYDPVLISH-GVRGTGAMLKGIVPK 120

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGKGV-------------IIGKDLARNLGISIGDKINIL 171
           D         R   N+ +DF  G GV             ++G DLA  +G S+GD + + 
Sbjct: 121 D--------ERTVSNLLSDFTHGSGVALSDPESSATPPIVLGSDLADTIGASVGDTVLVT 172

Query: 172 SPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFV 231
           SP GD+TP G+  R + + V G+F   F  YD+   ++ L++AQ  F   + +S I   +
Sbjct: 173 SPQGDLTPYGLVPRYQRFQVAGIFHSGFYQYDSSFGFIRLKDAQALFGEPDVISIISFKI 232

Query: 232 KDPDAIEKTHENIVRILGNGVVVIDW-QQRYQIFFSCYE 269
            +        + I +  G G    +W +Q  Q+F +  E
Sbjct: 233 DNLYQAPAIGQQIEKAAGKGFSTTNWMEQNRQLFAALQE 271


>gi|71279173|ref|YP_270153.1| lipoprotein releasing system transmembrane protein LolC [Colwellia
           psychrerythraea 34H]
 gi|71144913|gb|AAZ25386.1| lipoprotein releasing system transmembrane protein LolC [Colwellia
           psychrerythraea 34H]
          Length = 422

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 68/216 (31%), Positives = 114/216 (52%), Gaps = 13/216 (6%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  S     F+S  +F S +G+++GV ALI V+SVMNGF  ++ KR+L
Sbjct: 1   MFQPISIFIGLRYSRSKSHTGFVSFITFFSTVGILLGVAALITVVSVMNGFEGELKKRIL 60

Query: 63  GINGHVVIQQKYYPLVD--------YQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS 114
           GI  HV++    +  +D        +Q +   L   P+V++V PF+  +A +   + G  
Sbjct: 61  GIVPHVIVSD--FSTIDTGTDQEKSWQNLREELLTQPNVLRVTPFLESEALIQS-TKGLQ 117

Query: 115 GVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPY 174
           GVLV+GI          S     G++ N   +   +++G+ LA  L +S+GD++ ++ P 
Sbjct: 118 GVLVQGIMPKFEQKNIVSTHMVAGSMENLSTQSYSLVLGQSLANKLQVSLGDEVRLVLPN 177

Query: 175 GDV-TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYM 209
             V TPMG     + +TV G+F +     D+ MVY+
Sbjct: 178 KSVFTPMGRIPVQRVFTVAGIFHIG-SQVDDAMVYV 212


>gi|329119522|ref|ZP_08248207.1| lipoprotein ABC superfamily ATP binding cassette transporter,
           membrane protein [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464455|gb|EGF10755.1| lipoprotein ABC superfamily ATP binding cassette transporter,
           membrane protein [Neisseria bacilliformis ATCC BAA-1200]
          Length = 461

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 81/276 (29%), Positives = 140/276 (50%), Gaps = 25/276 (9%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + +++ F+S    IS IG+ IGV ALIVV+SV+NGF++D+  ++  +  
Sbjct: 50  LETWIGLRYLRAKKRSGFMSFIGAISIIGIAIGVTALIVVLSVVNGFQKDVRSQLFSVAP 109

Query: 67  HVVIQQKYYPLV--DYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGIS 122
           H  I   YY      +Q +   +    +V+   P+++ QA    L++ G   GV +RGI 
Sbjct: 110 HAEI--GYYDPAGGTWQELRKLVSGNKNVVGSAPYIADQAL---LANNGEVRGVQLRGIE 164

Query: 123 NSD----FSYLQN-SFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
            ++      Y Q   + RF    + +FD    +I+G+DLA  LG+  G K+ +++P G+V
Sbjct: 165 PAEEKQVADYWQKMPYGRFEDLKAGEFD----IILGQDLADALGVEKGGKVTVITPEGNV 220

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           TP GM  R K + ++G  +    + DN +    +++AQ  +  E    G+ + + DP   
Sbjct: 221 TPAGMVPRLKQFNLVGTVKTGIYELDNSLAMTHIRDAQTLYRTETGFGGLRLKLADP--- 277

Query: 238 EKTHENIVRIL----GNGVVVIDWQQRYQIFFSCYE 269
           +     + R+L     + V   DW    Q +F+  E
Sbjct: 278 QNAPTIVARLLPAAASDKVWARDWTFSNQSYFNAVE 313


>gi|116620160|ref|YP_822316.1| hypothetical protein Acid_1033 [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116223322|gb|ABJ82031.1| protein of unknown function DUF214 [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 408

 Score =  103 bits (256), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 71/263 (26%), Positives = 131/263 (49%), Gaps = 16/263 (6%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ +A RYL + RK A IS+ + IS +GV  GVMAL++ ++V +GF + +   +LG   
Sbjct: 4   FELFIAGRYLRARRKEAVISVITAISVLGVAAGVMALVIALAVTSGFSKTLQHNLLGAMA 63

Query: 67  H--VVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
           H  V+ +Q    + ++Q +   +  +P V  V P +    F++G      G  ++G+   
Sbjct: 64  HISVIPRQPGDGIENWQELVVGIRKVPHVTAVSPALYSPTFLTG-PIQSKGAYIKGVDLD 122

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGK-------GVIIGKDLARNLGISIGDKINILSPYGDV 177
               L  +  +     S   DR +       G+I+G  LA ++G+ +GD + +L+   ++
Sbjct: 123 SELALSGTLRKLK---SGSLDRLRDPNASPPGIILGSRLAEDVGMRVGDNVELLA--DEM 177

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
            P+G+    + + V G+F   F + D+   YMS+  AQ  F+ +  ++ IE+ V D +  
Sbjct: 178 LPVGVRPVKRRFKVAGLFETGFYEIDDLWAYMSIGAAQKAFSTDQ-INQIEINVDDLNLA 236

Query: 238 EKTHENIVRILGNGVVVIDWQQR 260
            +    I ++ G       W +R
Sbjct: 237 GRVAPEIEKVAGPRYTTTTWMER 259


>gi|146306638|ref|YP_001187103.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas mendocina ymp]
 gi|145574839|gb|ABP84371.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Pseudomonas mendocina ymp]
          Length = 415

 Score =  102 bits (255), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 72/261 (27%), Positives = 122/261 (46%), Gaps = 4/261 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S +G+ +GVM +I+V+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMLGLTLGVMVMILVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  ++    P+ D+  +A +++  P V  + PF   Q  ++        VL+  I 
Sbjct: 61  GMIPHATVESA-TPVSDWPALARQVERHPRVEALAPFTQMQGLLTH-DGKVQKVLINAID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
                 +      F     +    G   +IIG   A  LG+ +GDK+  ++P   VTP G
Sbjct: 119 PEQERKVSIIDGFFQQGGLDSLQPGDFAMIIGDKAAAKLGVKLGDKVTFVAPEVTVTPAG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEKT 240
           M  R K +TV G+F +   + D  +   ++ + A+L     + V G+ +   D     ++
Sbjct: 179 MFPRLKRFTVTGIFHVGAGEIDGALALANISDLARLQRWQPDQVQGLRLKFDDLFQAPRS 238

Query: 241 HENIVRILGNGVVVIDWQQRY 261
              I + L       DW + +
Sbjct: 239 AWEIAQTLDGDFYARDWTRTH 259


>gi|262195151|ref|YP_003266360.1| hypothetical protein Hoch_1920 [Haliangium ochraceum DSM 14365]
 gi|262078498|gb|ACY14467.1| protein of unknown function DUF214 [Haliangium ochraceum DSM 14365]
          Length = 470

 Score =  102 bits (255), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 74/262 (28%), Positives = 134/262 (51%), Gaps = 21/262 (8%)

Query: 23  AFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDY-- 80
           AF S+ + +S +GV++GV AL V ++V  GF+E+   +VLG+N HV+I +      +Y  
Sbjct: 72  AFFSVLTSVSGLGVVLGVAALTVTLAVATGFQEEFRAKVLGVNAHVIIMKNTTDFPEYRK 131

Query: 81  -QFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSY---LQNSFSRF 136
            + +A  +D  P+V  V PF+  +   +  +   SGV ++G+  +       LQ      
Sbjct: 132 VEEVARNID--PEVRAVQPFLFEEMLATRGNGKQSGVAIKGVDPARVGQVLDLQKHI--I 187

Query: 137 YGNVSNDFDRGK-----GVIIGKDLARNLGISIGDKINILSPYGDV-----TPMGMGIRS 186
            G+V    ++        +++G++LAR L  ++GD+I +++P  ++     T  G    +
Sbjct: 188 EGSVEPLAEQPPPGEPAAIVMGRELARKLDATVGDEITVVAPLSNLDLDTWTASGSAPLT 247

Query: 187 KSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVR 246
           + + V G+F   F +YD  ++Y+SL EAQ      + V G+E+ V D +   +  + I  
Sbjct: 248 RKFRVGGIFYSGFAEYDQRLMYVSLSEAQELRGQGDRVLGVELKVADVERAREIADKIEA 307

Query: 247 ILGNGV-VVIDWQQRYQIFFSC 267
            LG    VV DW +  +  F+ 
Sbjct: 308 ELGGSPYVVQDWYELNRNLFTA 329


>gi|312959647|ref|ZP_07774164.1| lipoprotein releasing system, transmembrane protein [Pseudomonas
           fluorescens WH6]
 gi|311286364|gb|EFQ64928.1| lipoprotein releasing system, transmembrane protein [Pseudomonas
           fluorescens WH6]
          Length = 414

 Score =  102 bits (253), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 122/269 (45%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N F+S  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLSIFIGTRYTRAKRRNRFVSFISMTSMIGLALGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     P+ D+Q +A      P V   +PF       S        + + G+ 
Sbjct: 61  GMVPHATI-VGVNPIDDWQPVAAAAMKNPQVTAAVPFTQMDGMFS-YKGAMQPIEISGVD 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            +    +             D   G+ GV+IG   AR   +++GDK+ ++ P     P G
Sbjct: 119 PAQEGKVSIVAQHIVRGKLEDLKPGEFGVVIGDITARRFRLNVGDKVTLIVPEISSAPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEKT 240
           +  R +   V+G+F++   + D  M  + + + A++     N V  + + VKD  A    
Sbjct: 179 ITPRMQRLNVVGIFKVG-AELDGSMALIHMADAAEIQHWQPNQVQSVRLAVKDLYAAPSV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
             +I   LG G    DW       FS  +
Sbjct: 238 SADIAGSLGAGYKPDDWTHTQGSLFSAMK 266


>gi|146306640|ref|YP_001187105.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas mendocina ymp]
 gi|145574841|gb|ABP84373.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Pseudomonas mendocina ymp]
          Length = 414

 Score =  102 bits (253), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 71/269 (26%), Positives = 128/269 (47%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S  S IG+ +GV+A+IVV+SVMNGF+++M  R+L
Sbjct: 1   MFRPLSIFIGARYTRAKRRNHFISFISLTSMIGLALGVLAMIVVLSVMNGFQKEMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H ++     P+ D++ +A +    P V    P+   +  +S   +    + + GI 
Sbjct: 61  GMVPHAML-YGAEPVADWRALAAKAMANPQVQAAAPYAELEGMLSHRGT-MQPIQIHGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            ++   +            N+   G+ GV+IG   AR  G+ +GDK+ ++ P     P G
Sbjct: 119 PAEEGKVSILPEHIRQGSLNNLQPGEFGVVIGDITARRFGLQVGDKLTLIIPELSSAPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPDAIEKT 240
           +  R +   V  +F++   + D+ +  +++ +A     L E  V GI + +KD     + 
Sbjct: 179 VTPRMQRLNVAAVFKVG-AELDSSLALINVADAAAMQRLPEGTVPGIRLALKDLYQAPQV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + +   LG      DW       FS  +
Sbjct: 238 SKALQAQLGADYRADDWTHTQGSLFSAMK 266


>gi|294671332|ref|ZP_06736183.1| hypothetical protein NEIELOOT_03041 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291306964|gb|EFE48207.1| hypothetical protein NEIELOOT_03041 [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 415

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 75/270 (27%), Positives = 138/270 (51%), Gaps = 12/270 (4%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E  +  RYL + +++ F+S    IS IG+ IGVMALIVV+SV+NGF++D+  ++  +  
Sbjct: 4   LETWIGLRYLRAKKRSGFMSFIGIISIIGIAIGVMALIVVLSVVNGFQKDVRSQLFSVAP 63

Query: 67  HVVIQQKYYPLVD---YQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGI 121
           H  I   +Y   +   +Q +   +    DV+   P+++ QA    L++ G   GV VRGI
Sbjct: 64  HAEI--GFYDTENGGSWQDLRKMVAGNKDVLGSAPYIADQAL---LANNGVVRGVQVRGI 118

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
              +   + + + +       D   G+  +I+G++LA  LG  +G K+ +++P G+VTP 
Sbjct: 119 DPQEEKQVVDYWQKMTTGKFEDLKPGEFDIILGQELANELGAEVGGKVTVITPEGNVTPA 178

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G+  R K + V+G+ +    + DN +    +++A+  +  E   +G+ + + DP      
Sbjct: 179 GVVPRLKQFNVVGVVKTGLYELDNTLTLTHIEDARTLYRFEGGFAGLRLKLADPQNAPAV 238

Query: 241 HENIVRI-LGNGVVVIDWQQRYQIFFSCYE 269
              ++     + V   DW    Q +F+  E
Sbjct: 239 VPKLLPADAADRVWARDWTFSNQSYFNAVE 268


>gi|148653537|ref|YP_001280630.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Psychrobacter sp. PRwf-1]
 gi|148572621|gb|ABQ94680.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Psychrobacter sp. PRwf-1]
          Length = 411

 Score =  101 bits (252), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 68/272 (25%), Positives = 130/272 (47%), Gaps = 12/272 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS+ S IS +G+ +GV  LI V+SVMNGF  ++  R+L
Sbjct: 1   MFRPLALFLGLRYTRAERSNRFISLISLISMVGLTLGVAVLITVLSVMNGFDRELKTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRG 120
           G+     +      + D++ +AN +   P+V  V PF+  Q     L+S G  +G++V G
Sbjct: 61  GMVPQATVTSAEI-IPDWKNLANEIKKDPEVHAVAPFIELQGM---LTSNGQVAGIMVTG 116

Query: 121 IS---NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
           +      + S +        G++    D    +++G+ +   LG+ +GDK+ ++ P    
Sbjct: 117 VEPEYEKNVSIINEHMVE--GSIDTLKDGDFSIVLGESMVEALGLQVGDKVTLVLPEASP 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           +P G+  R K +T+ G+F +   + DN + ++ + +A     L     GI + + +    
Sbjct: 175 SPAGVIPRFKRFTLTGVFNISR-EVDNLVAFIPMGDAATLLRLPEGAQGIRMKLDNIFLA 233

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +  +   +I    +   DW + +   F   +
Sbjct: 234 PQVAQRAAKINPQQLFPNDWTRTHGNLFGAIQ 265


>gi|225619121|ref|YP_002720347.1| LolC/E family lipoprotein releasing system protein [Brachyspira
           hyodysenteriae WA1]
 gi|225213940|gb|ACN82674.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Brachyspira hyodysenteriae WA1]
          Length = 430

 Score =  100 bits (250), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/264 (27%), Positives = 140/264 (53%), Gaps = 14/264 (5%)

Query: 14  RYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQ- 72
           RYL + +K +F+SI + I  +G+++G M +I V+SVMNGF++D+  ++LG+  H+ I   
Sbjct: 5   RYLRAKKKFSFVSIITIICVLGILVGDMVMITVLSVMNGFQDDIRDKILGMRAHINISAY 64

Query: 73  KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVL-VRGISNSDFSYLQN 131
              PL DY+++ + +    ++    P++     +   S G + ++ VR   ++ F+    
Sbjct: 65  SDQPLTDYKYVVDNIMNNKEITSAYPYIVLPCIMR--SYGFTTLITVRSFEDNIFT-TDK 121

Query: 132 SFSRFYGNVS-NDFDRGKG-VIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSY 189
            F +++  V  N+ D      +IG ++A++  +SIGD I+I+S  G     G   +  ++
Sbjct: 122 DFIKYFNFVEGNNKDMNTNDALIGSEMAKDYALSIGDTIDIISASGSFE-RGFKPQKTTF 180

Query: 190 TVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK---DPDAIEKTHENIVR 246
           T+ G+++  + +YD+ MV + L   Q     +NAV+G+ V V+   D D + K  +  ++
Sbjct: 181 TIKGIYKTGYYEYDSRMVIVPLTTGQKMVGYDNAVTGVAVKVRNFFDADKVAKKIDTDLK 240

Query: 247 ILGNGVVVIDWQQRYQIFFSCYES 270
              N   V+ W    + FF    +
Sbjct: 241 EFYN---VMPWMLFDRNFFQALHT 261


>gi|255320329|ref|ZP_05361513.1| lipoprotein-releasing system transmembrane protein LolE
           [Acinetobacter radioresistens SK82]
 gi|255302524|gb|EET81757.1| lipoprotein-releasing system transmembrane protein LolE
           [Acinetobacter radioresistens SK82]
          Length = 419

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 129/271 (47%), Gaps = 10/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  + +S IG+ +GV  LI V+SVMNGF  ++  RVL
Sbjct: 9   MFKPISLYIGLRYTRARRSNHFISFIALVSMIGLTLGVAVLITVLSVMNGFDRELKNRVL 68

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+     +      L D+  +A +++    V    PF   Q  ++      +G++V GI 
Sbjct: 69  GMIPQATVSSTQI-LTDWPELAKKVESHEHVTGAAPFTQLQGMLTA-QGQVAGLMVTGIE 126

Query: 123 ---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
                  S +Q+      G++ +   +G+ G+++GK +   LG+ + D + ++ P    +
Sbjct: 127 PQYEKKVSIIQDHMVE--GSI-DSLKKGEFGIVLGKQMTDALGLGLNDSVTLVLPEATPS 183

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + ++G+F +   + D+ M Y++L +A     L +   G+ + + D  +  
Sbjct: 184 PAGVVPRFKRFKIVGIFSIG-AEVDSMMGYIALNDASTLLRLPDGAQGVRLKLDDIFSAP 242

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +   +I R L       DW   +   FS  +
Sbjct: 243 QVASSIARELPGNFYASDWTYTHGNLFSAIQ 273


>gi|298486424|ref|ZP_07004485.1| Lipoprotein releasing system transmembrane protein lolC
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|298159052|gb|EFI00112.1| Lipoprotein releasing system transmembrane protein lolC
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
          Length = 416

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 84/265 (31%), Positives = 135/265 (50%), Gaps = 11/265 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I+    P+ D++ +A ++   P V+ V PF   Q     L+  G    VL+ G
Sbjct: 61  GMVPHATIESA-DPITDWRGLAAKVQENPQVLAVAPFTQMQGL---LTHDGKVQKVLLNG 116

Query: 121 ISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           I  ++   +   + F +  G + +      G++IG   A  LG+ +GDK+N ++P   VT
Sbjct: 117 IDPAEERKVSIIDHFIK-QGQLDSLSPGSFGIMIGDKAAAKLGVVVGDKLNFVAPEVTVT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P GM  R K + V G+F +   + D  +   +L + A+L+    N V G+ +   D  A 
Sbjct: 176 PAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLARLHRWKPNQVQGLRLKFDDLFAA 235

Query: 238 EKTHENIVRILG-NGVVVIDWQQRY 261
            +T   I + LG N     DW + +
Sbjct: 236 PRTSWEIAQKLGENNFYSRDWTRTH 260


>gi|78061357|ref|YP_371265.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia sp. 383]
 gi|77969242|gb|ABB10621.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia sp. 383]
          Length = 427

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/270 (28%), Positives = 129/270 (47%), Gaps = 16/270 (5%)

Query: 7   FEVIVAWRYLFSNRKNA---FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FE  +  RY    R++A   F+S  +  +  G+ +GV ALIVV+SVMNGFR ++  R+L 
Sbjct: 15  FEWQIGLRYARGGRRSAGDGFVSFIAGAAMAGIALGVAALIVVLSVMNGFRTEVRDRMLS 74

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D++  A+     P V  V P+V  QA ++   S  +GV +RGI  
Sbjct: 75  VLAHVEIFSPTGAMPDWRLTAHESLQNPAVRAVAPYVDAQALLTNAGS-VTGVALRGIDP 133

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSP-----YGDV 177
                +     +      +    G+ G+++G  LA  L + IGD+I   +P      GD 
Sbjct: 134 VLEPRVSEIARKLKTGRLDALVPGEMGIVLGSALADALHVKIGDRITFFAPGNRARIGDA 193

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
            P     + + + V+G F      YD+ + Y+ L++AQ  FN+  A +GI + + D    
Sbjct: 194 LP-----QFRQFNVVGTFESGHYQYDSALAYIHLRDAQTLFNV-RAPTGIRLRLDDLQRA 247

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
                 + R L   + + DW ++ + +F  
Sbjct: 248 PDVALELSRTLSGDLYIRDWTRQNRTWFEA 277


>gi|262379385|ref|ZP_06072541.1| lipoprotein releasing system, transmembrane protein LolE
           [Acinetobacter radioresistens SH164]
 gi|262298842|gb|EEY86755.1| lipoprotein releasing system, transmembrane protein LolE
           [Acinetobacter radioresistens SH164]
          Length = 411

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/271 (25%), Positives = 129/271 (47%), Gaps = 10/271 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R N FIS  + +S IG+ +GV  LI V+SVMNGF  ++  RVL
Sbjct: 1   MFKPISLYIGLRYTRARRSNHFISFIALVSMIGLTLGVAVLITVLSVMNGFDRELKNRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+     +      L D+  +A +++    V    PF   Q  ++      +G++V GI 
Sbjct: 61  GMIPQATVSSTQI-LTDWPELAKKVESHEHVTGAAPFTQLQGMLTA-QGQVAGLMVTGIE 118

Query: 123 ---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
                  S +Q+      G++ +   +G+ G+++GK +   LG+ + D + ++ P    +
Sbjct: 119 PQYEKKVSIIQDHMVE--GSI-DSLKKGEFGIVLGKQMTDALGLGLNDSVTLVLPEATPS 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
           P G+  R K + ++G+F +   + D+ M Y++L +A     L +   G+ + + D  +  
Sbjct: 176 PAGVVPRFKRFKIVGIFSIG-AEVDSMMGYIALNDASTLLRLPDGAQGVRLKLDDIFSAP 234

Query: 239 KTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +   +I R L       DW   +   FS  +
Sbjct: 235 QVASSIARELPGNFYASDWTYTHGNLFSAIQ 265


>gi|294141527|ref|YP_003557505.1| lipoprotein releasing system transmembrane protein LolC [Shewanella
           violacea DSS12]
 gi|293327996|dbj|BAJ02727.1| lipoprotein releasing system transmembrane protein LolC, putative
           [Shewanella violacea DSS12]
          Length = 310

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 114/237 (48%), Gaps = 26/237 (10%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           V WR+  + + N+FIS  SF S  G+ +GV  LIVV+S MNGF  ++  R+LG+  H  +
Sbjct: 9   VGWRFYLARQSNSFISFISFASTAGIALGVAVLIVVLSAMNGFERELENRLLGVVAHGEL 68

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN------- 123
                P+  +Q IAN  D IP ++   PF+  Q  V     G  G+ V GI         
Sbjct: 69  TGVNEPIAHWQKIANDADKIPGILASAPFIQLQGLVQK-PGGFQGLNVLGIDTEQEQKVS 127

Query: 124 --SDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
             +DF   +       G+ +N       +++GK LA NLG+S+GD +++  P  DV+   
Sbjct: 128 VIADFMSEETWLKLGRGDENN-------IVLGKGLADNLGLSVGDSLSLYMP--DVSHQS 178

Query: 182 M------GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK 232
                    +S  + V G+F +   + D    Y+ ++ A     +   VSG+ + V+
Sbjct: 179 QDSKRIGSAKSHRFVVAGVFELG-GELDLTTAYIPMKYAASILGMGQGVSGVRIKVE 234


>gi|167032705|ref|YP_001667936.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas putida GB-1]
 gi|166859193|gb|ABY97600.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Pseudomonas putida GB-1]
          Length = 413

 Score =  100 bits (249), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 125/269 (46%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGARYTRAKRRNHFISFISMTSMIGLSLGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     PL D+  +A+     P V+ V P    +  +S        + V GI 
Sbjct: 61  GLVPHAAI-LGVQPLDDWHKVADAAMQNPAVMAVAPITEMEGMLS-YKGAMQPIQVGGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            ++   +             D   G+ GV+IG+  AR   ++ GDK+ ++ P     P G
Sbjct: 119 PAEEGKVSIVGQHIVQGRLQDLQPGEFGVVIGELTARRFRLNTGDKLTLIVPEISKEPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEKT 240
           +  R +   V+G+F++   + D    Y+ + + A++       V G+ + + D  A  + 
Sbjct: 179 ITPRMQRLNVVGIFKVG-AELDGSQAYIHVADAAEMQRWAPGQVQGVRLKLHDLYAAPQV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + I   LG+     DW       FS  +
Sbjct: 238 SKAIAAGLGDAYRADDWSHTQGSLFSAMK 266


>gi|157375966|ref|YP_001474566.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Shewanella sediminis HAW-EB3]
 gi|157318340|gb|ABV37438.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella sediminis HAW-EB3]
          Length = 416

 Score =  100 bits (248), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 77/265 (29%), Positives = 129/265 (48%), Gaps = 9/265 (3%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           + +RY  + + N F S  +F +  G+++GV ALI+V SVMNG    + +R+LG    + +
Sbjct: 15  IGFRYWRARKANTFASFITFFAVSGILLGVAALIIVSSVMNGLEGQLKQRILGAVPQLTV 74

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQ 130
                PL D++     L  +P V+   P +S QA V    +  S V V GI  +    L 
Sbjct: 75  HAS-QPLTDWEKQVQGLKNLPGVLGATPSISTQAMVQS-QTNISAVQVYGIYPAYEQELL 132

Query: 131 NSFSR-FYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV-TPMGMGIRSKS 188
            +  R F G+      R   VI+G +LAR L +  GD + +LS  G V +P+G     + 
Sbjct: 133 RTMKRSFNGSFDKLEPRQYRVILGAELARRLDVVAGDTVRLLSGEGVVYSPLGPVPSQRK 192

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDP-DAIEKTHENIVR 246
           + V G+F M     D  + Y+  ++AQ L       +  + +++ DP +A+  T + + +
Sbjct: 193 FIVAGVFEMG-SQVDANLAYVHYEDAQRLMRQKSGEIKHLRLYLVDPFNAVSLTSKVVEQ 251

Query: 247 ILGNGVVVI--DWQQRYQIFFSCYE 269
               G+ V   DW++ Y   FS  +
Sbjct: 252 FENQGIEVTTSDWRESYGHLFSAVK 276


>gi|319789982|ref|YP_004151615.1| protein of unknown function DUF214 [Thermovibrio ammonificans HB-1]
 gi|317114484|gb|ADU96974.1| protein of unknown function DUF214 [Thermovibrio ammonificans HB-1]
          Length = 408

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 68/231 (29%), Positives = 116/231 (50%), Gaps = 8/231 (3%)

Query: 44  IVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQ 103
           I+V SVM GF++ + KR+L  N  +++ ++  P V Y +  + +  I  V+ V PF+   
Sbjct: 39  IIVNSVMTGFQDAIKKRLLSANADIIVMKRSGPFVRYDYAQHVISKIKGVVGVEPFIYVP 98

Query: 104 AFVSGLSSGGS-GVLVRGISNSDFSYLQNSFSRFYGNVSNDF----DRGKGVIIGKDLAR 158
           A  +   +  +    +RG   +       S  R    V  D+       KGV+IG+ LA 
Sbjct: 99  AMATAGQAQTAASASIRGCVPA-LEPKVTSIPRHM--VVGDWKLFESSPKGVVIGRILAD 155

Query: 159 NLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYF 218
            LGI++GD+I  +SPYG  TP G+  R+  +TV+G+F +    +D+ +V   L   +  F
Sbjct: 156 TLGITVGDEITFISPYGRKTPFGVIPRTAKFTVVGIFEVGMYQFDSSLVLAHLDAVRKAF 215

Query: 219 NLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              ++V+G+ V V+D + ++     I  +LG    V DW    +  FS  +
Sbjct: 216 GFGDSVTGLMVKVRDLNLVKPVERQIEAVLGPAYSVQDWISLNKSLFSALK 266


>gi|162449906|ref|YP_001612273.1| integral membrane protein [Sorangium cellulosum 'So ce 56']
 gi|161160488|emb|CAN91793.1| integral membrane protein [Sorangium cellulosum 'So ce 56']
          Length = 720

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 75/282 (26%), Positives = 132/282 (46%), Gaps = 53/282 (18%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           VA R++ ++ K+ F+++ S +S  GV +   AL  V S+M GF  D+ +++LG N H+V+
Sbjct: 259 VAARHVRAS-KSGFLTVISVLSMAGVAVSSCALCSVTSIMGGFGADLKRKILGNNAHMVV 317

Query: 71  QQKY---YPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN---- 123
                  +   D +    R+   P      P  +G+A  S  +S  +G LVRGI      
Sbjct: 318 DASRPGGFGNWDDKLTQVRVALAPYGGAATPVAAGEAMGSS-ASNTAGALVRGIDPDTIG 376

Query: 124 -----------SDFSYLQNS-----------FSRFYG----------NVSNDFDRG---- 147
                        F YL++              R  G              D D      
Sbjct: 377 QVIDLAKNIEVGSFDYLRDPEKLTSLPPEEIIGRGPGGEPYFKGPDFRQPTDVDPSVRDY 436

Query: 148 --------KGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRF 199
                    GVIIG++LA++L + +GD++ +LSP G++ P G+  RS+ + V  +F    
Sbjct: 437 LKLQTRVYPGVIIGRELAKSLHVLVGDEVTLLSPMGELGPTGVMPRSRRFRVAAIFYSGM 496

Query: 200 PDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
            +YD    Y+ ++EAQ +F+L++ ++ I++ V DP+ +++  
Sbjct: 497 YEYDVTHAYVLMEEAQRFFSLDDKITHIDIRVPDPERVQEVR 538


>gi|197121549|ref|YP_002133500.1| hypothetical protein AnaeK_1138 [Anaeromyxobacter sp. K]
 gi|196171398|gb|ACG72371.1| protein of unknown function DUF214 [Anaeromyxobacter sp. K]
          Length = 658

 Score = 99.8 bits (247), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 80/286 (27%), Positives = 137/286 (47%), Gaps = 36/286 (12%)

Query: 16  LFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGH-VVIQQKY 74
           LF   +     + + IS  GV IGV AL VV+SVM+GF  D+ K++LG   H +V+    
Sbjct: 238 LFHRPRMPATLLMTLISIGGVAIGVWALTVVLSVMSGFEADLKKKILGHTAHGMVLSYGQ 297

Query: 75  YPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGI----------- 121
               D++ I   +  +  V    PF+  +     LS+G   +G +++GI           
Sbjct: 298 DDFGDWRRIRETVLGVRGVEAATPFLYNEVM---LSTGQNLTGAILKGIDVKTIGSVTDL 354

Query: 122 -------------SNSDFSYLQNSFSRFYGNVSNDFDRG----KGVIIGKDLARNLGISI 164
                        + ++    ++  S   G  + +  R      G++IG++LA  L + +
Sbjct: 355 PASVQDGRLEWLEAPAEIPLPRDGGSGDGGGAAPERPRPGRPLPGIVIGRELAHALRVFV 414

Query: 165 GDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAV 224
           GD++N++SP+GD+ P G   +S+ + V  +F     +YD+   Y+SL +AQ +F +E  V
Sbjct: 415 GDQVNLVSPFGDLGPGGPQPKSRPFRVAAVFYSGMYEYDSKFAYISLADAQRFFGVET-V 473

Query: 225 SGIEVFVKDPDAIEKTHENIVRILGNGVV-VIDWQQRYQIFFSCYE 269
           +G+EV V+D DA       +V  LG       DW +  +  FS  +
Sbjct: 474 TGLEVKVRDADAARSVMGRVVFALGGWPYRAKDWGELNRSLFSALQ 519


>gi|148548792|ref|YP_001268894.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas putida F1]
 gi|148512850|gb|ABQ79710.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Pseudomonas putida F1]
          Length = 413

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 125/269 (46%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGARYTRAKRRNHFISFISMTSMIGLSLGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     PL D+  +A+     P V+ V P    +  +S        + V GI 
Sbjct: 61  GLVPHAAI-LGVQPLDDWHKVADAAMKNPAVMAVAPITEMEGMLS-YKGAMQPIQVGGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            ++   +                 G+ GV+IG+  AR   ++ GDK+ ++ P     P G
Sbjct: 119 PAEEGKVSIVGQHIVQGRLQGLQPGEFGVVIGELTARRFRLNTGDKLTLIVPEISKEPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEKT 240
           +  R +  TV+G+F++   + D    Y+ + + A++       V G+ + + D  A  + 
Sbjct: 179 ITPRMQRLTVVGIFKVG-AELDGSQAYIHVADAAEMQRWAPGQVQGVRLKLHDLYAAPQV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + I   LG+     DW       FS  +
Sbjct: 238 AKAIAAGLGDAYRADDWSHTQGSLFSAMK 266


>gi|294141529|ref|YP_003557507.1| lipoprotein releasing system transmembrane protein LolE [Shewanella
           violacea DSS12]
 gi|293327998|dbj|BAJ02729.1| lipoprotein releasing system transmembrane protein LolE [Shewanella
           violacea DSS12]
          Length = 410

 Score = 99.4 bits (246), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 79/266 (29%), Positives = 130/266 (48%), Gaps = 11/266 (4%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           + +RY  + + N F S  +F +  G+++GV ALI+V SVMNG    + +R+LG    + +
Sbjct: 9   IGFRYWRARKANGFASFITFFAVSGILLGVAALIIVSSVMNGLEGQLKQRILGAVPQLTV 68

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSY-L 129
             +  P+  +Q     L  +P VI V P +S QA +   SS  S + V GI   DF + L
Sbjct: 69  HSQ-APIEQWQSKIAELTKLPGVIGVTPSISNQAMIQS-SSNISAIGVYGI-YPDFEHNL 125

Query: 130 QNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV-TPMGMGIRSK 187
             S    +       + GK  +++G  LAR LG+S GDK+ +LS  G + +P+G     +
Sbjct: 126 LASMEHSFNGSFEQLEAGKYRIVLGSLLARRLGVSPGDKVRLLSGEGVIYSPLGPVPSQR 185

Query: 188 SYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDP-DAIEKTHENIV 245
            + V G+F M     D  + Y+  ++AQ L       V  +  ++ DP +A   + + I 
Sbjct: 186 KFVVAGVFEMG-SQVDANLAYIHYEDAQRLMRQKPGQVKNLRFYLDDPFNAANLSSDVIA 244

Query: 246 RILGNGVVVI--DWQQRYQIFFSCYE 269
               +G+ V   DW+  Y   F   +
Sbjct: 245 EFSKDGLEVTTSDWRDSYGHLFGAVK 270


>gi|88606867|ref|YP_505846.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Anaplasma phagocytophilum HZ]
 gi|88597930|gb|ABD43400.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Anaplasma phagocytophilum HZ]
          Length = 399

 Score = 99.0 bits (245), Expect = 6e-19,   Method: Compositional matrix adjust.
 Identities = 79/267 (29%), Positives = 132/267 (49%), Gaps = 22/267 (8%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
            E ++A RYL S +     S  S  S +G+ IGV  L+ VM+VM+GF   ++  +LG+NG
Sbjct: 3   LEWLLARRYLSSKKGRFLCSPMSVFSILGISIGVATLVSVMAVMSGFSAKLLHNILGMNG 62

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+ +  +    VDY  +   ++    V+  +  + GQ  V        G ++RG+   D 
Sbjct: 63  HITVHCQD---VDYHTVIPEVESTAGVVSAVAVLEGQVMVKS-EHAAVGAVLRGMEMPDI 118

Query: 127 SYLQNSFSRFYGNVSNDFDR-GKGVIIGKDLARNLGISIGDKINILSPYGDVT-PMGMGI 184
           S   +  S++   VS D +    G+IIG  LA +L +  GD++ ++S     T P     
Sbjct: 119 S---DKLSQYV--VSGDTEELEAGIIIGSRLAESLNVYYGDEVVVISSSSFSTMP----- 168

Query: 185 RSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENI 244
           R+  Y V G+F +   +YD+  VY+ L+ AQ     +  +  +EV V   DA+  +  NI
Sbjct: 169 RTHEYKVTGIFNVGMYEYDSAFVYVPLESAQTLLGYDGGMQYVEVRVD--DALHSS--NI 224

Query: 245 VR--ILGNGVVVIDWQQRYQIFFSCYE 269
           V+  I    + V DW+ ++  +F   E
Sbjct: 225 VKELIEKTKMRVEDWKVQHGQYFYALE 251


>gi|300869872|ref|YP_003784743.1| lipoprotein [Brachyspira pilosicoli 95/1000]
 gi|300687571|gb|ADK30242.1| lipoprotein releasing system transmembrane protein, LolC E family
           [Brachyspira pilosicoli 95/1000]
          Length = 431

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 66/259 (25%), Positives = 136/259 (52%), Gaps = 4/259 (1%)

Query: 14  RYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQ- 72
           RYL + +K +F+SI + I  +G+++G M +I V+SVMNGF++D+  ++LG+  H+ I   
Sbjct: 5   RYLKAKKKFSFVSIITVICILGILVGDMVMITVLSVMNGFQDDIRDKILGMRAHINISAY 64

Query: 73  KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNS 132
              PL++Y+++ + +    ++  + P++   + +   +   + + VR   +  F+  ++ 
Sbjct: 65  GDQPLLNYEYVVDNIKDNKEITSIYPYIVLPSIMRTYTF-TTLITVRSFEDDIFTKDRDF 123

Query: 133 FSRFYGNVSNDFDRGKG-VIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTV 191
              F      + + G    +IG ++A +  +S+GD I+I+S  G     G   +  ++T+
Sbjct: 124 IKYFKFIEGGNKNLGTNDALIGSEMADDYALSVGDTIDIVSASGSFEK-GFRPQKTTFTI 182

Query: 192 LGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNG 251
            G+++  + +YD+ MV + L+ AQ     E  V+G+ V +K+    +K  +NI   L   
Sbjct: 183 KGIYKTGYYEYDSKMVIVPLKTAQAMMGYEGGVTGVAVKIKNFFDADKVAKNIDLSLKQF 242

Query: 252 VVVIDWQQRYQIFFSCYES 270
             V+ W    + FF    +
Sbjct: 243 YNVMPWMLFDRNFFQALHT 261


>gi|206564213|ref|YP_002234976.1| permease [Burkholderia cenocepacia J2315]
 gi|198040253|emb|CAR56238.1| permease protein [Burkholderia cenocepacia J2315]
          Length = 422

 Score = 98.6 bits (244), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 76/270 (28%), Positives = 129/270 (47%), Gaps = 16/270 (5%)

Query: 7   FEVIVAWRYLFSNRKNA---FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FE  +  RY    R++A   F+S  +  +  G+ +GV ALIVV+SVMNGFR ++  R+L 
Sbjct: 10  FEWQIGLRYARGGRRSAGDGFVSFIAGAAMAGIALGVAALIVVLSVMNGFRTEVRDRMLS 69

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D++  A+       V  V P+V  QA ++  +   +GV +RGI  
Sbjct: 70  VLAHVEIFSPSGAMPDWRLTAHESLQNTAVRAVAPYVDAQALLTN-AGNVTGVALRGIDP 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSP-----YGDV 177
                +     +      +    G+ G+++G  LA  L + IGD+I   +P      GD 
Sbjct: 129 VLEPRVSEIARKLKTGRLDALAPGEMGIVLGAALADALHVKIGDRITFFAPGNRARLGDA 188

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
            P     R + + V+G F      YD+ + Y+ +++AQ  FN+  A +GI + V D    
Sbjct: 189 LP-----RFRQFNVVGTFESGHYQYDSALAYIHIRDAQQLFNVP-APTGIRLRVDDLQRA 242

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSC 267
            +    + R L   + + DW ++ + +F  
Sbjct: 243 PEVALALSRTLSGDLYIRDWTRQNRTWFEA 272


>gi|149912294|ref|ZP_01900864.1| putative ABC transporter integral membrane subunit [Moritella sp.
           PE36]
 gi|149804628|gb|EDM64689.1| putative ABC transporter integral membrane subunit [Moritella sp.
           PE36]
          Length = 408

 Score = 98.6 bits (244), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 86/270 (31%), Positives = 132/270 (48%), Gaps = 17/270 (6%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
             + +  RY  S R N F+S  +  S  G+ IGV+ALI V+SVMNGF +D+  R+LG   
Sbjct: 5   LSLFIGLRYTRSKRNNRFVSFITLFSTAGITIGVLALITVLSVMNGFEQDLKTRILGAVP 64

Query: 67  HVVIQQKY-YPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
           HV++  K     +D    A   D  P V  V PF+   A V    S   G  ++GI  S 
Sbjct: 65  HVIVTPKSGSDNIDESLSALADD--PLVAAVTPFLQADAMVQS-KSQIQGAQLQGIDPS- 120

Query: 126 FSYLQNSFSR---FYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV-TPM 180
            SY Q    R     G++S     GK  +IIG+ +A++L + +GDKI ++S  G + TPM
Sbjct: 121 -SYPQWDVIRQNMLIGDISL-LQPGKYNIIIGRSMAKSLNVKLGDKIRLISTKGSIFTPM 178

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEK 239
           G     + +TV+G++ +   D +   V +++ +A     L  ++     VFV DP A+  
Sbjct: 179 GRVPSQRKFTVVGIYSVG-SDVEATQVLVNITDAGKLVRLSPSSPMQHRVFVHDPFAV-- 235

Query: 240 THENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +E   R   +    +DWQ      F   +
Sbjct: 236 -NELASRNFFSNFDSLDWQTTRGELFQAVK 264


>gi|330986254|gb|EGH84357.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. lachrymans str. M301315]
          Length = 416

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 134/265 (50%), Gaps = 11/265 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I+    P+ D++ +A ++   P V+ V PF   Q     L+  G    VL+ G
Sbjct: 61  GMVPHATIESA-DPITDWRGLAAKVQENPQVLAVAPFTQMQGL---LTHDGKVQKVLLNG 116

Query: 121 ISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           I  ++   +   + F +  G + +      G++IG   A  LG+ +GDK+  ++P   VT
Sbjct: 117 IDPAEERKVSIIDHFIK-QGQLDSLSPGSFGIMIGDKAAAKLGVVVGDKLTFVAPEVTVT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P GM  R K + V G+F +   + D  +   +L + A+L+    N V G+ +   D  A 
Sbjct: 176 PAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLARLHRWKPNQVQGLRLKFDDLFAA 235

Query: 238 EKTHENIVRILG-NGVVVIDWQQRY 261
            +T   I + LG N     DW + +
Sbjct: 236 PRTSWEIAQKLGENNFYSRDWTRTH 260


>gi|71734277|ref|YP_274090.1| lipoprotein releasing system transmembrane protein LolC
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257484405|ref|ZP_05638446.1| lipoprotein releasing system transmembrane protein LolC
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|71554830|gb|AAZ34041.1| lipoprotein releasing system transmembrane protein LolC
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|320324795|gb|EFW80867.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320329161|gb|EFW85158.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330881532|gb|EGH15681.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330889114|gb|EGH21775.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. mori str. 301020]
 gi|331013183|gb|EGH93239.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 416

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 134/265 (50%), Gaps = 11/265 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I+    P+ D++ +A ++   P V+ V PF   Q     L+  G    VL+ G
Sbjct: 61  GMVPHATIESA-DPITDWRGLAAKVQENPQVLAVAPFTQMQGL---LTHDGKVQKVLLNG 116

Query: 121 ISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           I  ++   +   + F +  G + +      G++IG   A  LG+ +GDK+  ++P   VT
Sbjct: 117 IDPAEERKVSIIDHFIK-QGQLDSLSPGSFGIMIGDKAAAKLGVVVGDKLTFVAPEVTVT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P GM  R K + V G+F +   + D  +   +L + A+L+    N V G+ +   D  A 
Sbjct: 176 PAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLARLHRWKPNQVQGLRLKFDDLFAA 235

Query: 238 EKTHENIVRILG-NGVVVIDWQQRY 261
            +T   I + LG N     DW + +
Sbjct: 236 PRTSWEIAQKLGENNFYSRDWTRTH 260


>gi|313499725|gb|ADR61091.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas putida BIRD-1]
          Length = 413

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 124/269 (46%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGARYTRAKRRNHFISFISMTSMIGLSLGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     PL D+  +A+     P V+   P    +  +S        + V GI 
Sbjct: 61  GLVPHAAI-LGVQPLDDWHKVADAAMKNPAVMAAAPITEMEGMLS-YKGAMQPIQVGGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            ++   +                 G+ GV+IG+  AR   ++ GDK+ ++ P     P G
Sbjct: 119 PAEEGKVSIVGQHIVQGRLQGLQPGEFGVVIGELTARRFRLNTGDKLTLIVPEISKEPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEKT 240
           +  R +  TV+G+F++   + D    Y+ + + A++       V G+ + + D  A  + 
Sbjct: 179 ITPRMQRLTVVGIFKVG-AELDGSQAYIHVADAAEMQRWAPGQVQGVRLKLHDLYAAPQV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + I   LG+     DW       FS  +
Sbjct: 238 SKAIAAGLGDAYRADDWSHTQGSLFSAMK 266


>gi|296112874|ref|YP_003626812.1| lipoprotein ABC transporter permease protein LolC/E [Moraxella
           catarrhalis RH4]
 gi|295920568|gb|ADG60919.1| lipoprotein ABC transporter permease protein LolC/E [Moraxella
           catarrhalis RH4]
 gi|326564461|gb|EGE14688.1| lipoprotein ABC transporter permease protein LolC/E [Moraxella
           catarrhalis 103P14B1]
 gi|326564562|gb|EGE14787.1| lipoprotein ABC transporter permease protein LolC/E [Moraxella
           catarrhalis 12P80B1]
 gi|326571387|gb|EGE21402.1| lipoprotein ABC transporter permease protein LolC/E [Moraxella
           catarrhalis BC7]
 gi|326575331|gb|EGE25259.1| lipoprotein ABC transporter permease protein LolC/E [Moraxella
           catarrhalis CO72]
 gi|326576585|gb|EGE26492.1| lipoprotein ABC transporter permease protein LolC/E [Moraxella
           catarrhalis 101P30B1]
 gi|326577398|gb|EGE27282.1| lipoprotein ABC transporter permease protein LolC/E [Moraxella
           catarrhalis O35E]
          Length = 414

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 134/272 (49%), Gaps = 11/272 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + RKN FIS  SFIS IG+ +GV  LI V+SVMNGF  ++  R+L
Sbjct: 1   MFRPLALFIGLRYTKAKRKNGFISFISFISTIGLTLGVAVLITVLSVMNGFDREIKSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFI-PDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
           G+     +      L ++Q +A ++    P+V  V P++  Q  ++      +G++V GI
Sbjct: 61  GMVPQASVTSTEI-LTNWQELAEKIKMQNPEVQAVAPYIQLQGMLTA-EGQVTGIVVSGI 118

Query: 122 S---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
                   S +    +   GN+ +D   G+ G+I+G+ +  ++G+ +GDK+ ++ P    
Sbjct: 119 EPDYEKQVSIIDEHMTA--GNL-DDLHIGEFGIILGESIVSDMGLKLGDKVTLVLPEASP 175

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           +  G+  R K +T++G++ +   + D  M ++ +++A +   L     G+ + + D    
Sbjct: 176 SAAGVIPRFKRFTLVGVYHIS-SEIDGMMGFVRMRDAGVMLRLPEGAQGLRMKLNDIFKA 234

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   N   I    +   DW   +   FS  +
Sbjct: 235 PQVANNAAGIDSLPLFPSDWTTTHGNLFSAIQ 266


>gi|238897366|ref|YP_002923043.1| transport protein of outer membrane lipoproteins (ABC superfamily,
           membrane) [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
 gi|229465121|gb|ACQ66895.1| transport protein of outer membrane lipoproteins (ABC superfamily,
           membrane) [Candidatus Hamiltonella defensa 5AT
           (Acyrthosiphon pisum)]
          Length = 400

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 69/272 (25%), Positives = 138/272 (50%), Gaps = 15/272 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           ++    + +  RY++  R + F  + S +S IG+M+GVM++IVV+SVMNGF  D+   VL
Sbjct: 1   MYQPVTLFIGLRYIYGRRSDRFGRLVSSLSSIGIMLGVMSMIVVLSVMNGFERDLQNNVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H +I      +   +  A++L  +  +  + P  +    +    +  +GV++ GI+
Sbjct: 61  GLMPHALITTPENVIDPQKIPASKLQNLKGIKHIAPITTSDVVIQSAQNISAGVML-GIN 119

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKG--VIIGKDLARNLGISIGDKINILSP-YGDVTP 179
              +  L    S+++ NV  +  +     +I+G  LA+ LGI  GD + ++ P    +TP
Sbjct: 120 PEQYEPL----SKYFINVHQNLLQAGQYRIIMGAKLAQQLGIQSGDTVRLIVPSVRQLTP 175

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ--LYFNLENAVSGIEVFVKDPDAI 237
           MG  +  + +T++G+F     + D    +++ Q+A   + + L + ++G  +F+  P  +
Sbjct: 176 MGGMLSQRLFTLVGVFSAN-SEVDADQFFVNQQDASRLMRYPLGD-ITGWRLFLTQPLKV 233

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
               +   + L +G V  DW++R    F   +
Sbjct: 234 ASLSK---QKLPDGTVWKDWRERKGALFQAMQ 262


>gi|26988880|ref|NP_744305.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Pseudomonas putida KT2440]
 gi|24983688|gb|AAN67769.1|AE016408_7 lipoprotein releasing system, permease protein [Pseudomonas putida
           KT2440]
          Length = 413

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 73/269 (27%), Positives = 125/269 (46%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPIFIGARYTRAKRRNHFISFISMTSMIGLSLGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     P+ D+  +A+     P V+ V P    +  +S        + V GI 
Sbjct: 61  GLVPHAAI-LGVQPVDDWHKVADAAMKNPAVMAVAPITEMEGMLS-YKGAMQPIQVGGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            ++   +                 G+ GV+IG+  AR   ++ GDK+ ++ P     P G
Sbjct: 119 PAEEGKVSIVGQHIVQGRLQGLQPGEFGVVIGELTARRFRLNTGDKLTLIVPEISKEPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEKT 240
           +  R +  TV+G+F++   + D    Y+ + + A++       V G+ + + D  A  + 
Sbjct: 179 ITPRMQRLTVVGIFKVG-AELDGSQAYIHVADAAEMQRWAPGQVQGVRLKLHDLYAAPQV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + I   LG+     DW       FS  +
Sbjct: 238 SKAIAAGLGDAYRADDWSHTQGSLFSAMK 266


>gi|326564784|gb|EGE14996.1| lipoprotein ABC transporter permease protein LolC/E [Moraxella
           catarrhalis 46P47B1]
 gi|326567566|gb|EGE17681.1| lipoprotein ABC transporter permease protein LolC/E [Moraxella
           catarrhalis BC1]
          Length = 414

 Score = 98.2 bits (243), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 134/272 (49%), Gaps = 11/272 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + RKN FIS  SFIS IG+ +GV  LI V+SVMNGF  ++  R+L
Sbjct: 1   MFRPLALFIGLRYTKAKRKNGFISFISFISTIGLTLGVAVLITVLSVMNGFDREIKSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFI-PDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
           G+     +      L ++Q +A ++    P+V  V P++  Q  ++      +G++V GI
Sbjct: 61  GMVPQASVTSTEI-LTNWQELAEKIKMQNPEVQAVAPYIQLQGMLTA-EGQVTGIVVSGI 118

Query: 122 S---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
                   S +    +   GN+ +D   G+ G+I+G+ +  ++G+ +GDK+ ++ P    
Sbjct: 119 EPDYEKQVSIIDEHMTA--GNL-DDLHIGEFGIILGESIVSDMGLKLGDKVTLVLPEASP 175

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           +  G+  R K +T++G++ +   + D  M ++ +++A +   L     G+ + + D    
Sbjct: 176 SAAGVIPRFKRFTLVGVYHIS-SEIDGMMGFVRMRDAGVMLRLPEGAQGLRMKLNDIFKA 234

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   N   I    +   DW   +   FS  +
Sbjct: 235 PQVANNAAGIDSLPLFPSDWTTTHGNLFSAIQ 266


>gi|170720859|ref|YP_001748547.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas putida W619]
 gi|169758862|gb|ACA72178.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Pseudomonas putida W619]
          Length = 413

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 124/269 (46%), Gaps = 5/269 (1%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + R+N FIS  S  S IG+ +GV+A+IVV+SVMNGF+ +M  R+L
Sbjct: 1   MFRPLPLFIGARYTRAKRRNHFISFISMTSMIGLSLGVLAMIVVLSVMNGFQREMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     PL D++  A+     P V+   P    +  +S        + V GI 
Sbjct: 61  GLVPHASI-LGVQPLGDWRKAADAALQNPAVMAAAPITEMEGMLS-YKGAMQPIQVSGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMG 181
            ++   +                 G+ GV+IG+  AR   ++ GDK+ ++ P     P G
Sbjct: 119 PAEEGKVSIVGQHIVQGRLQALQPGEYGVVIGELTARRFRLNTGDKLTLIVPEISKEPGG 178

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEA-QLYFNLENAVSGIEVFVKDPDAIEKT 240
           +  R +  TV+G+F++   + D    YM + +A ++       V G+ + + D  A  + 
Sbjct: 179 ITPRMQRLTVVGIFKVG-AELDGSQAYMHVADAGEMQRWSPGQVQGVRLKLHDLYAAPQV 237

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            + I   LG+     DW       FS  +
Sbjct: 238 SKAIAASLGDAYRADDWSHTQGSLFSAMK 266


>gi|109898047|ref|YP_661302.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudoalteromonas atlantica T6c]
 gi|109700328|gb|ABG40248.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Pseudoalteromonas atlantica T6c]
          Length = 403

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 137/272 (50%), Gaps = 16/272 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RY  S++ N FI+  +  S IG+ +G+M+LI V+SVMNGF  D+  R+L
Sbjct: 1   MFHSVSAFIGLRYAKSSKGNQFIAFINAFSAIGIALGLMSLITVLSVMNGFEGDLKDRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI- 121
           GI  H+V+  +     + + I + L  +P V     F+  +  V   S    GV+++G+ 
Sbjct: 61  GIAPHIVVDTQG----ENEQIISSLSKLPGVTATSDFIESEGVVQS-SRSLEGVMIQGVE 115

Query: 122 --SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV-T 178
             +  + S +  +     G +++      G+I+G+ L+  LG+ +G++  ILS  G V  
Sbjct: 116 PQTTHEHSIIAKNM--LVGQIADLTPGSYGIIVGRALSTRLGLRVGEQTRILSAQGSVFG 173

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P G     + +TV+G+F +   + D  ++ M++ + A+L  N  + ++   +F++DP   
Sbjct: 174 PFGQMPSQRLFTVVGVFDVG-SELDAKVILMNINDSAKLMRNKVSRIAQTRLFLQDPFEY 232

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +   + +  +   G+   DW+ R    F   +
Sbjct: 233 KTVVDKVTEV---GLKSDDWRTRQGPLFDAVK 261


>gi|167041978|gb|ABZ06715.1| putative Predicted permease [uncultured marine microorganism
           HF4000_141E02]
          Length = 396

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 114/246 (46%), Gaps = 2/246 (0%)

Query: 25  ISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIA 84
           +S  S  S +G+ IGV  ++ VMSVMNGF+ ++  R+LGI  H  I      L +   + 
Sbjct: 3   MSFISMFSVLGIAIGVAVIVTVMSVMNGFQSEVKNRMLGILPHAKIMGLGGSLENRDALQ 62

Query: 85  NRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDF 144
             L    DV     FVS +A + G S   SG+  +GI   +    Q           +  
Sbjct: 63  AALIANKDVKSFSAFVSSEALLLG-SKEVSGIQFKGIDPKESGSAQKLEGLMVQGQLDSM 121

Query: 145 DRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYD 203
             G   +++GK LA +L +S+GD + ++ P   ++ MG+  R K +TV G F     ++D
Sbjct: 122 SNGSFNIVLGKGLADDLNLSLGDPVTVMIPNSLISAMGVIPRLKQFTVSGFFEAGVYEFD 181

Query: 204 NGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQI 263
             + + +L +AQ    +   +SG+E+   DP    +    I    G G  + DW  +   
Sbjct: 182 RNLAFANLLDAQTLLQMPGKISGMEIDFFDPKQSREMVRKIAIGSGGGYTITDWTVQNPN 241

Query: 264 FFSCYE 269
           FF   E
Sbjct: 242 FFRSLE 247


>gi|330870698|gb|EGH05407.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. aesculi str. 0893_23]
          Length = 272

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 133/265 (50%), Gaps = 11/265 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 4   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 63

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I+    P+ D+  +A ++   P V+ V PF   Q     L+  G    VL+ G
Sbjct: 64  GMVPHATIESA-DPITDWCGLAAKVQENPQVLAVAPFTQMQGL---LTHDGKVQKVLLNG 119

Query: 121 ISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           I  ++   +   + F +  G + +      G++IG   A  LG+ +GDK+  ++P   VT
Sbjct: 120 IDPAEERKVSIIDHFIK-QGQLDSLSPGSFGIMIGDKAAAKLGVVVGDKLTFVAPEVTVT 178

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P GM  R K + V G+F +   + D  +   +L + A+L+    N V G+ +   D  A 
Sbjct: 179 PAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLARLHRWKPNQVQGLRLKFDDLFAA 238

Query: 238 EKTHENIVRILG-NGVVVIDWQQRY 261
            +T   I + LG N     DW + +
Sbjct: 239 PRTSWEIAQKLGENNFYSRDWTRTH 263


>gi|326561106|gb|EGE11471.1| lipoprotein ABC transporter permease protein LolC/E [Moraxella
           catarrhalis 7169]
 gi|326569414|gb|EGE19474.1| lipoprotein ABC transporter permease protein LolC/E [Moraxella
           catarrhalis BC8]
          Length = 414

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/272 (26%), Positives = 133/272 (48%), Gaps = 11/272 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  + RKN FIS  SFIS IG+ +GV  LI V+SVMNGF  ++  R+L
Sbjct: 1   MFRPLALFIGLRYTKAKRKNGFISFISFISTIGLTLGVAVLITVLSVMNGFDREIKSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFI-PDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
           G+     +      L ++Q +A ++    P+V  V P++  Q  ++      +G++V GI
Sbjct: 61  GMVPQASVTSTEI-LTNWQELAEKIKMQNPEVQAVAPYIQLQGMLTA-EGQVTGIVVSGI 118

Query: 122 S---NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV 177
                   S +    +   GN+ +D   G+ G+I+G+ +   +G+ +GDK+ ++ P    
Sbjct: 119 EPDYEKQVSIIDEHMTA--GNL-DDLHIGEFGIILGESIVSEMGLKLGDKVTLVLPEASP 175

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           +  G+  R K +T++G++ +   + D  M ++ +++A +   L     G+ + + D    
Sbjct: 176 SAAGVIPRFKRFTLVGVYHIS-SEIDGMMGFVRMRDAGVMLRLPEGAQGLRMKLNDIFKA 234

Query: 238 EKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +   N   I    +   DW   +   FS  +
Sbjct: 235 PQVANNAAGIDSLPLFPSDWTTTHGNLFSAIQ 266


>gi|119774469|ref|YP_927209.1| lipoprotein releasing system transmembrane protein LolE [Shewanella
           amazonensis SB2B]
 gi|119766969|gb|ABL99539.1| lipoprotein releasing system transmembrane protein LolE [Shewanella
           amazonensis SB2B]
          Length = 411

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 79/274 (28%), Positives = 137/274 (50%), Gaps = 10/274 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +FS    ++ +RY  + + NAF S  +  +  G+ +GV ALIVV SVMNG    +  R+L
Sbjct: 1   MFSSSAFLIGYRYWRARKANAFASFITLFAVSGIFLGVAALIVVSSVMNGLEGQLKTRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLD-FIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
           G    VV+ +K     D++  A++L   +P ++ V P    QA +   S+ G+ V + GI
Sbjct: 61  GAVPQVVV-EKNDGFADWRQTADQLQATLPGIVGVSPSTGTQAMLQSSSNIGA-VQLSGI 118

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV-TP 179
                S L +  +  Y    +    G+  +I+G  LA  L +++GD I +LS  G V +P
Sbjct: 119 LPEVESALASRTTTVYSPAFDSLISGEYRIILGVQLASELDVAVGDTIRVLSGEGVVFSP 178

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEA-QLYFNLENAVSGIEVFVKDPDAIE 238
           +G     + + V G+F+M     D  + ++   +A +L     + V G+ +++ DP   E
Sbjct: 179 LGPVPSQRKFIVSGLFQMG-SQVDAQLAFIHYDDARRLMRKAPDKVDGLRLYLDDPFEAE 237

Query: 239 KTHENIVRIL---GNGVVVIDWQQRYQIFFSCYE 269
            T + + +IL   G+ + V DW+  Y   F   +
Sbjct: 238 ATGKAVPQILAAEGDTLNVHDWRDGYGHLFGAVK 271


>gi|302184819|ref|ZP_07261492.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. syringae 642]
          Length = 416

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 133/265 (50%), Gaps = 11/265 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I+    P+ D++ +A ++   P V+ V PF   Q     L+  G    VL+ G
Sbjct: 61  GMVPHATIESA-DPITDWRGLAAKVQENPQVLAVAPFTQMQGL---LTHDGKVQKVLLNG 116

Query: 121 ISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           I  ++   +   + F +  G + +      G++IG   A  LG+ IGDK+  ++P   VT
Sbjct: 117 IDPTEERKVSIIDHFIK-QGRLDSLSPGSFGIMIGDKAAAKLGVGIGDKLTFVAPEVTVT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P GM  R K + V G+F +   + D  +   +L +  +L+    N V G+ +   D  A 
Sbjct: 176 PAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLGRLHRWKPNQVQGLRLKFDDLFAA 235

Query: 238 EKTHENIVRILG-NGVVVIDWQQRY 261
            +T   I + LG N     DW + +
Sbjct: 236 PRTSWEIAQKLGENNFYSRDWTRTH 260


>gi|226943589|ref|YP_002798662.1| lipoprotein releasing system, hypothetical protein [Azotobacter
           vinelandii DJ]
 gi|226718516|gb|ACO77687.1| Lipoprotein releasing system, transmembrane protein [Azotobacter
           vinelandii DJ]
          Length = 414

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 76/274 (27%), Positives = 124/274 (45%), Gaps = 15/274 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N +IS  S  S +G+ +GV+A+IVV+SVMNGF+++M  R+L
Sbjct: 1   MFRPLAVYIGARYTRAKRRNHYISFISLTSMLGLALGVLAMIVVLSVMNGFQKEMSSRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I     PL D++ +A      P V  V P       +S        + V+GI 
Sbjct: 61  GMVPHAAIVGA-QPLDDWRSLAGTALANPQVRAVAPLTELDGMLS-YKGTMQPIQVQGID 118

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPY-----GD 176
             +   +             D   G+ G IIG+  AR   + +GDK+ ++ P      G 
Sbjct: 119 PFEEPKVSIIADHLQQGRLTDLAPGEFGTIIGEITARRFALQVGDKLTLIVPELNGASGS 178

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENA-VSGIEVFVKDPD 235
           VTP     R +  +V+G+F++   + D  +  + + +A      +   V G+ + +KD  
Sbjct: 179 VTP-----RMQRLSVVGIFKIG-AELDGSLALIHVADAAHLMRWQPGQVQGVRLALKDLY 232

Query: 236 AIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
              K    I   LG     +DW Q     FS  +
Sbjct: 233 QAPKVAGGIAGELGAAYRAVDWTQTQGSLFSAMQ 266


>gi|167041422|gb|ABZ06174.1| putative Predicted permease [uncultured marine microorganism
           HF4000_006O13]
          Length = 396

 Score = 97.8 bits (242), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 114/246 (46%), Gaps = 2/246 (0%)

Query: 25  ISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIA 84
           +S  S  S +G+ IGV  ++ VMSVMNGF+ ++  R+LGI  H  I      L +   + 
Sbjct: 3   MSFISMFSVLGIAIGVAVIVTVMSVMNGFQSEVKNRMLGILPHAKIMGLGGSLENRDALQ 62

Query: 85  NRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDF 144
             L    DV     FVS +A + G S   SG+  +GI   +    Q           +  
Sbjct: 63  AALIANKDVKSFSAFVSSEALLLG-SKEVSGIQFKGIDPKESGSAQKLEGLMVQGQLDSM 121

Query: 145 DRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYD 203
             G   +++GK LA +L +S+GD + ++ P   ++ MG+  R K +TV G F     ++D
Sbjct: 122 SNGSFNIVLGKGLADDLNLSLGDPVTVMIPNSLISAMGVIPRLKRFTVSGFFEAGVYEFD 181

Query: 204 NGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQI 263
             + + +L +AQ    +   +SG+E+   DP    +    I    G G  + DW  +   
Sbjct: 182 RNLAFANLLDAQTLLQMPGKISGMEIDFFDPKQSREMVRKIAIGSGGGYTITDWTVQNPN 241

Query: 264 FFSCYE 269
           FF   E
Sbjct: 242 FFRSLE 247


>gi|289624086|ref|ZP_06457040.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289648578|ref|ZP_06479921.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. aesculi str. 2250]
          Length = 416

 Score = 97.4 bits (241), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 133/265 (50%), Gaps = 11/265 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I+    P+ D+  +A ++   P V+ V PF   Q     L+  G    VL+ G
Sbjct: 61  GMVPHATIESA-DPITDWCGLAAKVQENPQVLAVAPFTQMQGL---LTHDGKVQKVLLNG 116

Query: 121 ISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           I  ++   +   + F +  G + +      G++IG   A  LG+ +GDK+  ++P   VT
Sbjct: 117 IDPAEERKVSIIDHFIK-QGQLDSLSPGSFGIMIGDKAAAKLGVVVGDKLTFVAPEVTVT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P GM  R K + V G+F +   + D  +   +L + A+L+    N V G+ +   D  A 
Sbjct: 176 PAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLARLHRWKPNQVQGLRLKFDDLFAA 235

Query: 238 EKTHENIVRILG-NGVVVIDWQQRY 261
            +T   I + LG N     DW + +
Sbjct: 236 PRTSWEIAQKLGENNFYSRDWTRTH 260


>gi|254249950|ref|ZP_04943270.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia cenocepacia PC184]
 gi|124876451|gb|EAY66441.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia cenocepacia PC184]
          Length = 417

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 131/266 (49%), Gaps = 8/266 (3%)

Query: 7   FEVIVAWRYLFSNRKNA---FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FE  +  RY    R++A   F+S  +  +  G+ +GV ALIVV+SVMNGFR ++  R+L 
Sbjct: 5   FESQIGLRYAHGGRRSAGDGFVSFIAGAAMAGIALGVAALIVVLSVMNGFRTEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D++  A+       V  V P+V  QA ++  +   +GV +RGI  
Sbjct: 65  VLAHVEIFSPSGAMPDWRLTAHESLQNAAVRAVAPYVDAQALLTN-AGNVTGVALRGIDP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
                +     +      +    G+ G+++G  LA  L + IGD+I   +P G+   +G 
Sbjct: 124 VLEPRVSEIARKLKTGRLDALVPGEMGIVLGAALADALHVKIGDRITFFAP-GNTARLGD 182

Query: 183 GI-RSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
            + R + + V+G F      YD+ + Y+ +++AQ   N+ NA +GI + V D     +  
Sbjct: 183 ALPRFRQFNVVGTFESGHYQYDSALAYIHIRDAQQLSNV-NAPTGIRLRVDDLQRAPEIA 241

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
             + R L   + + DW ++ + +F  
Sbjct: 242 LALSRSLSGNLYIRDWTRQNRTWFEA 267


>gi|258544985|ref|ZP_05705219.1| lipoprotein releasing system transmembrane protein LolC
           [Cardiobacterium hominis ATCC 15826]
 gi|258519788|gb|EEV88647.1| lipoprotein releasing system transmembrane protein LolC
           [Cardiobacterium hominis ATCC 15826]
          Length = 415

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 73/270 (27%), Positives = 131/270 (48%), Gaps = 18/270 (6%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHV-- 68
           +  RY ++     FI + + ++ IG+ IG+ ALIVV+SVMNG    +  ++L +  H   
Sbjct: 8   IGLRYSYARSGARFIGLNAILAIIGITIGIAALIVVLSVMNGVVTQVRDKMLSMTSHAML 67

Query: 69  -------VIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI 121
                  VI  ++ P     ++AN    IP++I   P+V GQ  + G S    GV+++G+
Sbjct: 68  RSSDGTGVIPPEFDP---APYLAN----IPELIAYAPYVQGQGLI-GDSEHFQGVVLQGV 119

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
             ++   +  +F++    +S   + G   +I+G+ LA  +   +GDK+ I+ P    +  
Sbjct: 120 DPAEEGKVSQTFAKIDPEISGQLEAGHFNLILGQVLAEKINAKVGDKVTIIVPQVTASAA 179

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G+  R K +T++G F      +DNG+  ++ Q+A     L   V+G  + + DP      
Sbjct: 180 GLLPRIKRFTLVGTFSSGHYSFDNGVALVNYQDAAKLLQLPEGVTGYHIMLHDPMQAPLV 239

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYES 270
            E +   L  GV   DW      +FS  ++
Sbjct: 240 RERLTPQLPYGVYASDWSVDNASYFSAVQT 269


>gi|167589766|ref|ZP_02382154.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia ubonensis Bu]
          Length = 420

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 67/259 (25%), Positives = 122/259 (47%), Gaps = 23/259 (8%)

Query: 22  NAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQ 81
           N FIS  +  S  G+ +GV ALI+V+SVMNGFR ++  R+L +  H+ I      + D+ 
Sbjct: 26  NGFISFIAVASMSGIALGVAALIIVLSVMNGFRSEVRDRMLAVLAHIEIFSPTGTMPDWT 85

Query: 82  FIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGISNSDFSYLQNSFSRFYGN 139
             A        V    P+V  QA    L+ GG  +GV +RGI       L+   S    +
Sbjct: 86  LTAGESLRNSSVTSAAPYVEAQAL---LTHGGKVTGVALRGID----PRLEQQVS----D 134

Query: 140 VSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYT 190
           ++ D   G+         G+++G  LA  L +  GD++   +P G      +  + + + 
Sbjct: 135 IAKDMKSGRLDALAPGELGIVLGTALASTLQVQAGDRLTFFAPGGGAQMRNLLPQFRQFK 194

Query: 191 VLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGN 250
           V+G F      YD+ + ++ + +AQ  F++  A +G+ + + D +   +    + R L  
Sbjct: 195 VVGTFESGHYQYDSALAFIHIGDAQTLFHVA-APTGVRLRIDDMERAPEIALQLARSLSG 253

Query: 251 GVVVIDWQQRYQIFFSCYE 269
            + + DW ++ + +F   +
Sbjct: 254 DLYIRDWTRQNRTWFVAEQ 272


>gi|288818272|ref|YP_003432620.1| lipoprotein releasing system transmembrane protein, LolC/E family
           [Hydrogenobacter thermophilus TK-6]
 gi|288787672|dbj|BAI69419.1| lipoprotein releasing system transmembrane protein, LolC/E family
           [Hydrogenobacter thermophilus TK-6]
 gi|308751869|gb|ADO45352.1| protein of unknown function DUF214 [Hydrogenobacter thermophilus
           TK-6]
          Length = 396

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 78/264 (29%), Positives = 134/264 (50%), Gaps = 23/264 (8%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A RY  +++ +  +   S I+ +GV++ ++A+++ M V  GF+  + +++L  + H+V+
Sbjct: 11  IALRYTLASKGSTLL--VSVIALLGVVLSIVAILLTMGVFAGFQHALKEKILSTSPHIVV 68

Query: 71  Q---QKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNSD 125
                +  P  DYQ    R+  +  V  V P V  QA VS    GGS   V ++G+  SD
Sbjct: 69  SLLDSQNMP--DYQ---ERIKTLKGVKSVYPVVLYQAIVS---KGGSLQSVSIKGMKPSD 120

Query: 126 FSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIR 185
              +Q    +F   V  +F +G G+++GK LA  +GI  GD++ ++SP G  TP G   +
Sbjct: 121 I--IQKK--KFL--VKGEF-KG-GLLVGKGLADIMGIKPGDEVLLVSPMGKSTPFGFLPK 172

Query: 186 SKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIV 245
              + V G+F+    D D   V M + EA  +F     + G EVF+KDP   ++    I 
Sbjct: 173 VGHFRVDGIFQTGSFDQDYLTVLMPMSEANDFFGPSWQLYGFEVFIKDPYKAQQVKAQIE 232

Query: 246 RILGNGVVVIDWQQRYQIFFSCYE 269
           + L +  +V  W    +  F+  E
Sbjct: 233 KELSDSAIVRSWIDLNKPLFNALE 256


>gi|330878584|gb|EGH12733.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
          Length = 416

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 82/265 (30%), Positives = 135/265 (50%), Gaps = 11/265 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I+    P+ D++ +A ++   P V+ V PF   Q     L+  G    VL+ G
Sbjct: 61  GMVPHATIESA-DPITDWRGLAAKVQENPQVLAVAPFTQMQGL---LTHDGKVQKVLLNG 116

Query: 121 ISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           I+ ++   +   + F +  G + +      G++IG   A  LG+ +GDK+  ++P   VT
Sbjct: 117 INPAEERKVSIIDHFIK-QGQLDSLSPGSFGIMIGDKAAAKLGVVVGDKLTFVAPEVTVT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P GM  R K + V G+F +   + D  +   +L + A+L+    + V G+ +   D  A 
Sbjct: 176 PAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLARLHRWKPDQVQGLRLKFDDLFAA 235

Query: 238 EKTHENIVRILG-NGVVVIDWQQRY 261
            +T   I + LG N     DW + +
Sbjct: 236 PRTSWEIAQKLGENNFYSRDWTRTH 260


>gi|119505778|ref|ZP_01627846.1| ABC-type transport system, involved in lipoprotein release,
           permease component [marine gamma proteobacterium
           HTCC2080]
 gi|119458412|gb|EAW39519.1| ABC-type transport system, involved in lipoprotein release,
           permease component [marine gamma proteobacterium
           HTCC2080]
          Length = 413

 Score = 97.1 bits (240), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 123/271 (45%), Gaps = 24/271 (8%)

Query: 14  RYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQK 73
           RY F+ R+  F  + S  S +G+++GV +LI V+SVMNGF  ++  R+L +  H V+   
Sbjct: 4   RYTFTGRREGFARLVSRASMLGMILGVASLITVLSVMNGFALELRDRILSLVPHAVVSSP 63

Query: 74  YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLS----SGGSGVLV---RGISNSDF 126
             PL  +Q +A+ L  +P V  V PF+   A +   S    S  +G+ +   RG+S+   
Sbjct: 64  GNPLTQWQQLASELQAVPSVQSVAPFIEDIALLQSRSRRVGSQVTGIDLKAQRGVSDLHE 123

Query: 127 SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRS 186
             L           S  F     + +G  LA  LG   GD I ++ P   VTP+G+  R 
Sbjct: 124 RILSGDLGLLQ---SQPFT----IALGSTLAGQLGAMAGDVIEVVLPTLSVTPLGVFPRV 176

Query: 187 KSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVR 246
           +   V+  F +     D    Y+SL+ A   F     V G+++ +  PD +      +  
Sbjct: 177 RKLVVVAEFEVG-SSIDAVQSYVSLETAGRLFA-RRGVDGLQIDLGSPDNVADAAPPLRE 234

Query: 247 IL--------GNGVVVIDWQQRYQIFFSCYE 269
           +L         + +V+ DW+      FS  +
Sbjct: 235 MLRMTTAVSSPSDLVITDWRDSQGSLFSAVK 265


>gi|170726166|ref|YP_001760192.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Shewanella woodyi ATCC 51908]
 gi|169811513|gb|ACA86097.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella woodyi ATCC 51908]
          Length = 416

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 123/263 (46%), Gaps = 9/263 (3%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           + +RY  + + NAF S  +F +  G+++GV ALI+V SVMNG    + +R+LG    + +
Sbjct: 15  IGFRYWRARKANAFASFITFFAVSGILLGVAALIIVSSVMNGLEGQLKQRILGAVPQLTV 74

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQ 130
             +   L  +      L  +P V+   P ++ QA V    S  S + V GI       L+
Sbjct: 75  NSE-QALTHWHANVAELKTLPGVLAATPSIATQAMVQS-PSNISAIQVYGIYPEYEKVLE 132

Query: 131 NSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV-TPMGMGIRSKS 188
                      +    GK  +I+G +LAR L +SIG+K+ +LS  G V +P G     + 
Sbjct: 133 GKMQGVLNAHFSQLIPGKYRIILGSELARRLDVSIGEKVRVLSAEGVVYSPFGPVPSQRK 192

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDP---DAIEKTHENI 244
           + V G+F M     D  + Y+  ++AQ L       +  + +++ DP   +++     N+
Sbjct: 193 FVVAGIFEMG-SQVDASLAYVHYEDAQRLMRQPPGEIKHLRLYLADPFNAESLSSEVTNL 251

Query: 245 VRILGNGVVVIDWQQRYQIFFSC 267
            +  G  V   DW+  Y   FS 
Sbjct: 252 FKRQGIEVTTSDWRDTYGHLFSA 274


>gi|330967934|gb|EGH68194.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. actinidiae str. M302091]
          Length = 298

 Score = 97.1 bits (240), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 82/265 (30%), Positives = 135/265 (50%), Gaps = 11/265 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I+    P+ D++ +A ++   P V+ V PF   Q     L+  G    VL+ G
Sbjct: 61  GMVPHATIESA-DPITDWRGLAAKVQENPQVLAVAPFTQMQGL---LTHDGKVQKVLLNG 116

Query: 121 ISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           I+ ++   +   + F +  G + +      G++IG   A  LG+ +GDK+  ++P   VT
Sbjct: 117 INPAEERKVSIIDHFIK-QGQLDSLSPGSFGIMIGDKAAAKLGVVVGDKLTFVAPEVTVT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P GM  R K + V G+F +   + D  +   +L + A+L+    + V G+ +   D  A 
Sbjct: 176 PAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLARLHRWKPDQVQGLRLKFDDLFAA 235

Query: 238 EKTHENIVRILG-NGVVVIDWQQRY 261
            +T   I + LG N     DW + +
Sbjct: 236 PRTSWEIAQKLGENNFYSRDWTRTH 260


>gi|325917577|ref|ZP_08179777.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325536211|gb|EGD08007.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 413

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 70/261 (26%), Positives = 126/261 (48%), Gaps = 8/261 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFKPIPVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
            +  H  +  +  P+ D+Q         P V    P++  ++ + G        +VRGI 
Sbjct: 61  QMAAHATVSAEGAPMRDWQHAVEVAMADPRVAGAAPYIETESLLQGPRK--QPAIVRGIV 118

Query: 123 NSD---FSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
            ++    S L     +  G+V +       ++IGK+LA  LG+ +GD + +L      TP
Sbjct: 119 PAEENKVSVLAKKMQQ--GSVDSLTPGSYNIVIGKELALWLGVDVGDSVVVLLSDTQATP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           +G   R K +TV G+F   + + D G+  +++Q+      ++  V+G+ + + D D    
Sbjct: 177 LGAMPRLKRFTVSGIFEAGYNEIDRGLAVVNMQDLARVLRMDG-VTGVRLRLHDMDQAWN 235

Query: 240 THENIVRILGNGVVVIDWQQR 260
              ++   L     V DW Q 
Sbjct: 236 VARDLALKLHGPYRVSDWTQE 256


>gi|54309557|ref|YP_130577.1| putative ABC transporter integral membrane subunit [Photobacterium
           profundum SS9]
 gi|46913993|emb|CAG20775.1| putative ABC transporter integral membrane subunit [Photobacterium
           profundum SS9]
          Length = 402

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 76/267 (28%), Positives = 131/267 (49%), Gaps = 14/267 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RYL     + F    S++S  G+ IGV++L+ V+SVMNGF + +  R+L
Sbjct: 1   MFHPVSFFIGLRYLRGRSGDRFSRFVSYMSTAGITIGVLSLVTVLSVMNGFEQQLKDRIL 60

Query: 63  GINGHVVIQQK--YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           G+    VI Q     P+ D   I   L  +P V  V P   G+A +   SS  +G ++ G
Sbjct: 61  GVLPQAVISQDDGRMPVSDT--IPQSLQQLPHVTHVTPITRGEAVLQSASSLAAGNMI-G 117

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINIL-SPYGDVTP 179
           I  S +  +    +   G + N       V+IG+ LA  LG+ +GDKI ++ +     TP
Sbjct: 118 IDPSYYEPIAMDMT--VGKLDNLISGSYRVVIGQALANQLGVQVGDKIRLMVTSASQYTP 175

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEA-QLYFNLENAVSGIEVFVKDPDAIE 238
           +G     +++T+ G F     D D  ++  ++Q+A +L     + ++G  +F+ DP A+ 
Sbjct: 176 LGRIPSQRNFTIEGFFDTG-SDVDKQLILTNIQDAGKLLRYKADQITGWRLFLDDPFAVT 234

Query: 239 KTHENIVRILGNGVVVIDW-QQRYQIF 264
           +  +     + N     DW +QR ++F
Sbjct: 235 ELAQ---VSMPNDWQWSDWREQRGELF 258


>gi|269139411|ref|YP_003296112.1| lipoprotein releasing system, transmembrane [Edwardsiella tarda
           EIB202]
 gi|267985072|gb|ACY84901.1| lipoprotein releasing system, transmembrane [Edwardsiella tarda
           EIB202]
          Length = 400

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 72/263 (27%), Positives = 124/263 (47%), Gaps = 13/263 (4%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +  RY+     + F    S++S IG+ +GVMAL+ V+SVMNGF  D+ + +L +    V+
Sbjct: 9   IGLRYMRGRASDRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERDLEQSILNLMPQAVV 68

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQ 130
                 L   ++ A+ L  +P V +V P  +G   +    S G GV++ G++ ++     
Sbjct: 69  TTPQGQLDPARYPASLLQGLPGVHRVAPLTTGDVVLQSPHSVGVGVMI-GVNPTE----A 123

Query: 131 NSFSRFYGNVSND-FDRGK-GVIIGKDLARNLGISIGDKINILSPYG-DVTPMGMGIRSK 187
           +   R+   VS      G+   I+G  LA  LG+  GD++ ++ P     TPMG     +
Sbjct: 124 DPLDRYLNGVSQSALQPGQYRAILGSQLAAELGVKAGDRVRLMVPSASQFTPMGRIPSQR 183

Query: 188 SYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEKTHENIVR 246
            +TV+G F     + D   + ++ Q+A          +SG  +F+  P  IE     +  
Sbjct: 184 IFTVIGTFNADS-EVDQTQLLVNQQDASRLMRYPLGHISGWRLFMDRPLDIEAL---VAH 239

Query: 247 ILGNGVVVIDWQQRYQIFFSCYE 269
            L +G+V  DW+ R    F   +
Sbjct: 240 ALPDGLVWQDWRARKGELFQAVK 262


>gi|114563565|ref|YP_751078.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Shewanella frigidimarina NCIMB 400]
 gi|114334858|gb|ABI72240.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           protein [Shewanella frigidimarina NCIMB 400]
          Length = 413

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 67/231 (29%), Positives = 118/231 (51%), Gaps = 10/231 (4%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
             + + WR+  + + N FI   SF S  G+ +GV  LIVV+S MNGF +++  R+LG+  
Sbjct: 5   LPLTIGWRFFRARQSNGFIGFISFASTAGIALGVGVLIVVLSAMNGFEKELQDRLLGVVS 64

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI---SN 123
           H  +     P+ D+Q IA     +P +  V PFV  Q  V     G  G++V GI     
Sbjct: 65  HGELVGVNQPIADWQDIAKSASNMPQITGVAPFVRLQGLVQK-PGGFQGLIVNGIDIKHE 123

Query: 124 SDFSYLQNSFS-RFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
           SD S + +  S   + ++S+D +    +++G+ L   LG+ +GD + + +P  + + +  
Sbjct: 124 SDVSSIADYMSVDAWQSLSSDENH---IVLGRSLLTKLGLKVGDTLAMYTPDANNSQL-T 179

Query: 183 GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
             +S  + V G+F +   + ++   Y+SL        L +AVSG+ + V +
Sbjct: 180 SAKSHRFVVSGVFELG-GEIESTQAYVSLDYLADLLELGSAVSGVRIQVNN 229


>gi|107025588|ref|YP_623099.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia cenocepacia AU 1054]
 gi|116693229|ref|YP_838762.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia cenocepacia HI2424]
 gi|105894962|gb|ABF78126.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia cenocepacia AU 1054]
 gi|116651229|gb|ABK11869.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia cenocepacia HI2424]
          Length = 422

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/266 (27%), Positives = 131/266 (49%), Gaps = 8/266 (3%)

Query: 7   FEVIVAWRYLFSNRKNA---FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FE  +  RY    R++A   F+S  +  +  G+ +GV ALIVV+SVMNGFR ++  R+L 
Sbjct: 10  FEWQIGLRYARGGRRSAGDGFVSFIAGAAMAGIALGVAALIVVLSVMNGFRTEVRDRMLS 69

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D++  A+       V  V P+V  QA ++  +   +GV +RGI  
Sbjct: 70  VLAHVEIFSPSGAMPDWRLTAHESLQNAAVRAVAPYVDAQALLTN-AGNVTGVALRGIDP 128

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
                +     +      +    G+ G+++G  LA  L + IGD+I   +P G+   +G 
Sbjct: 129 VLEPRVSEIARKLKTGRLDALVPGEMGIVLGAALADTLHVKIGDRITFFAP-GNTARLGD 187

Query: 183 GI-RSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
            + R + + V+G F      YD+ + Y+ +++AQ   N+ NA +GI + + D     +  
Sbjct: 188 ALPRFRQFNVVGTFESGHYQYDSALAYIHIRDAQQLSNV-NAPTGIRLRIDDLQRAPEIA 246

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
             + R L   + + DW ++ + +F  
Sbjct: 247 LALSRTLSGNLYLRDWTRQNRTWFEA 272


>gi|308050218|ref|YP_003913784.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ferrimonas balearica DSM 9799]
 gi|307632408|gb|ADN76710.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Ferrimonas balearica DSM 9799]
          Length = 413

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 60/223 (26%), Positives = 108/223 (48%), Gaps = 10/223 (4%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           + WR+L +   N F+S  S  S +GV +GV  LI+V+S MNGF  ++  R+L +  H  +
Sbjct: 12  IGWRFLRARNNNRFVSFISLSSVVGVALGVTVLILVLSAMNGFERELKDRLLAVVPHAEM 71

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG---SGVLVRGISNSDFS 127
                P++D+  +    +  P V    PFV     + G+   G     V +RG+      
Sbjct: 72  TAIDTPIIDWPAMVQSAEAEPGVAAAAPFV----LIEGMLQKGDTMKPVALRGVLPKWEK 127

Query: 128 YLQNSFSRFYGNVSNDF-DRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRS 186
            + ++      +  N   D    +++GK LA  LG+ +GD+I++L P     P+  G R+
Sbjct: 128 DVSDAHRFMSDSAWNSLTDNQPNLVLGKALANQLGVEVGDRISLLLPRAGAGPLA-GYRT 186

Query: 187 KSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEV 229
           +  T+ G+F +   + D  + + +L  A     + + VSG+ +
Sbjct: 187 RHLTITGLFDLG-GEIDRTVAFTNLAAAAELAGMGDGVSGVRI 228


>gi|254508522|ref|ZP_05120640.1| lipoprotein releasing system, transmembrane protein LolE [Vibrio
           parahaemolyticus 16]
 gi|219548547|gb|EED25554.1| lipoprotein releasing system, transmembrane protein LolE [Vibrio
           parahaemolyticus 16]
          Length = 414

 Score = 96.7 bits (239), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 128/267 (47%), Gaps = 17/267 (6%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +FS   + +  R+  + ++N  +S  S  S IG+ +GV  +I+ +S MNGF  ++  RVL
Sbjct: 1   MFSSLSLFIGGRFSRAKQRNKMVSFISLSSTIGITVGVAVIIIGLSAMNGFERELKDRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG---SGVLVR 119
            +  H   +    P+ +++ +  +    P V    PFV     ++ L+  G     + VR
Sbjct: 61  SVISHGEFEGVRGPIQEWKSVIQQSQLHPKVEAAAPFVK----LTALAEKGQQLKAIEVR 116

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRGKG-VIIGKDLARNLGISIGDKINILSPYGDVT 178
           G+     S + N       +V   F  GK  VI+GK +A  L +++GD + ++ P    T
Sbjct: 117 GVDPKLESKVSNLSHYIDSDVWQQFTPGKKQVILGKGIADLLNVNVGDFLTLMIPTSGAT 176

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
                 +     V G+  +     D+ +  + L++AQLY  L +AVSG  V +K  D ++
Sbjct: 177 TKVQAPKRVRVQVAGLLTLN-GQIDHSLALVPLEDAQLYAKLGSAVSG--VALKVTDVLD 233

Query: 239 KTHENIVRILGNG----VVVIDWQQRY 261
            T   I+R +GN     V +  WQQ+Y
Sbjct: 234 ATQ--IIREVGNTLDEYVYLRSWQQKY 258


>gi|237797695|ref|ZP_04586156.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331020545|gb|EGI00602.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 416

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 83/266 (31%), Positives = 132/266 (49%), Gaps = 13/266 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I+    P+ D++ +A ++   P V+ V PF   Q     L+  G    VL+ G
Sbjct: 61  GMVPHATIESA-DPITDWRGLAAKVQENPQVLAVAPFTQMQGL---LTHDGKVQKVLLNG 116

Query: 121 I---SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDV 177
           I        S + N   +  G + +      G++IG   A  LG+ +GDK+  ++P   V
Sbjct: 117 IDPVEERKVSIIDNFIKQ--GRLDSLSPGSFGIMIGDKAAAKLGVVVGDKLTFVAPEVTV 174

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDA 236
           TP GM  R K + V G+F +   + D  +   +L + A+L+    + V G+ +   D  A
Sbjct: 175 TPAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLARLHRWKPHQVQGLRLKFDDLFA 234

Query: 237 IEKTHENIVRILG-NGVVVIDWQQRY 261
             +T   I + LG N     DW + +
Sbjct: 235 APRTSWEIAQKLGENNFYSRDWTRTH 260


>gi|289548944|ref|YP_003473932.1| hypothetical protein Thal_1173 [Thermocrinis albus DSM 14484]
 gi|289182561|gb|ADC89805.1| protein of unknown function DUF214 [Thermocrinis albus DSM 14484]
          Length = 392

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/262 (27%), Positives = 131/262 (50%), Gaps = 17/262 (6%)

Query: 10  IVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVV 69
           ++A RYL S+R +  +   S ++ +GV +GV A+++ M+V  GF+  +  ++L  + HVV
Sbjct: 6   VIALRYLLSSRGSTLV--VSGVALLGVALGVSAVLLTMAVFAGFQHALKDKILASSPHVV 63

Query: 70  IQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG--SGVLVRGISNSDFS 127
           +        D + + + +  +  V  V      QA    LS  G    + V+G+   D  
Sbjct: 64  VSLMTEK--DARDVRSVIQKVKGVRSVKLVTVYQAL---LSYNGRIQSITVKGMEPEDIR 118

Query: 128 YLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSK 187
            ++    +  G +       KG+++G+ +A  LG+ IGDK+ ++SP G  TP+G   ++ 
Sbjct: 119 SMEKFLVK--GKLE------KGLLLGEGVADVLGVKIGDKVVLVSPMGIRTPLGFLPKTA 170

Query: 188 SYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRI 247
           ++ V G+F+    + D   V + LQEAQ +F  +  + G EV++ DP   ++   NI  I
Sbjct: 171 TFEVAGIFKTGTFEQDYLTVILPLQEAQRFFGDDWQMRGFEVYLYDPYKADEIKRNISDI 230

Query: 248 LGNGVVVIDWQQRYQIFFSCYE 269
           L +  +V  W       F+  +
Sbjct: 231 LQDDAIVRSWMDLNAPLFNALQ 252


>gi|66045145|ref|YP_234986.1| hypothetical protein Psyr_1904 [Pseudomonas syringae pv. syringae
           B728a]
 gi|289679731|ref|ZP_06500621.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. syringae FF5]
 gi|63255852|gb|AAY36948.1| Protein of unknown function DUF214 [Pseudomonas syringae pv.
           syringae B728a]
 gi|330897613|gb|EGH29032.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. japonica str. M301072PT]
          Length = 416

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 132/265 (49%), Gaps = 11/265 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I+    P+ D++ +A ++   P V+ V PF   Q     L+  G    VL+ G
Sbjct: 61  GMVPHATIESA-DPITDWRGLAAKVQENPQVLAVAPFTQMQGL---LTHDGKVQKVLLNG 116

Query: 121 ISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           I   +   +   + F +  G + +      G++IG   A  LG+ IGDK+  ++P   VT
Sbjct: 117 IDPLEERKVSIIDHFIK-QGQLDSLSPGSFGIMIGDKAAAKLGVGIGDKLTFVAPEVTVT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P GM  R K + V G+F +   + D  +   +L +  +L+    N V G+ +   D  A 
Sbjct: 176 PAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLGRLHRWKPNQVQGLRLKFDDLFAA 235

Query: 238 EKTHENIVRILG-NGVVVIDWQQRY 261
            +T   I + LG N     DW + +
Sbjct: 236 PRTSWEIAQKLGENNFYSRDWTRTH 260


>gi|254284245|ref|ZP_04959213.1| transport protein of outer membrane lipoproteins (ABC superfamily,
           membrane) [gamma proteobacterium NOR51-B]
 gi|219680448|gb|EED36797.1| transport protein of outer membrane lipoproteins (ABC superfamily,
           membrane) [gamma proteobacterium NOR51-B]
          Length = 411

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 68/263 (25%), Positives = 128/263 (48%), Gaps = 10/263 (3%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A RY  S R+  F  + + +S  G+++GV +LI VMS+MNGF +++  R+L +  H  +
Sbjct: 7   IALRYGLSRRQQRFTRVVALVSTFGMVLGVASLITVMSIMNGFSDELHNRILAVVPHGKL 66

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI---SNSDFS 127
                 L D+  +  ++   P +  V P++     +        G +++GI   +  D +
Sbjct: 67  TASSGVLTDWPELKRKIMRQPGIKAVAPYIDETVLMQAWGQ-SRGSIMKGIDLEAERDIN 125

Query: 128 YLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSK 187
            L        G+++   +R   V +G+ LAR LG+S+GD + +  P   VTP+G+  R K
Sbjct: 126 QLHTHI--VSGSLNAIEERRFTVALGQSLARLLGVSVGDSVIVTVPSLTVTPLGLFPRIK 183

Query: 188 SYTVLGMFRM-RFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVR 246
              V+  F +   PD  +   Y+SL+ AQ    +E  V G+++   +  A  +  + +  
Sbjct: 184 RLEVVAEFEVGAEPDASHS--YVSLETAQRLLGVEG-VQGLQLRTDNLMAAPQIIDALGS 240

Query: 247 ILGNGVVVIDWQQRYQIFFSCYE 269
            L + + + DW+      F+  +
Sbjct: 241 QLPSTIALSDWRDTQGSLFTAVQ 263


>gi|330973220|gb|EGH73286.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. aceris str. M302273PT]
          Length = 416

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 83/265 (31%), Positives = 132/265 (49%), Gaps = 11/265 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I+    P+ D++ +A ++   P V+ V PF   Q     L+  G    VL+ G
Sbjct: 61  GMVPHATIESA-DPITDWRGLAAKVQENPQVLAVAPFTQMQGL---LTHDGKVQKVLLNG 116

Query: 121 ISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           I   +   +   + F +  G + +      G++IG   A  LG+ IGDK+  ++P   VT
Sbjct: 117 IDPLEERKVSIIDHFIK-QGQLDSLSPGSFGIMIGDKAAAKLGVGIGDKLTFVAPEVTVT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P GM  R K + V G+F +   + D  +   +L +  +L+    N V G+ +   D  A 
Sbjct: 176 PAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLGRLHRWKPNQVQGLRLKFDDLFAA 235

Query: 238 EKTHENIVRILG-NGVVVIDWQQRY 261
            +T   I + LG N     DW + +
Sbjct: 236 PRTSWEIAQKLGENNFYSRDWTRTH 260


>gi|330982238|gb|EGH80341.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 417

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 81/263 (30%), Positives = 131/263 (49%), Gaps = 7/263 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I+    P+ D++ +A ++   P V+ V PF   Q  ++        VL+ GI 
Sbjct: 61  GMVPHATIESA-DPITDWRGLAAKVQENPQVLAVAPFTQMQGLLTH-DGKVQKVLLNGID 118

Query: 123 NSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
             +   +   + F +  G + +      G++IG   A  LG+ IGDK+  ++P   VTP 
Sbjct: 119 PLEERKVSIIDHFIK-QGQLDSLSPGSFGIMIGDKAAAKLGVGIGDKLTFVAPEVTVTPA 177

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEK 239
           GM  R K + V G+F +   + D  +   +L +  +L+    N V G+ +   D  A  +
Sbjct: 178 GMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLGRLHRWKPNQVQGLRLKFDDLFAAPR 237

Query: 240 THENIVRILG-NGVVVIDWQQRY 261
           T   I + LG N     DW + +
Sbjct: 238 TSWEIAQKLGENNFYSRDWTRTH 260


>gi|28869312|ref|NP_791931.1| lipoprotein releasing system transmembrane protein LolC
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213967350|ref|ZP_03395498.1| lipoprotein releasing system transmembrane protein LolC
           [Pseudomonas syringae pv. tomato T1]
 gi|301381684|ref|ZP_07230102.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. tomato Max13]
 gi|302058442|ref|ZP_07249983.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. tomato K40]
 gi|302131153|ref|ZP_07257143.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28852553|gb|AAO55626.1| lipoprotein releasing system transmembrane protein LolC
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213927651|gb|EEB61198.1| lipoprotein releasing system transmembrane protein LolC
           [Pseudomonas syringae pv. tomato T1]
          Length = 416

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/265 (30%), Positives = 135/265 (50%), Gaps = 11/265 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I+    P+ D++ +A ++   P V+ V PF   Q     L+  G    VL+ G
Sbjct: 61  GMVPHATIESA-DPITDWRGLAAKVQENPQVLAVAPFTQMQGL---LTHDGKVQKVLLNG 116

Query: 121 ISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           I+ ++   +   + F +  G + +      G++IG   A  LG+ +GDK+  ++P   VT
Sbjct: 117 INPAEERKVSIIDHFIQ-QGQLDSLSAGSFGIMIGDKAAAKLGVVVGDKLTFVAPEVTVT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P GM  R K + V G+F +   + D  +   +L + A+L+    + V G+ +   D  A 
Sbjct: 176 PAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLARLHRWKPDQVQGLRLKFDDLFAA 235

Query: 238 EKTHENIVRILG-NGVVVIDWQQRY 261
            +T   I + LG N     DW + +
Sbjct: 236 PRTSWEIAQKLGENNFYSRDWTRTH 260


>gi|317051231|ref|YP_004112347.1| hypothetical protein Selin_1056 [Desulfurispirillum indicum S5]
 gi|316946315|gb|ADU65791.1| protein of unknown function DUF214 [Desulfurispirillum indicum S5]
          Length = 401

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 67/264 (25%), Positives = 122/264 (46%), Gaps = 5/264 (1%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           +E+ +AWR L   ++  FIS    IS +G+ IGV ALI+V+ VM GF  ++  ++LG   
Sbjct: 2   YELTIAWRNLRGKKREKFISFIGLISVLGIAIGVAALIIVLGVMKGFETELRSKILGATS 61

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
           H+V+      + +Y  +  R+  I  V      +     + G     SGV+ RGI     
Sbjct: 62  HIVVSSYDGVMTEYPDLERRIRAIDGVESASGVLHASLMLMG-QRNVSGVVARGIDPESH 120

Query: 127 SYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRS 186
           +++ +      G++ N   +   +IIG+ LA    + +G  +  L+P G + P G   + 
Sbjct: 121 AHIASYI--VEGSLQN-LHQPDSIIIGRQLASKYHLDVGSVVTFLAPSGRIGPFGSVPKR 177

Query: 187 KSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEKTHENIV 245
           K   V G+ +    +YD  + + S++  + +  + + +V+ IEV +++    E     I 
Sbjct: 178 KQMRVAGILQTGMYEYDTSLAFASIETVSDIAGHRDLSVNTIEVRIRNIFNTEDAMAAIR 237

Query: 246 RILGNGVVVIDWQQRYQIFFSCYE 269
             +G      DW       FS  +
Sbjct: 238 EEIGPMYFTRDWTTMNANLFSALK 261


>gi|330954501|gb|EGH54761.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae Cit 7]
          Length = 416

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 81/263 (30%), Positives = 131/263 (49%), Gaps = 7/263 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I+    P+ D++ +A ++   P V+ V PF   Q  ++        VL+ GI 
Sbjct: 61  GMVPHATIESA-DPITDWRGLAAKVQENPQVLAVAPFTQMQGLLTH-DGKVQKVLLNGID 118

Query: 123 NSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
             +   +   + F +  G + +      G++IG   A  LG+ IGDK+  ++P   VTP 
Sbjct: 119 PLEERKVSIIDHFIK-QGQLDSLSPGSFGIMIGDKAAAKLGVGIGDKLTFVAPEVTVTPA 177

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEK 239
           GM  R K + V G+F +   + D  +   +L +  +L+    N V G+ +   D  A  +
Sbjct: 178 GMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLGRLHRWKPNQVQGLRLKFDDLFAAPR 237

Query: 240 THENIVRILG-NGVVVIDWQQRY 261
           T   I + LG N     DW + +
Sbjct: 238 TSWEIAQKLGENNFYSRDWTRTH 260


>gi|331019546|gb|EGH99602.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 416

 Score = 96.3 bits (238), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 82/265 (30%), Positives = 135/265 (50%), Gaps = 11/265 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  H  I+    P+ D++ +A ++   P V+ V PF   Q     L+  G    VL+ G
Sbjct: 61  GMVPHATIESA-DPITDWRGLAAKVQENPQVLAVAPFTQMQGL---LTHDGKVQKVLLNG 116

Query: 121 ISNSDFSYLQ--NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           I+ ++   +   + F +  G + +      G++IG   A  LG+ +GDK+  ++P   VT
Sbjct: 117 INPAEERKVSIIDHFIQ-QGQLDSLSAGSFGIMIGDKAAAKLGVVVGDKLTFVAPEVTVT 175

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAI 237
           P GM  R K + V G+F +   + D  +   +L + A+L+    + V G+ +   D  A 
Sbjct: 176 PAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLARLHRWKPDQVQGLRLKFDDLFAA 235

Query: 238 EKTHENIVRILG-NGVVVIDWQQRY 261
            +T   I + LG N     DW + +
Sbjct: 236 PRTSWEIAQKLGENNFYSRDWTRTH 260


>gi|269139409|ref|YP_003296110.1| lipoprotein releasing system, transmembrane protein [Edwardsiella
           tarda EIB202]
 gi|267985070|gb|ACY84899.1| lipoprotein releasing system, transmembrane protein [Edwardsiella
           tarda EIB202]
 gi|304559305|gb|ADM41969.1| Lipoprotein releasing system transmembrane protein LolE
           [Edwardsiella tarda FL6-60]
          Length = 415

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 121/246 (49%), Gaps = 9/246 (3%)

Query: 24  FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFI 83
            +S+ S IS +G+ +GV  LIV +S MNGF  ++ +R+L +  H  I     P  D+Q +
Sbjct: 22  MVSLISVISTVGIALGVAVLIVGLSAMNGFERELDQRILSVVPHGEIYPVEQPFNDWQSV 81

Query: 84  ANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS---GVLVRGISNSDFSYLQNSFSRFYGNV 140
             R+D + DV+   P+V+     +GL   GS    V VRG+  +  S + +       N 
Sbjct: 82  LARVDRVKDVVGAAPYVN----FTGLMEHGSQLRAVQVRGVDPAQESRVSSLPRYVLDNA 137

Query: 141 SNDFDR-GKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRF 199
             DF   G+ VI+GK +A  LG+  GD + ++ P  D     +  +     V G+ ++  
Sbjct: 138 WADFRAGGQQVILGKGVADALGVRRGDWVTVMVPNSDPQMKLLQPKRIRLQVGGILQLSG 197

Query: 200 PDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQ 259
              D+ +  + L +AQ Y +L+++V+GI + V DP   +K       +  + V +  W+ 
Sbjct: 198 M-LDHTLALVPLADAQQYQDLDDSVTGIAIRVADPFQADKVVRAAGEVTNDYVYIRSWKG 256

Query: 260 RYQIFF 265
            Y   F
Sbjct: 257 TYGYMF 262


>gi|115377120|ref|ZP_01464335.1| ABC transporter, permease protein [Stigmatella aurantiaca DW4/3-1]
 gi|115365895|gb|EAU64915.1| ABC transporter, permease protein [Stigmatella aurantiaca DW4/3-1]
          Length = 774

 Score = 95.9 bits (237), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 135/281 (48%), Gaps = 57/281 (20%)

Query: 41  MALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFV 100
           MALI+V+SVM+GF  D+ K++LG + H V+ +    L +Y  +  ++  +P VI   PF+
Sbjct: 356 MALIIVLSVMSGFELDLQKKILGTHSHAVVSKYAGDLTEYPKLMEQVAQVPGVIGQSPFI 415

Query: 101 SGQAFVSGLSSGG-SGVLVRGI------SNSDFSY-------LQNSFS-------RFYGN 139
           + Q  +  +S G   GV+++GI      S +D          L+N  S       R  G 
Sbjct: 416 TNQVMI--VSDGNVDGVVIKGIDPATVGSVTDLPQYMLPGGSLENLTSPEKILPRRLQGG 473

Query: 140 VSNDF----DRG---------------------------KGVIIGKDLARNLGISIGDKI 168
            S D     DR                             G+I+G++LA +L   +GD++
Sbjct: 474 GSPDSPLLDDRPAGGTPEPEEEEDPIIGRPKKSAQEAVLPGIILGRELAASLRAVVGDRV 533

Query: 169 NILSPYG-DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGI 227
           NI+SP G ++ P G   +++ + V G+F     +YD   VY+ L+EAQ +F ++ A +GI
Sbjct: 534 NIVSPLGTEMGPTGPIPKNRVFRVAGIFYSGMYEYDAKFVYILLEEAQRFFEVKGA-NGI 592

Query: 228 EVFVKDPDAIEKTHENIVRILGN-GVVVIDWQQRYQIFFSC 267
           ++ V D D   +   ++VR LG       DW +  +  FS 
Sbjct: 593 DLKVADIDNARRLAADVVRKLGGYPYRARDWSETNRNLFSA 633


>gi|310822814|ref|YP_003955172.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Stigmatella aurantiaca DW4/3-1]
 gi|309395886|gb|ADO73345.1| Lipoprotein releasing system, transmembrane protein, LolC/E family
           [Stigmatella aurantiaca DW4/3-1]
          Length = 806

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 82/281 (29%), Positives = 135/281 (48%), Gaps = 57/281 (20%)

Query: 41  MALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFV 100
           MALI+V+SVM+GF  D+ K++LG + H V+ +    L +Y  +  ++  +P VI   PF+
Sbjct: 388 MALIIVLSVMSGFELDLQKKILGTHSHAVVSKYAGDLTEYPKLMEQVAQVPGVIGQSPFI 447

Query: 101 SGQAFVSGLSSGG-SGVLVRGI------SNSDFSY-------LQNSFS-------RFYGN 139
           + Q  +  +S G   GV+++GI      S +D          L+N  S       R  G 
Sbjct: 448 TNQVMI--VSDGNVDGVVIKGIDPATVGSVTDLPQYMLPGGSLENLTSPEKILPRRLQGG 505

Query: 140 VSNDF----DRG---------------------------KGVIIGKDLARNLGISIGDKI 168
            S D     DR                             G+I+G++LA +L   +GD++
Sbjct: 506 GSPDSPLLDDRPAGGTPEPEEEEDPIIGRPKKSAQEAVLPGIILGRELAASLRAVVGDRV 565

Query: 169 NILSPYG-DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGI 227
           NI+SP G ++ P G   +++ + V G+F     +YD   VY+ L+EAQ +F ++ A +GI
Sbjct: 566 NIVSPLGTEMGPTGPIPKNRVFRVAGIFYSGMYEYDAKFVYILLEEAQRFFEVKGA-NGI 624

Query: 228 EVFVKDPDAIEKTHENIVRILGN-GVVVIDWQQRYQIFFSC 267
           ++ V D D   +   ++VR LG       DW +  +  FS 
Sbjct: 625 DLKVADIDNARRLAADVVRKLGGYPYRARDWSETNRNLFSA 665


>gi|117620209|ref|YP_856538.1| lipoprotein releasing system, transmembrane protein LolE [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
 gi|117561616|gb|ABK38564.1| lipoprotein releasing system, transmembrane protein LolE [Aeromonas
           hydrophila subsp. hydrophila ATCC 7966]
          Length = 413

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 116/235 (49%), Gaps = 9/235 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  S R+N FI+  S  S IG+ +GVMALI+ +S MNGF  ++  RVL
Sbjct: 1   MFKPLPLFLGLRYSRSRRRNGFIAFISASSLIGIALGVMALILGLSAMNGFERELKNRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS---GVLVR 119
            +  H  +     PL ++  + + L   P V    P +     + GL   GS   G+ VR
Sbjct: 61  SVVPHGELMGMEAPLPNWPKLRDYLLAQPGVEAAAPVIR----LDGLLEHGSALKGLQVR 116

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
            +     + L ++ +   G    + + G+ G+I+GK +A  LG+ IGD + +L P G   
Sbjct: 117 AVLPELEANLSDAGNYMTGRGLRELEAGEHGLILGKTIADKLGVKIGDTVTLLLPQGGDA 176

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
                 + +S TV+G+  +     D  + +M L +AQ+   + +AV G  + V D
Sbjct: 177 AGIKNPKRESLTVVGLLEIGG-QLDGVLGFMHLADAQVITGMGSAVEGFSLKVND 230


>gi|304312033|ref|YP_003811631.1| hypothetical protein HDN1F_24050 [gamma proteobacterium HdN1]
 gi|301797766|emb|CBL45988.1| Conserved hypothetical protein [gamma proteobacterium HdN1]
          Length = 411

 Score = 95.9 bits (237), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 78/257 (30%), Positives = 123/257 (47%), Gaps = 6/257 (2%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + V  RYL + ++N FIS  S  + +GVM+GV  LIVV+SV+NGF  +  +RVL
Sbjct: 1   MFRPLSLFVGLRYLRAKQRNHFISFISSATILGVMLGVAVLIVVLSVINGFDREFQQRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS-GVLVRGI 121
           G+  H  I  +   + D+      L+ IP V    PFV  Q  +  +  GGS GV++ G+
Sbjct: 61  GMVSHANIWSR-SGIEDWPAAVKSLEQIPGVEGAAPFVRLQGML--MQQGGSTGVILMGV 117

Query: 122 SNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
             +  + +        G   +    G   ++IGK +A  LG+S+GD + ++ P    +  
Sbjct: 118 DPAYEARVSILPKYLEGTSLSVLSAGSFNILIGKPVAERLGLSVGDSVTLILPSPSSSSA 177

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G+    + + V G+F     + D  + Y+SL +AQ    L     GI + V D       
Sbjct: 178 GVSPLFQRFNVAGIFSTG-SEVDQLLAYVSLGDAQPLAQLGERAQGIRLRVADLFHASTI 236

Query: 241 HENIVRILGNGVVVIDW 257
            EN V  L      +DW
Sbjct: 237 AENAVASLRGPYWAVDW 253


>gi|127512563|ref|YP_001093760.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Shewanella loihica PV-4]
 gi|126637858|gb|ABO23501.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella loihica PV-4]
          Length = 417

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 75/250 (30%), Positives = 119/250 (47%), Gaps = 12/250 (4%)

Query: 5   SRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGI 64
            R    V WR+  + + N FIS  SF S  G+ +GV  LI V+S MNGF +++ +R+LG+
Sbjct: 3   ERLAFWVGWRFYMARQSNRFISFISFASTAGIALGVAVLITVLSAMNGFEKELEQRLLGV 62

Query: 65  NGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNS 124
             H  +     PL D+  IA     IP +    PFV  Q  +     G  G+ V GI+  
Sbjct: 63  VPHGELTGVNEPLHDWPKIAEDAKKIPGINASAPFVRIQGLIQK-PGGFQGLTVIGITPE 121

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGK--GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
             + + N    F  + +      K   +++GK LA  LG+S+G+ +++ +P       G 
Sbjct: 122 LEAKVSN-IRDFMPDAAWQALASKENNIVLGKGLADALGLSLGNTLSLYTPNLASQSTGR 180

Query: 183 GI---RSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           G+   +S  + V G+F +   + D    Y+SL        L + VSGI + V D  A  +
Sbjct: 181 GLGSAKSHQFKVAGIFALG-GELDLTTAYISLDYGAELLGLGDGVSGIRIKVDDVFAAPQ 239

Query: 240 THENIVRILG 249
               ++R LG
Sbjct: 240 ----LIRTLG 245


>gi|238920220|ref|YP_002933735.1| outer membrane-specific lipoprotein transporter subunit LolE
           [Edwardsiella ictaluri 93-146]
 gi|238869789|gb|ACR69500.1| lipoprotein releasing system, transmembrane protein LolE, putative
           [Edwardsiella ictaluri 93-146]
          Length = 415

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 71/246 (28%), Positives = 120/246 (48%), Gaps = 9/246 (3%)

Query: 24  FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFI 83
            +S+ S IS +G+ +GV  LIV +S MNGF  ++ +R+L +  H  I     P  D+Q +
Sbjct: 22  MVSLISVISTVGIALGVAVLIVGLSAMNGFERELDQRILSVVPHGEIYPVEQPFTDWQSV 81

Query: 84  ANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS---GVLVRGISNSDFSYLQNSFSRFYGNV 140
             R+D + DV+   P+V+     +GL   GS    V VRG+  +  S + +       N 
Sbjct: 82  LARVDRVKDVVGAAPYVN----FTGLMEHGSQLRAVQVRGVDPAQESRVSSLPRYVLDNA 137

Query: 141 SNDFDR-GKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRF 199
             DF   G+ VI+GK +A  LG+  GD + ++ P  D     +  +     V G+ ++  
Sbjct: 138 WVDFHAGGQQVILGKGVADALGVRRGDWVTVMVPNSDPQMKLLQPKRIRLQVGGILQLSG 197

Query: 200 PDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQ 259
              D+ +  + L +AQ Y +L ++V+GI + V DP   +K       +  + V +  W+ 
Sbjct: 198 M-LDHTLALVPLADAQQYQDLGDSVTGIAIRVADPFQADKVVRAAGEVTNDYVYIRSWKG 256

Query: 260 RYQIFF 265
            Y   F
Sbjct: 257 TYGYMF 262


>gi|330445695|ref|ZP_08309347.1| liporeleasing system, transmembrane, LolC/E family protein
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328489886|dbj|GAA03844.1| liporeleasing system, transmembrane, LolC/E family protein
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 401

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 75/266 (28%), Positives = 130/266 (48%), Gaps = 13/266 (4%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RYL     + F    S++S  G+ IGVMALI VMSVMNGF + +  R+L
Sbjct: 1   MFHPVSFFIGLRYLRGRSGDRFSRFVSYMSTAGITIGVMALITVMSVMNGFEDQLKGRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+    V+      +   +     L  +P V+ V     G+A +   SS  +G ++ GI 
Sbjct: 61  GVLPQAVVSSTDGRVPLSENAPEVLKKLPHVVNVTAITRGEAIIQSASSITAGTMI-GIE 119

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINIL-SPYGDVTPMG 181
            + +  +        G++S+       VIIG+ +A +LG+  GDKI ++ +     TP+G
Sbjct: 120 PNQYEPIAKHL--MVGSLSSLTPGSFKVIIGQAMAVSLGVQPGDKIRLMVTSASQFTPLG 177

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQ--LYFNLENAVSGIEVFVKDPDAIEK 239
                +++ V G++     D D  +VY ++ +A   L + L+  ++G  +++ DP  + +
Sbjct: 178 RMPSQRNFEVAGIYDTG-SDVDQQLVYTNISDAGRLLRYKLDQ-MTGWRLYLDDPFTVPE 235

Query: 240 THENIVRILGNGVVVIDWQ-QRYQIF 264
             E     L NG    DW+ QR ++F
Sbjct: 236 LKEK----LPNGWTWSDWRDQRGELF 257


>gi|77460080|ref|YP_349587.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas fluorescens Pf0-1]
 gi|77384083|gb|ABA75596.1| putative lipoprotein releasing system, membrane protein
           [Pseudomonas fluorescens Pf0-1]
          Length = 416

 Score = 95.5 bits (236), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 79/258 (30%), Positives = 126/258 (48%), Gaps = 20/258 (7%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           G+  H  I+     + D+  +A ++   P V  V PF   Q     L++ G       +S
Sbjct: 61  GMVPHATIESG-EAINDWPSLAAKVKQNPQVAAVAPFTQMQGL---LTNNGQ------VS 110

Query: 123 NSDFSYLQNSFSRFYGNVSNDFDRGK---------GVIIGKDLARNLGISIGDKINILSP 173
               + +  +  R    + N   +GK         G++IG   A  LG+ IGDKI  ++P
Sbjct: 111 KVLLNAIDPALERNVSIIDNFMKQGKLDDLTPGSFGIVIGDKAATKLGVGIGDKITFVAP 170

Query: 174 YGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVK 232
              VTP GM  R K +TV+G+F +   + D  +   +LQ+ A+++    + V G+ +   
Sbjct: 171 EVSVTPAGMFPRMKRFTVVGIFHVGAGELDGYLGVTNLQDLAKMHRWKPDQVQGLRLKFD 230

Query: 233 DPDAIEKTHENIVRILGN 250
           D     +   NI + LG 
Sbjct: 231 DLFQAPREAWNIAQRLGE 248


>gi|332174289|gb|AEE23543.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 403

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 76/272 (27%), Positives = 141/272 (51%), Gaps = 16/272 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RY  S++ N FI+  +  S IG+ +G+M+LI V+SVMNGF  D+  R+L
Sbjct: 1   MFHSVSAFIGLRYAKSSKGNHFIAFINAFSAIGIALGLMSLITVLSVMNGFEGDLKDRIL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
           GI  HVV+  +     + + I + L  +P VI    F+  +  V   S    GV+++GI 
Sbjct: 61  GIAPHVVVDTQG----ESEQIISSLSQLPGVIAASDFIESEGVVQS-SRSLEGVMIQGIE 115

Query: 123 -NSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV-TP 179
             +  ++   + +   G + ND   G  G+I+G+ L+  L + +G++  ILS  G V  P
Sbjct: 116 PQTTDAHSIIAENMMMGQI-NDLTPGSYGIIVGRALSTRLDLRLGEQTRILSAQGSVFGP 174

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIE 238
            G     + +TV+G++ +   + D+ ++ M++ + A+L  N  + ++   +F++DP    
Sbjct: 175 FGQMPSQRLFTVVGIYDVG-SELDSKVILMNINDSAKLMRNKVSRIAQTRLFLQDP---- 229

Query: 239 KTHENIVRILGN-GVVVIDWQQRYQIFFSCYE 269
             ++++V  L   G+   DW+ R    F   +
Sbjct: 230 FEYKSVVDTLSEMGLSSDDWRTRQGPLFDAVK 261


>gi|330961358|gb|EGH61618.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 316

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 82/268 (30%), Positives = 127/268 (47%), Gaps = 17/268 (6%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSG-------LSSGGSG 115
           G+  H  I+    P+ D++ +  ++   P V+ V PF   Q  ++        L +G   
Sbjct: 61  GMVPHATIESA-DPITDWRGLGAKVQENPQVLAVAPFTQMQGLLTHDGKVQKVLLNGIDP 119

Query: 116 VLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYG 175
           V  R +S  D    Q             F    G++IG   A  LG+ IGDK+  ++P  
Sbjct: 120 VEERKVSIIDHFIKQGQLDSL---TPGSF----GIMIGDKAAAKLGVGIGDKLTFVAPEV 172

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDP 234
            VTP GM  R K + V G+F +   + D  +   +L +  +L+    N V G+ +   D 
Sbjct: 173 TVTPAGMFPRMKRFEVTGIFHVGAGEIDGFLGLTNLDDLGRLHRWKPNQVQGLRLKFDDL 232

Query: 235 DAIEKTHENIVRILG-NGVVVIDWQQRY 261
            A  +T   I + LG N     DW + +
Sbjct: 233 FAAPRTSWEIAQKLGENNFYSRDWTRTH 260


>gi|261417019|ref|YP_003250702.1| protein of unknown function DUF214 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|261373475|gb|ACX76220.1| protein of unknown function DUF214 [Fibrobacter succinogenes subsp.
           succinogenes S85]
 gi|302326582|gb|ADL25783.1| lipoprotein releasing system transmembrane protein, LolC/E family
           [Fibrobacter succinogenes subsp. succinogenes S85]
          Length = 416

 Score = 95.5 bits (236), Expect = 7e-18,   Method: Compositional matrix adjust.
 Identities = 72/272 (26%), Positives = 132/272 (48%), Gaps = 19/272 (6%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           + S+ E+++AWRYL + RK+ F+S+    S +GV IGV AL+V ++ +NGF E++  +++
Sbjct: 1   MISKLELLIAWRYLGAQRKSLFVSLIGIFSMLGVSIGVFALVVALAAVNGFEEEVTAQMI 60

Query: 63  GINGHV-VIQQKYYPLVDYQFIANRLDF-IPDVIKVLPFVSGQAFVSGLSSG--GSGVLV 118
           G + H  ++     P+  Y  +   +   +PDV+   PF+    +  G+SS     G+++
Sbjct: 61  GKDAHFELMAYNGNPIGPYDSLTQEVQKRVPDVVASSPFI---VYKVGISSKKVNDGIVI 117

Query: 119 RGISNSDFSYLQNSFSRF-YGNVSNDF------DRGKGVIIGKDLARNLGISIGDKI--- 168
            GI  +    + +      +G  S D        R  G+I+G  LA  L + +GDK+   
Sbjct: 118 YGIDPATAKGVTDIHKYIKWGEYSVDSLEDMGGKRRPGIILGTGLAARLRVVVGDKLVLQ 177

Query: 169 NILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIE 228
              SP  D      G +     V G+F     +YD  + Y+ + + Q    + N V+GI+
Sbjct: 178 TFQSP--DEAMSSGGPKMMMCVVSGIFETGTYEYDGNLAYVGISDLQKLLGMGNTVTGIQ 235

Query: 229 VFVKDPDAIEKTHENIVRILGNGVVVIDWQQR 260
             +KD     +  +++   L      +DW+ +
Sbjct: 236 FRIKDHWKAGEAVDSMATWLSYPYYGMDWKSK 267


>gi|58581928|ref|YP_200944.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           oryzae pv. oryzae KACC10331]
 gi|188576498|ref|YP_001913427.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           oryzae pv. oryzae PXO99A]
 gi|289665889|ref|ZP_06487470.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           campestris pv. vasculorum NCPPB702]
 gi|58426522|gb|AAW75559.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           oryzae pv. oryzae KACC10331]
 gi|188520950|gb|ACD58895.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           oryzae pv. oryzae PXO99A]
          Length = 416

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 124/261 (47%), Gaps = 8/261 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 4   MFKPIPVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 63

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGI- 121
            +  H  +  +  P+ D+Q         P V    P++  ++ + G        +VRG+ 
Sbjct: 64  QMAAHATVSAEGAPMRDWQHAVEVAMSDPRVAGAAPYIETESLLQGPRK--QPAIVRGVI 121

Query: 122 --SNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
                  S L     +  G+V +       ++IGK+LA  LG+ +GD + +L      TP
Sbjct: 122 PAEEGKVSVLAKKMQQ--GSVDSLTPGSYNIVIGKELALWLGVDVGDSVVVLLSDTQATP 179

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           +G   R K +TV G+F   + + D G+  +++Q+      ++  V+G+ + + D D    
Sbjct: 180 LGAMPRLKRFTVSGIFEAGYNEIDRGLAVVNMQDLARVLRMDG-VTGVRLRLHDMDQAWP 238

Query: 240 THENIVRILGNGVVVIDWQQR 260
              ++   L     V DW Q 
Sbjct: 239 VARDLAVKLHGPYRVSDWTQE 259


>gi|84623839|ref|YP_451211.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           oryzae pv. oryzae MAFF 311018]
 gi|166712281|ref|ZP_02243488.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           oryzae pv. oryzicola BLS256]
 gi|289669021|ref|ZP_06490096.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           campestris pv. musacearum NCPPB4381]
 gi|84367779|dbj|BAE68937.1| lipoprotein releasing system transmembrane protein [Xanthomonas
           oryzae pv. oryzae MAFF 311018]
          Length = 413

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 69/261 (26%), Positives = 126/261 (48%), Gaps = 8/261 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RYL + R+N FIS  S  S +G+ +GV  LI  ++VM+GF++++  R+L
Sbjct: 1   MFKPIPVAIGLRYLRAKRRNGFISFISMASILGIALGVTVLITTLAVMSGFQKEIRDRLL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGIS 122
            +  H  +  +  P+ D+Q         P V    P++  ++ + G        +VRG+ 
Sbjct: 61  QMAAHATVSAEGAPMRDWQHAVEVAMSDPRVAGAAPYIETESLLQGPRK--QPAIVRGVI 118

Query: 123 NSD---FSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTP 179
            ++    S L     +  G+V +       ++IGK+LA  LG+ +GD + +L      TP
Sbjct: 119 PAEEGKVSVLAKKMQQ--GSVDSLTPGSYNIVIGKELALWLGVDVGDSVVVLLSDTQATP 176

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEK 239
           +G   R K +TV G+F   + + D G+  +++Q+      ++  V+G+ + + D D    
Sbjct: 177 LGAMPRLKRFTVSGIFEAGYNEIDRGLAVVNMQDLARVLRMDG-VTGVRLRLHDMDQAWP 235

Query: 240 THENIVRILGNGVVVIDWQQR 260
              ++   L     V DW Q 
Sbjct: 236 VARDLAVKLHGPYRVSDWTQE 256


>gi|323496027|ref|ZP_08101090.1| outer membrane-specific lipoprotein transporter subunit LolE
           [Vibrio sinaloensis DSM 21326]
 gi|323318918|gb|EGA71866.1| outer membrane-specific lipoprotein transporter subunit LolE
           [Vibrio sinaloensis DSM 21326]
          Length = 414

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 73/267 (27%), Positives = 126/267 (47%), Gaps = 17/267 (6%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +FS   + +  R+  + ++N  +S  S  S IG+ +GV  +I+ +S MNGF  ++  RVL
Sbjct: 1   MFSSLSLFIGGRFSRAKQRNKMVSFISLSSTIGITVGVAVIIIGLSAMNGFERELKDRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG---SGVLVR 119
            +  H   +    P+ ++Q + N+ +  P +    PFV     ++ L+  G     + VR
Sbjct: 61  SVISHGEFEGVRGPIEEWQSVVNQAEKHPKIEAAAPFVK----LTALAEKGQQLKAIEVR 116

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRG-KGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           G+     + + N        V   F+ G K VI+G+ +A  LG+ +GD + ++ P    T
Sbjct: 117 GVDPEQETRVSNLSQYIDPMVWQQFEPGNKQVILGQGVANLLGVDVGDYLTLMIPTAGST 176

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
                 +     V G+  +     D+ +  + L +AQ Y  L + VSG  V +K  D + 
Sbjct: 177 TKVQAPKRVRVQVAGLLTLN-GQIDHNLALVPLADAQQYAKLGSGVSG--VALKVTDVLN 233

Query: 239 KTHENIVRILGNG----VVVIDWQQRY 261
            T   IVR +GN     V +  WQQ+Y
Sbjct: 234 ATQ--IVREVGNTLDVYVYLRSWQQKY 258


>gi|127512561|ref|YP_001093758.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Shewanella loihica PV-4]
 gi|126637856|gb|ABO23499.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella loihica PV-4]
          Length = 410

 Score = 95.5 bits (236), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 74/265 (27%), Positives = 127/265 (47%), Gaps = 9/265 (3%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           + +RY  + + N F S  +  +  G+++GV ALI+V SVMNG    + +R+LG    + +
Sbjct: 9   IGYRYWRARKANPFASFITLFAVSGILLGVAALIIVSSVMNGLEGQLKQRILGAVPQLTV 68

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQ 130
             + + L  +Q +AN L     ++ + P V+ QA +    S  S V V GI         
Sbjct: 69  HCEQH-LGHWQDVANTLIDGKQILAMSPSVATQAMLQS-PSNISAVQVYGIYPELEKDNL 126

Query: 131 NSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV-TPMGMGIRSKS 188
           +  +R +    +  + GK  +IIG +LAR L +  GDKI +LS  G V +P+G     + 
Sbjct: 127 SRLNRHFNGSLDSLEAGKYRIIIGAELARRLDVKPGDKIRVLSGDGVVYSPLGPVPSQRK 186

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQEA-QLYFNLENAVSGIEVFVKDPDAIEKTHENI--- 244
           + V G+F M     D  + Y+  ++A +L     N +  + +++ DP    K    +   
Sbjct: 187 FIVAGVFEMG-SQVDASLAYVHHEDALRLMRKSPNEIKSLRLYLADPFKASKLASKVKAA 245

Query: 245 VRILGNGVVVIDWQQRYQIFFSCYE 269
               G+ V   DW++ Y   FS  +
Sbjct: 246 FEAAGDSVTTSDWRENYGHLFSAVK 270


>gi|90417521|ref|ZP_01225443.1| hypothetical protein GB2207_03212 [marine gamma proteobacterium
           HTCC2207]
 gi|90330674|gb|EAS45958.1| hypothetical protein GB2207_03212 [marine gamma proteobacterium
           HTCC2207]
          Length = 426

 Score = 95.1 bits (235), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 125/242 (51%), Gaps = 18/242 (7%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           + +   + +  RY+ S R+++F+S  S  S   + IGVMALIVV+SVMNGF  ++  R+L
Sbjct: 1   MLTNLPLFIGLRYMRSKRRDSFVSFISLFSLAAMAIGVMALIVVLSVMNGFDREIKMRLL 60

Query: 63  GINGHVVIQQ------KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG-SG 115
            +  HV +             ++ +  A   +    V+ V+P +  Q+FV G S G  +G
Sbjct: 61  RVVPHVTLTSPQGLDIAQINQLEAELKAGSDNAPVQVLSVVPLL--QSFVMGSSKGNQAG 118

Query: 116 VLVRGI---SNSDFSYLQNSFSRFYGNV-SNDFDRGKGVIIGKDLARNLGISIGDKINIL 171
           ++++GI   S +     +N  S + G + + +F    GV+IG  +AR L + +GD++ + 
Sbjct: 119 LVLQGIDPESRAGEKLAENMISGYVGQLQAGEF----GVVIGSQVARKLDLFVGDRLQLT 174

Query: 172 SPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFV 231
            P   VTP G   R K  TV G+F++     D  +V++  ++ Q    L     G+++ +
Sbjct: 175 LPSVTVTPAGAFPRIKRVTVTGIFQVG-AQVDASVVFIHYRDGQKLLRLGKRFQGVQLEL 233

Query: 232 KD 233
            D
Sbjct: 234 SD 235


>gi|212712827|ref|ZP_03320955.1| hypothetical protein PROVALCAL_03924 [Providencia alcalifaciens DSM
           30120]
 gi|212684519|gb|EEB44047.1| hypothetical protein PROVALCAL_03924 [Providencia alcalifaciens DSM
           30120]
          Length = 415

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 70/250 (28%), Positives = 119/250 (47%), Gaps = 15/250 (6%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
             ++ A R+    R+   +S+ S +S +G+++GV  LI+ +S MNGF  ++  RVL +  
Sbjct: 6   LTLLAALRFSRGRRRTGMVSLVSIVSTLGIVLGVAVLIIGLSAMNGFERELNNRVLSVVP 65

Query: 67  HVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS 124
           H  I     P  D++F  N +   P V  V P+V+   F   L  G +   + + G+S+ 
Sbjct: 66  HGQIYAVEAPYQDWEFAQNVIRKTPGVQAVSPYVN---FTGLLERGANLKAIQIMGVSHE 122

Query: 125 DFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMG 183
             S +         +    F+ GK  +I+G+ +A +L + +GD + I+ P  D +     
Sbjct: 123 TESQVSALPEFILNDAWQHFEAGKQSIILGQGVANSLNVKVGDWVTIMIPNTDDSMKIQQ 182

Query: 184 IRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP--------D 235
            R     V G+FR+     D+ +  + L +AQ Y    N +SG E+  KDP        D
Sbjct: 183 PRRIRVQVTGIFRLS-GLLDHQLALVPLADAQEYLGYGNGISGFEIKAKDPFEADKVVYD 241

Query: 236 AIEKTHENIV 245
           A  KT  ++V
Sbjct: 242 AGLKTMHHVV 251


>gi|229589094|ref|YP_002871213.1| putative lipoprotein releasing system, membrane protein
           [Pseudomonas fluorescens SBW25]
 gi|229360960|emb|CAY47820.1| putative lipoprotein releasing system, membrane protein
           [Pseudomonas fluorescens SBW25]
          Length = 416

 Score = 95.1 bits (235), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 82/269 (30%), Positives = 129/269 (47%), Gaps = 19/269 (7%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSG-------LSSGGSG 115
           G+  H  I+    P+ D+Q +A ++   P V+ V PF   Q  ++        L +    
Sbjct: 61  GMVPHATIEGD-APISDWQSLAAKVKQNPKVLAVAPFTQMQGLLTNDGKVQKILLNAIDP 119

Query: 116 VLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPY 174
              R +S  D   LQ           +D   G  G++IG   A  LG+ +GDK+  ++P 
Sbjct: 120 AQERNVSIIDKFMLQGKL--------DDLAPGSFGIVIGDKAAAKLGVGLGDKLTFVAPE 171

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKD 233
             VTP GM  R K +TV+G F +   + D  +   +L + A+L+    + V G+ +   D
Sbjct: 172 VTVTPAGMFPRMKRFTVVGTFHVGAGEIDGYLGLTNLTDLARLHRWQPDQVQGLRLKFND 231

Query: 234 PDAIEKTHENIVRILG-NGVVVIDWQQRY 261
                +    I + LG N     DW + +
Sbjct: 232 LFDAPRGAWEIAQHLGENQYYARDWTRTH 260


>gi|104782718|ref|YP_609216.1| lipoprotein releasing system transmembrane protein LolC
           [Pseudomonas entomophila L48]
 gi|95111705|emb|CAK16429.1| lipoprotein releasing system transmembrane protein LolC
           [Pseudomonas entomophila L48]
          Length = 416

 Score = 95.1 bits (235), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/256 (30%), Positives = 128/256 (50%), Gaps = 16/256 (6%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSG-------LSSGGSG 115
           G+  H  ++    P+ D+Q +A+++   P V+ V PF   Q  ++        L +G   
Sbjct: 61  GMIPHATLETG-QPIDDWQALASKVKQNPQVLAVAPFTQMQGLLTHEGKVQKVLLNGVDP 119

Query: 116 VLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYG 175
              R +S  D   L  S  +       ++    G++IG   A+ LG+ IGDK+  ++P  
Sbjct: 120 AREREVSIIDKFVLDGSLDKL---APGEW----GIMIGDKAAQKLGVGIGDKLTFVAPEV 172

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDP 234
            VTP GM  R K +TV+G F +   + D  +   +L + ++L+    + V G+ +   D 
Sbjct: 173 SVTPAGMFPRMKRFTVVGTFHVGAGEIDGYLGLTNLSDLSRLHRWKADQVQGLRLKFDDL 232

Query: 235 DAIEKTHENIVRILGN 250
               +   +I + LG 
Sbjct: 233 FQAPRAAWDIAQQLGE 248


>gi|297171074|gb|ADI22086.1| ABC-type transport system, involved in lipoprotein release,
           permease component [uncultured Planctomycetales
           bacterium HF0200_11L05]
          Length = 414

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 77/276 (27%), Positives = 132/276 (47%), Gaps = 24/276 (8%)

Query: 5   SRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGI 64
           S   + +A +YL   +++ F+S  S   F+GV +GV  LI+V SVMNGF +++ +RVL  
Sbjct: 2   SSLPLYIAIKYL-RGKRSGFLSFVSSAGFVGVALGVAVLILVSSVMNGFEKELRERVLQS 60

Query: 65  NGHVVI----QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
             H  I    +    P V    + N+     +++   P++  Q  + G S    G+ + G
Sbjct: 61  IPHASIIGGIEIDRVPQVRDILLENK-----EIVASSPYIESQGLI-GSSESLKGIYIFG 114

Query: 121 ISNSDFSYLQNSFS----RFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYG 175
           ++ +    L+N  S    R         +  K G+++G  LA  LGI IGD +N+L P  
Sbjct: 115 VNPN----LENEVSIVGKRIIEGSWKSIEEEKYGIVVGDILAYQLGIGIGDMVNVLFPDT 170

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDP- 234
            ++  G+  R+K + V G+F +  P+ D    Y+++  AQ    L++ V GI +  KD  
Sbjct: 171 TLSLAGILPRTKRFKVTGIFSIGAPEMDQSFAYINIINAQKLLRLDDTVHGIRIRYKDLF 230

Query: 235 DAIEKTHENIVRI---LGNGVVVIDWQQRYQIFFSC 267
            A +  H + +R+   L +     +W   Y   F  
Sbjct: 231 QAPQMVHLDTIRVNQALNSYYSSSNWTNTYGTLFKA 266


>gi|296125330|ref|YP_003632582.1| hypothetical protein Bmur_0277 [Brachyspira murdochii DSM 12563]
 gi|296017146|gb|ADG70383.1| protein of unknown function DUF214 [Brachyspira murdochii DSM
           12563]
          Length = 431

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 69/263 (26%), Positives = 137/263 (52%), Gaps = 12/263 (4%)

Query: 14  RYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQ- 72
           RYL + +K +F+S+ + I  +G+++G M +I V+SVMNGF++D+  ++LG+  H+ I   
Sbjct: 5   RYLRAKKKFSFVSVITIICVLGILVGDMVMITVLSVMNGFQDDIRDKILGMRAHINISSY 64

Query: 73  KYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNS 132
               + DY+++ + +    D+    P++     +   +     + VR   ++ FS     
Sbjct: 65  SDGAISDYKYVVDNIMDNKDITSAYPYIVIPCIMRSYNF-TILITVRSFEDNIFS-TDKD 122

Query: 133 FSRFYGNVS-NDFD-RGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYT 190
           F +++  V  N+ D +    +IG ++A++  +S+GD I+I+S  G     G   +  ++T
Sbjct: 123 FIKYFNFVEGNNKDMKTNEALIGSEMAKDYALSVGDTIDIISASGSFD-RGFKPQKTTFT 181

Query: 191 VLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVK---DPDAIEKTHENIVRI 247
           + G+++  + +YD+ MV + L   Q      NAV+G+ V VK   D D + K  ++ ++ 
Sbjct: 182 IKGVYKTGYYEYDSRMVIVPLSAGQSMVGYSNAVTGVAVKVKNFFDADKVAKQIDSDLKE 241

Query: 248 LGNGVVVIDWQQRYQIFFSCYES 270
             N   V+ W    + FF    +
Sbjct: 242 FYN---VMPWMLFDRNFFQALHT 261


>gi|219871779|ref|YP_002476154.1| outer membrane-specific lipoprotein transporter subunit LolE
           [Haemophilus parasuis SH0165]
 gi|219691983|gb|ACL33206.1| outer membrane-specific lipoprotein transporter subunit LolE
           [Haemophilus parasuis SH0165]
          Length = 416

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/237 (30%), Positives = 120/237 (50%), Gaps = 23/237 (9%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           ++WRY    +KN  +S+ S  S +G+ +GV  LI+ +S MNGF  ++ +RVL +  H  I
Sbjct: 7   ISWRYQRGKQKNRLVSLISLFSSVGIALGVAVLIIGLSAMNGFERELNQRVLSVVPHAEI 66

Query: 71  ----QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGV---LVRGISN 123
               + K   +V    + N +   P+V  + PFVS     +GL   GS +    VRGI  
Sbjct: 67  MAYNESKSATIVQGDRLENIVKDTPNVTALSPFVS----FTGLIENGSQLKIAQVRGIDP 122

Query: 124 SDFSYLQNSFSRFYGNVSND----FDRGKGVIIGKDLARNLGISIGDKINILSPY-GDVT 178
           +     Q   SR    +  D    F +  G+I+G  +AR+L I++GD++ +L P+  D  
Sbjct: 123 TK----QEQVSRLAQFIPQDQWQAFKQEGGLILGAGIARSLDINVGDEVTLLLPHPTDDG 178

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDP 234
            +   +R  S TV G+ R+     D+    + + +AQ    L+ +  +GIE+ VK P
Sbjct: 179 KLAQPLRF-SLTVTGILRLD-GQLDHSYALLPIAKAQELLELKPSQYTGIELAVKQP 233


>gi|238920222|ref|YP_002933737.1| outer membrane-specific lipoprotein transporter subunit LolC
           [Edwardsiella ictaluri 93-146]
 gi|238869791|gb|ACR69502.1| conserved hypothetical protein [Edwardsiella ictaluri 93-146]
          Length = 400

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/263 (27%), Positives = 123/263 (46%), Gaps = 13/263 (4%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +  RY+     + F    S++S IG+ +GVMAL+ V+SVMNGF  D+ + +L +    V+
Sbjct: 9   IGLRYMRGRASDRFGRFVSWLSTIGITLGVMALVTVLSVMNGFERDLEQSILNLMPQAVV 68

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQ 130
                 L   ++ A+ L  +P V +  P  +G   +    S G GV++ G+ N D +   
Sbjct: 69  TTPQGQLDPARYPASLLQGLPGVHRAAPLTTGDVVLQSPHSVGVGVMI-GV-NPDEA--- 123

Query: 131 NSFSRFYGNVSND-FDRGK-GVIIGKDLARNLGISIGDKINILSPYG-DVTPMGMGIRSK 187
           +   R+   VS      G+   I+G  LA  LG+  GD++ ++ P     TPMG     +
Sbjct: 124 DPLDRYLNGVSQSALQPGQYRAILGSQLAAELGVKAGDRVRLMVPSASQFTPMGRIPSQR 183

Query: 188 SYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEKTHENIVR 246
            +TV+G F     + D   + ++ Q+A          +SG  +F+  P  IE     +  
Sbjct: 184 IFTVIGTFNADS-EVDQTQLLVNQQDASRLMRYPLGHISGWRLFMDRPLDIEAL---VAH 239

Query: 247 ILGNGVVVIDWQQRYQIFFSCYE 269
            L +G+V  DW+ R    F   +
Sbjct: 240 ALPDGLVWQDWRARKGELFQAVK 262


>gi|315634392|ref|ZP_07889679.1| lipoprotein ABC superfamily ATP binding cassette transporter,
           membrane protein [Aggregatibacter segnis ATCC 33393]
 gi|315476982|gb|EFU67727.1| lipoprotein ABC superfamily ATP binding cassette transporter,
           membrane protein [Aggregatibacter segnis ATCC 33393]
          Length = 416

 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 70/234 (29%), Positives = 117/234 (50%), Gaps = 17/234 (7%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           ++WRY  S  KN  +S+ SF S +G+ +GV  LI+ +S MNGF  ++ +R+L +  H  I
Sbjct: 7   ISWRYQRSKHKNRLVSLISFFSSMGIALGVAVLIIGLSAMNGFERELNQRILAVVPHAEI 66

Query: 71  Q----QKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
                Q   P+  +Q +A +L   P +I V PFVS  A V    +    V ++G+  +  
Sbjct: 67  SSASGQSNAPIDHWQHLAAKLKQNPQIIGVSPFVSFTALVEN-GAKLKVVQIKGVETA-- 123

Query: 127 SYLQNSFSRFYGNVSN----DFDRGKGVIIGKDLARNLGISIGDKINIL-SPYGDVTPMG 181
             LQ+  S     V N    +F +  G+++G  +AR+L +  GD +++L S       + 
Sbjct: 124 --LQDQVSSLGHFVLNQGWQNFAQNGGLVLGSGIARDLDVQEGDWVSLLISQQKGTENLT 181

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDP 234
             +R +   V G+ R+     D+    M L +AQ   + +   VSG+E+   DP
Sbjct: 182 QPLRER-IQVTGILRLD-GQLDHSYALMPLAQAQQLMDYQAEQVSGVELKTADP 233


>gi|261253313|ref|ZP_05945886.1| lipoprotein releasing system transmembrane protein LolE [Vibrio
           orientalis CIP 102891]
 gi|260936704|gb|EEX92693.1| lipoprotein releasing system transmembrane protein LolE [Vibrio
           orientalis CIP 102891]
          Length = 414

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 79/272 (29%), Positives = 127/272 (46%), Gaps = 19/272 (6%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +FS     +A R+    ++N  +S  S  S IG+ +GV  +I+ +S MNGF  ++  RVL
Sbjct: 1   MFSSLSHFIARRFSRGKQRNKMVSFISMSSTIGIAVGVAVIIIGLSAMNGFERELNNRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS---GVLVR 119
            +  H   +    PLV++Q +  + +  P +    P+V     ++ L+  G+    + VR
Sbjct: 61  SVISHGEFEGVRGPLVEWQQVVTQAEKHPKIEAAAPYVK----LTALAEKGTQLKAIEVR 116

Query: 120 GISNSDFSYLQNSFSRFYG-NVSNDFDRG-KGVIIGKDLARNLGISIGDKINILSPYGDV 177
           GI       + +S S F   +V   F  G +  I+GK +A  LG+  GD + ++ P G  
Sbjct: 117 GIDPEQEGRV-SSLSDFIDPSVWASFKAGQQQAILGKGVADLLGVKKGDYLTLMIPTGGA 175

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAI 237
           T      +     V G+  +     D+ +  + L +AQ Y  L   VSG  V VK  D +
Sbjct: 176 TTKVQAPKRVRVKVAGLLTLN-GQIDHNLALIPLADAQSYAKLGQGVSG--VAVKVTDVL 232

Query: 238 EKTHENIVRILGNGVVVI----DWQQRYQIFF 265
           E T   IVR  GN + V      WQQ+Y   +
Sbjct: 233 EATQ--IVREAGNTLSVYVYLRSWQQKYGFLY 262


>gi|170737505|ref|YP_001778765.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Burkholderia cenocepacia MC0-3]
 gi|169819693|gb|ACA94275.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Burkholderia cenocepacia MC0-3]
          Length = 417

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 73/266 (27%), Positives = 130/266 (48%), Gaps = 8/266 (3%)

Query: 7   FEVIVAWRYLFSNRKNA---FISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLG 63
           FE  +  RY    R++A   F+S  +  +  G+ +GV ALIVV+SVMNGFR ++  R+L 
Sbjct: 5   FEWQIGLRYARGGRRSAGDGFVSFIAGAAMAGIALGVAALIVVLSVMNGFRTEVRDRMLS 64

Query: 64  INGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISN 123
           +  HV I      + D++   +       V  V P+V  QA ++  +   +GV +RGI  
Sbjct: 65  VLAHVEIFSPSGAMPDWRLTVHESLQNAAVRTVAPYVDAQALLTN-AGNVTGVALRGIDP 123

Query: 124 SDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
                +     +      +    G+ G+++G  LA  L + IGD+I   +P G+   +G 
Sbjct: 124 VLEPRVSEIARKLKTGRLDALVPGEMGIVLGAALADALHVKIGDRITFFAP-GNTARLGD 182

Query: 183 GI-RSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTH 241
            + R + + V+G F      YD+ + Y+ +++AQ  FN+  A +GI + + D     +  
Sbjct: 183 ALPRFRQFNVVGTFESGHYQYDSALAYIHIRDAQQLFNVP-APTGIRLRLDDLQHAPEIA 241

Query: 242 ENIVRILGNGVVVIDWQQRYQIFFSC 267
             + R L   + + DW ++ + +F  
Sbjct: 242 LALSRTLSGNLYIRDWTRQNRTWFEA 267


>gi|90413105|ref|ZP_01221102.1| putative ABC transporter integral membrane subunit [Photobacterium
           profundum 3TCK]
 gi|90325948|gb|EAS42394.1| putative ABC transporter integral membrane subunit [Photobacterium
           profundum 3TCK]
          Length = 402

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 74/267 (27%), Positives = 130/267 (48%), Gaps = 14/267 (5%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F      +  RYL     + F    S++S  G+ IGV++L+ V+SVMNGF + +  R+L
Sbjct: 1   MFHPVSFFIGLRYLRGRSGDRFSRFVSYMSTAGITIGVLSLVTVLSVMNGFEQQLKDRIL 60

Query: 63  GINGHVVIQQK--YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           G+    VI Q     P+ D   +   L  +P V  V P   G+A +   SS  +G ++ G
Sbjct: 61  GVLPQAVISQDDGRMPVSDT--VPQSLQQLPHVTHVTPITRGEAVLQSASSLAAGNMI-G 117

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINIL-SPYGDVTP 179
           I  S +  +    +   G + N       V+IG+ LA  LG+ +GDKI ++ +     TP
Sbjct: 118 IDPSYYEPIAMDMT--VGKLDNLVAGSYRVVIGQALANQLGVQVGDKIRLMVTSASQYTP 175

Query: 180 MGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIE 238
           +G     +++T+ G F     D D  ++  ++Q+A      + + ++G  +F+ DP A+ 
Sbjct: 176 LGRIPSQRNFTIEGFFDTG-SDVDKQLILTNIQDAGKLLRYKVDQITGWRLFLDDPFAVT 234

Query: 239 KTHENIVRILGNGVVVIDW-QQRYQIF 264
           +  +     + N     DW +QR ++F
Sbjct: 235 ELAQ---VPMPNDWQWSDWREQRGELF 258


>gi|153837308|ref|ZP_01989975.1| lipoprotein-releasing system transmembrane protein LolC [Vibrio
           parahaemolyticus AQ3810]
 gi|149749339|gb|EDM60112.1| lipoprotein-releasing system transmembrane protein LolC [Vibrio
           parahaemolyticus AQ3810]
          Length = 405

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 80/269 (29%), Positives = 132/269 (49%), Gaps = 18/269 (6%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           ++    + +  RYL     + F    S++S  G+ IGVMAL+ V+SVMNGF   + +R+L
Sbjct: 4   MYHPISLFIGLRYLRGRSGDRFSRFVSYMSTAGITIGVMALVTVLSVMNGFEAQLKERIL 63

Query: 63  GINGHVVIQQK--YYPLVDY--QFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLV 118
           G+  H VI Q     PL +   QFI      + DV +  P V G+A +   +   +G L+
Sbjct: 64  GVLPHAVISQHDGRTPLTESAPQFI----QAMSDVAEPEPVVRGEAVIQSSAQLTAGYLI 119

Query: 119 RGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINIL-SPYGDV 177
            GI       + N      G +S+       V +G  LAR+L +SIGDK+ ++ +     
Sbjct: 120 -GIEPKKGDPIANHL--IAGRLSSLQAGEYKVFLGHSLARSLKVSIGDKVRLMVTNATQF 176

Query: 178 TPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPDA 236
           TP+G     +++TV G+F     D D  ++ +++ +A     L ++ VSG  VF  DP  
Sbjct: 177 TPLGRIPSQRNFTVAGIFNTG-SDVDGQLMIVNMADAAKLMRLPKDTVSGWRVFFSDPFM 235

Query: 237 IEKTHENIVRILGNGVVVIDWQ-QRYQIF 264
           +    +   + +  G    DW+ QR ++F
Sbjct: 236 VTDFAD---KPMPEGWQWSDWRAQRGELF 261


>gi|148548794|ref|YP_001268896.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas putida F1]
 gi|148512852|gb|ABQ79712.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Pseudomonas putida F1]
          Length = 416

 Score = 94.4 bits (233), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 68/189 (35%), Positives = 102/189 (53%), Gaps = 11/189 (5%)

Query: 14  RYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQK 73
           RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVLG+  H  ++  
Sbjct: 12  RYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVLGMIPHATLESG 71

Query: 74  YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS---DFSY 128
             P+ D+Q +A ++   P V+ V PF   Q     L+  G    VL+ GI  +   + S 
Sbjct: 72  -QPIADWQALAQQVKQNPQVVAVAPFTQMQGL---LTHDGKVQKVLLNGIDPAREREVSI 127

Query: 129 LQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKS 188
           + N      G +        G++IG   A  LG++IGDK+  ++P   VTP GM  R K 
Sbjct: 128 IDNFV--LQGRLDQLAPGEWGIMIGDKAAAKLGVAIGDKLTFVAPEVSVTPAGMFPRMKR 185

Query: 189 YTVLGMFRM 197
           +TV+G F +
Sbjct: 186 FTVVGTFHV 194


>gi|325277321|ref|ZP_08142946.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas sp. TJI-51]
 gi|324097511|gb|EGB95732.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Pseudomonas sp. TJI-51]
          Length = 414

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 125/243 (51%), Gaps = 12/243 (4%)

Query: 14  RYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQK 73
           RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVLG+  H  ++  
Sbjct: 10  RYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVLGMIPHATLESG 69

Query: 74  YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS---DFSY 128
             P+ D+Q +A ++   P V+ V PF   Q     L+  G    VL+ GI  +   + S 
Sbjct: 70  -QPIADWQALAQQVKQNPQVVAVAPFTQMQGL---LTHDGKVQKVLLNGIDPAREREVSI 125

Query: 129 LQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKS 188
           + N      G +        G++IG   A  LG++IGDK+  ++P   VTP GM  R K 
Sbjct: 126 IDNFV--LQGRLDQLAPGEWGIMIGDKAAAKLGVAIGDKLTFVAPEVSVTPAGMFPRMKR 183

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRI 247
           +TV+G F +   + D  +   ++ + ++L+    + V G+ +   D     +   +I + 
Sbjct: 184 FTVVGTFHVGAGEIDGYLGLTNISDLSRLHRWKPDQVQGLRLKFDDLFQAPRVAWSIAQQ 243

Query: 248 LGN 250
           LG+
Sbjct: 244 LGD 246


>gi|145298865|ref|YP_001141706.1| lipoprotein releasing system transmembrane protein LolE [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|142851637|gb|ABO89958.1| lipoprotein releasing system transmembrane protein LolE [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 411

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 81/273 (29%), Positives = 134/273 (49%), Gaps = 23/273 (8%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  S R N F+S  S  S  G+ IGV AL+VV+SVMNGF   +  R+L
Sbjct: 5   LFQPLSLAIGLRYAGSRRSNRFVSFISLFSTFGIAIGVAALMVVISVMNGFEGQLKGRIL 64

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRG 120
           G+  HVV+  +   +  +      L  +P VI   P +  +     L S G   GV V+G
Sbjct: 65  GVIPHVVVTNQTDRIDAHPDGLPDLAKLPHVIASAPMLDSEGM---LQSPGQLIGVSVQG 121

Query: 121 ISNS-----DFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPY 174
           I  +     D  + Q    R      +   +G+  +++G+ +A  L +S+GD++ +L   
Sbjct: 122 IDPAQWPKDDILHAQMQMGRL-----DSLQQGEYHIVLGQGVASRLKVSMGDQVRLLLTE 176

Query: 175 GD-VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLEN-AVSGIEVFVK 232
           G   TP G     + +TV G+F +   D D+ +  ++L +AQ    L    V GI +++ 
Sbjct: 177 GTRFTPFGRVPAQRLFTVSGIFGVG-ADVDSQVALVALGDAQRLLRLPTETVGGIRLWLD 235

Query: 233 DPDAIEKTHENIVRILGNGVVVIDW-QQRYQIF 264
           DP A ++    I   L +G+   DW ++R ++F
Sbjct: 236 DPFAADQV---IKTALPDGLEWQDWRRERGELF 265


>gi|28897751|ref|NP_797356.1| hypothetical protein VP0977 [Vibrio parahaemolyticus RIMD 2210633]
 gi|308094432|ref|ZP_05889273.2| outer membrane-specific lipoprotein transporter subunit [Vibrio
           parahaemolyticus AN-5034]
 gi|308095507|ref|ZP_05906436.2| outer membrane-specific lipoprotein transporter subunit [Vibrio
           parahaemolyticus Peru-466]
 gi|308126688|ref|ZP_05911870.2| outer membrane-specific lipoprotein transporter subunit [Vibrio
           parahaemolyticus AQ4037]
 gi|28805964|dbj|BAC59240.1| conserved hypothetical protein [Vibrio parahaemolyticus RIMD
           2210633]
 gi|308085453|gb|EFO35148.1| outer membrane-specific lipoprotein transporter subunit [Vibrio
           parahaemolyticus Peru-466]
 gi|308093816|gb|EFO43511.1| outer membrane-specific lipoprotein transporter subunit [Vibrio
           parahaemolyticus AN-5034]
 gi|308110358|gb|EFO47898.1| outer membrane-specific lipoprotein transporter subunit [Vibrio
           parahaemolyticus AQ4037]
          Length = 405

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 80/270 (29%), Positives = 132/270 (48%), Gaps = 18/270 (6%)

Query: 2   SIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRV 61
            ++    + +  RYL     + F    S++S  G+ IGVMAL+ V+SVMNGF   + +R+
Sbjct: 3   CMYHPISLFIGLRYLRGRSGDRFSRFVSYMSTAGITIGVMALVTVLSVMNGFEAQLKERI 62

Query: 62  LGINGHVVIQQK--YYPLVDY--QFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVL 117
           LG+  H VI Q     PL +   QFI      + DV +  P V G+A +   +   +G L
Sbjct: 63  LGVLPHAVISQHDGRTPLTESAPQFI----QAMSDVAEPEPVVRGEAVIQSSAQLTAGYL 118

Query: 118 VRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINIL-SPYGD 176
           + GI       + N      G +S+       V +G  LAR+L +SIGDK+ ++ +    
Sbjct: 119 I-GIEPKKGDPIANHL--IAGRLSSLQAGEYKVFLGHSLARSLKVSIGDKVRLMVTNATQ 175

Query: 177 VTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNL-ENAVSGIEVFVKDPD 235
            TP+G     +++TV G+F     D D  ++ +++ +A     L ++ VSG  VF  DP 
Sbjct: 176 FTPLGRIPSQRNFTVAGIFNTG-SDVDGQLMIVNMADAAKLMRLPKDTVSGWRVFFSDPF 234

Query: 236 AIEKTHENIVRILGNGVVVIDWQ-QRYQIF 264
            +    +   + +  G    DW+ QR ++F
Sbjct: 235 MVTDFAD---KPMPEGWQWSDWRAQRGELF 261


>gi|26988878|ref|NP_744303.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Pseudomonas putida KT2440]
 gi|24983686|gb|AAN67767.1|AE016408_5 lipoprotein releasing system, permease protein [Pseudomonas putida
           KT2440]
 gi|313499727|gb|ADR61093.1| LolC [Pseudomonas putida BIRD-1]
          Length = 416

 Score = 94.4 bits (233), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 125/243 (51%), Gaps = 12/243 (4%)

Query: 14  RYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQK 73
           RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVLG+  H  ++  
Sbjct: 12  RYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVLGMIPHATLESG 71

Query: 74  YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNS---DFSY 128
             P+ D+Q +A ++   P V+ V PF   Q     L+  G    VL+ GI  +   + S 
Sbjct: 72  -QPIADWQALAQQVKQNPQVVAVAPFTQMQGL---LTHDGKVQKVLLNGIDPAREREVSI 127

Query: 129 LQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKS 188
           + N      G +        G++IG   A  LG++IGDK+  ++P   VTP GM  R K 
Sbjct: 128 IDNFV--LQGRLDQLAPGEWGIMIGDKAAAKLGVAIGDKLTFVAPEVSVTPAGMFPRMKR 185

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRI 247
           +TV+G F +   + D  +   ++ + ++L+    + V G+ +   D     +   +I + 
Sbjct: 186 FTVVGTFHVGAGEIDGYLGLTNISDLSRLHRWKPDQVQGLRLKFDDLFQAPRVAWSIAQQ 245

Query: 248 LGN 250
           LG+
Sbjct: 246 LGD 248


>gi|260776191|ref|ZP_05885086.1| lipoprotein releasing system transmembrane protein LolE [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607414|gb|EEX33679.1| lipoprotein releasing system transmembrane protein LolE [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 414

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 75/271 (27%), Positives = 125/271 (46%), Gaps = 17/271 (6%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +FS   + +  R+  + ++N  +S  S  S IG+ +GV  +I+ +S MNGF  ++  RVL
Sbjct: 1   MFSSLSLFIGGRFSRAKQRNKMVSFISLSSTIGIAVGVAVIIIGLSAMNGFERELKDRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGG---SGVLVR 119
            +  H   +    P+ ++Q +  + +  P V    P+V     ++ L+  G     + VR
Sbjct: 61  SVIAHGEFEGVRGPIEEWQSVIEQAEKHPKVEAAAPYVK----ITALAEKGQQLKALEVR 116

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRG-KGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           GI     S + N        V + F  G K VI+G+ +A  LG+S GD I ++ P     
Sbjct: 117 GIDPDKESAVSNMSQYIDKAVWSQFKAGDKQVILGQGVADLLGVSRGDYITLMIPTSGSA 176

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
                 +     V G+ ++     D+ +  + LQ+AQ Y  L  AV+G+   +K  D + 
Sbjct: 177 TKVQAPKRVRVRVAGLLKLN-GQIDHNLALVPLQDAQQYAKLGEAVTGVS--LKVSDVLN 233

Query: 239 KTHENIVRILGNG----VVVIDWQQRYQIFF 265
            T   IVR  GN     V +  WQQ Y   +
Sbjct: 234 ATQ--IVREAGNTLNVYVYLRSWQQNYGFLY 262


>gi|251792439|ref|YP_003007165.1| outer membrane-specific lipoprotein transporter subunit LolE
           [Aggregatibacter aphrophilus NJ8700]
 gi|247533832|gb|ACS97078.1| lipoprotein releasing system, transmembrane protein LolE
           [Aggregatibacter aphrophilus NJ8700]
          Length = 416

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 73/246 (29%), Positives = 124/246 (50%), Gaps = 17/246 (6%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           ++WRY  S  KN  +S+ SF S +G+ +GV  LIV +S MNGF  ++ +R+L +  H  I
Sbjct: 7   ISWRYQRSKHKNRLVSLISFFSSLGIALGVAVLIVGLSAMNGFERELNQRILAVVPHAEI 66

Query: 71  Q----QKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDF 126
                Q    +  +Q +  +L   P +  + PFVS  A V      G+ + V  I   + 
Sbjct: 67  TSAPGQHETSIRHWQNLQTKLKQNPQINGISPFVSFTALV----ENGAKLKVVQIKGVE- 121

Query: 127 SYLQNSFSRFYGNVSND----FDRGKGVIIGKDLARNLGISIGDKINIL-SPYGDVTPMG 181
           S LQ+S S     V ND    F +  G+I+G  +AR+LG+  GD +++L S       + 
Sbjct: 122 SLLQDSVSTLGRFVLNDGWQHFAKQGGLILGYGIARDLGVQEGDWVSLLISQQKGSENLS 181

Query: 182 MGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDPDAIEKT 240
             +R +   V G+ R+     D+    M L +AQ     + + VSG+E+   DP +++  
Sbjct: 182 QPLRER-VQVTGILRLD-GQLDHSYALMPLSQAQQLMEYQPDEVSGVELKTTDPFSVQTM 239

Query: 241 HENIVR 246
           + ++++
Sbjct: 240 NYSMLQ 245


>gi|312959645|ref|ZP_07774162.1| lipoprotein releasing system transmembrane protein [Pseudomonas
           fluorescens WH6]
 gi|311286362|gb|EFQ64926.1| lipoprotein releasing system transmembrane protein [Pseudomonas
           fluorescens WH6]
          Length = 416

 Score = 94.0 bits (232), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 119/240 (49%), Gaps = 18/240 (7%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    V +  RY  + R+N F+S  S  S IG+ +GV+ +IVV+SVMNGF  +M  RVL
Sbjct: 1   MFRPLFVFIGTRYTRAKRRNHFVSFISLTSMIGLALGVVVMIVVLSVMNGFDHEMRTRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSG-------LSSGGSG 115
           G+  H  I+    P+ D+Q +A ++   P V+ V PF   Q  ++        L +    
Sbjct: 61  GMVPHATIEGD-APISDWQSLAAKVKQNPKVLAVAPFTQMQGLLTHDGKVQKILLNAIDP 119

Query: 116 VLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPY 174
              R +S  D   LQ           +D   G  G++IG   A  LG+ +GDK+  ++P 
Sbjct: 120 AQERNVSIIDKFMLQGKL--------DDLAPGSFGIVIGDKAAAKLGVGLGDKLTFVAPE 171

Query: 175 GDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQE-AQLYFNLENAVSGIEVFVKD 233
             VTP GM  R K +TV+G F +   + D  +   +L + A+L+    + V G+ +   D
Sbjct: 172 VTVTPAGMFPRMKRFTVVGTFHVGAGEIDGYLGLTNLTDLARLHRWQPDQVQGLRLKFSD 231


>gi|262275600|ref|ZP_06053409.1| lipoprotein releasing system transmembrane protein LolE [Grimontia
           hollisae CIP 101886]
 gi|262219408|gb|EEY70724.1| lipoprotein releasing system transmembrane protein LolE [Grimontia
           hollisae CIP 101886]
          Length = 414

 Score = 93.6 bits (231), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 69/255 (27%), Positives = 118/255 (46%), Gaps = 7/255 (2%)

Query: 14  RYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQK 73
           R+  + R+N  +S  S  S IG+ +GVM +IV +S MNGF  ++  RVL +  H  ++  
Sbjct: 12  RFSKAKRRNKLVSFISVSSMIGISVGVMVIIVGLSAMNGFERELNNRVLAVIPHAELEGV 71

Query: 74  YYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS--GVLVRGISNSDFSYLQN 131
             P+  +Q +    +  P V    P+V+   F + L  G S   V +RG+     S + N
Sbjct: 72  DAPVKAWQEMKVTAEANPKVSAGAPYVT---FTALLEKGASLKPVQIRGVDPVQESRVSN 128

Query: 132 SFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYT 190
                  N  +    G   V++GK +A NL + +GD +  L P  D        +     
Sbjct: 129 IGDYVLDNAWSTLKPGSNAVVLGKGIADNLNVGVGDWVTALVPSPDPELKLRAPQRIRLQ 188

Query: 191 VLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGN 250
           V G+  +     D+G+  + +Q+AQ Y ++ +AVSG+ + V +P         + + L  
Sbjct: 189 VSGILSLGG-QVDHGLALVPIQDAQQYLDMGDAVSGVALRVIEPLEARAIVREVGQTLKE 247

Query: 251 GVVVIDWQQRYQIFF 265
            V + +W Q Y   +
Sbjct: 248 YVYLKNWTQEYGFLY 262


>gi|297183300|gb|ADI19437.1| ABC-type transport system, involved in lipoprotein release,
           permease component [uncultured bacterium HF0500_16O16]
          Length = 417

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/275 (25%), Positives = 131/275 (47%), Gaps = 13/275 (4%)

Query: 7   FEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGING 66
           FE+ VA RYL S +++ F+S+ + I+  GV++GV ALI+++SV NGF  ++  R++G++ 
Sbjct: 3   FELFVARRYLQSKQRSGFLSVITVIALGGVILGVAALIIMLSVTNGFSGEVRGRLIGMDA 62

Query: 67  HVVIQQKY-YPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSD 125
           HV IQ+ Y  P+ D   + + LD    V    P   G+  +        GV V GI  + 
Sbjct: 63  HVSIQRYYDKPIEDPSALIDSLDRY-GVAAAAPVAKGKVILITDDEEMDGVFVWGIDTAS 121

Query: 126 FSYLQN--SFSRFYGNVSNDFDRGK----GVIIGKDLARNLGISIGDKINILS----PYG 175
           F  + +     R+  +     + G+    G+++G  LA  + + +GD I +++       
Sbjct: 122 FGRVSDLPEHLRYDSHKEFHLESGEGERPGIVLGAYLANRMRVGLGDVIYLMTFGNQSLD 181

Query: 176 DVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE-NAVSGIEVFVKDP 234
           D+   G+      + V  +F      +D+  V++ +++A+    +E    + I + + D 
Sbjct: 182 DMMMGGLSPNIDGFVVRDIFESGMYHFDDSFVFIGIEQARKLLRIEGEGATAIHIRIDDL 241

Query: 235 DAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYE 269
           +      + +   LG      DW Q++   F   E
Sbjct: 242 EQATALRQQLSTDLGYPYYTTDWTQQFPELFEWME 276


>gi|157375964|ref|YP_001474564.1| LolC/E family lipoprotein releasing system, transmembrane protein
           [Shewanella sediminis HAW-EB3]
 gi|157318338|gb|ABV37436.1| lipoprotein releasing system, transmembrane protein, LolC/E family
           [Shewanella sediminis HAW-EB3]
          Length = 419

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 63/233 (27%), Positives = 115/233 (49%), Gaps = 24/233 (10%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           V WR+  + + N FIS  SF S  G+ +GV  LI+V+S MNGF  ++  R+LG+  H  +
Sbjct: 9   VGWRFYLARQSNRFISFISFASTAGIALGVAVLIIVLSAMNGFESELETRLLGVVAHAEL 68

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQ 130
                P+  +Q IA+  + IP ++   PF+  Q  V     G  G+ + GI   + + + 
Sbjct: 69  SGVNEPIHSWQAIADDANKIPGIVAAAPFIRLQGLVQK-PGGFQGLSILGIDTIEEAKVS 127

Query: 131 --------NSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGM 182
                   +++S+   + +N+      +++GK LA +LG+ +GD +++  P  D++    
Sbjct: 128 KISEFMSTSTWSKLAQHDANN------IVLGKSLAESLGLDVGDALSLYMP--DISGKNR 179

Query: 183 ------GIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEV 229
                   +S  +TV G+F +     D    Y+ +Q A     + + VSG+ +
Sbjct: 180 SGSRIGAAKSYRFTVAGVFELG-GSLDLTTAYIPMQYAASILKMGDDVSGVRI 231


>gi|145298867|ref|YP_001141708.1| lipoprotein releasing system transmembrane protein LolE [Aeromonas
           salmonicida subsp. salmonicida A449]
 gi|142851639|gb|ABO89960.1| Lipoprotein releasing system transmembrane protein LolE [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 413

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 113/235 (48%), Gaps = 9/235 (3%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +F    + +  RY  S R+N FI+  S  S IG+ +GVMALI+ +S MNGF  ++  RVL
Sbjct: 1   MFKPLPLFLGLRYSRSRRRNGFIAFISASSLIGIALGVMALILGLSAMNGFERELKDRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS---GVLVR 119
            +  H  +     PL D+  + + L   P V    P ++    ++GL   G+   G+ VR
Sbjct: 61  SVVPHGELMGMEAPLPDWPKLRDYLLAQPGVEAAAPVIT----LNGLLEHGNALKGLQVR 116

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDVT 178
            +     + L ++     G    +   G+ G+I+GK +A  LG+ IGD + +L P G   
Sbjct: 117 AVLPELEANLSDAGKYMTGRGLRELQVGEHGLILGKTIADKLGVKIGDSVALLLPQGGDA 176

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKD 233
                 + +S  V+G+  +     D  + +M L +AQ    + N V G  + V D
Sbjct: 177 AGIKNPKRESLKVVGLLEIGG-QLDGMLGFMHLADAQAMTGMGNTVEGFSLKVSD 230


>gi|163751454|ref|ZP_02158678.1| lipoprotein releasing system transmembrane protein LolE [Shewanella
           benthica KT99]
 gi|161328668|gb|EDP99817.1| lipoprotein releasing system transmembrane protein LolE [Shewanella
           benthica KT99]
          Length = 410

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 74/266 (27%), Positives = 129/266 (48%), Gaps = 11/266 (4%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           + +RY  + + N F S  +F +  G+++GV ALI+V SVMNG    + +R+LG    + +
Sbjct: 9   IGFRYWHARKANGFASFITFFAVSGILLGVAALIIVSSVMNGLEGQLKQRILGAVPQLTV 68

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSY-L 129
                P+  +Q     L  +P VI V P ++ QA +    S  S + V GI   DF + L
Sbjct: 69  HST-APIEQWQSKITELSKLPGVIGVTPSIANQAMIQS-RSNISAIQVYGI-YPDFEHDL 125

Query: 130 QNSFSRFYGNVSNDFDRGK-GVIIGKDLARNLGISIGDKINILSPYGDV-TPMGMGIRSK 187
             +  R +       + G+  +++G  LAR L +S GDK+ +LS  G + +P+G     +
Sbjct: 126 LATMQRSFNGSFEQLEAGQYRIVLGSLLARRLDVSSGDKVRLLSGEGVIYSPLGPVPSQR 185

Query: 188 SYTVLGMFRMRFPDYDNGMVYMSLQEAQ-LYFNLENAVSGIEVFVKDP-DAIEKTHENIV 245
           ++ V G+F M     D  + Y+  ++AQ L       V  +  ++ DP +A   + + I 
Sbjct: 186 NFVVAGVFEMG-SQVDANLAYVHYEDAQRLMRQKPGEVKHLRFYLDDPFNAANLSADVIA 244

Query: 246 RILGNGVVVI--DWQQRYQIFFSCYE 269
               + + V   DW++ Y   F   +
Sbjct: 245 EFSKDNLKVTTSDWRETYGHLFGAVK 270


>gi|327481333|gb|AEA84643.1| lipoprotein releasing system, permease protein [Pseudomonas
           stutzeri DSM 4166]
          Length = 385

 Score = 93.2 bits (230), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 68/235 (28%), Positives = 117/235 (49%), Gaps = 12/235 (5%)

Query: 33  FIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPD 92
            IG+ +GV+ +IVV+SVMNGF  +M  RVLG+  H  I+    P+ D+Q +  RL+    
Sbjct: 1   MIGLALGVLVMIVVLSVMNGFDHEMRTRVLGMVPHATIESPT-PINDWQALGARLEQHAQ 59

Query: 93  VIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFS---RFYGNVS-NDFDRGK 148
           V+   PF+  Q  ++       G + + + N+     +   S   +F+   S +D   G+
Sbjct: 60  VLASAPFIQSQGLLTH-----QGQVTKILINAVEPQAERQVSIIDQFFREGSLDDLKPGE 114

Query: 149 -GVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMV 207
            G++IG   A  LG+++GDKI  ++P   VTP GM  R K +TV G+F +   + D  + 
Sbjct: 115 FGIVIGDKAAAKLGVAVGDKITFVAPEVTVTPAGMFPRMKRFTVTGIFHVGAGEIDGYVA 174

Query: 208 YMSLQE-AQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRY 261
             ++ + A+L     + V G+ +   D     +    +   LG+     DW + +
Sbjct: 175 LANIADMARLQRWQPDQVQGLRLRFADLFQAPRIAWELAGQLGDDFYSRDWTRTH 229


>gi|163782902|ref|ZP_02177898.1| hypothetical protein HG1285_16241 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882023|gb|EDP75531.1| hypothetical protein HG1285_16241 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 395

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 69/262 (26%), Positives = 132/262 (50%), Gaps = 16/262 (6%)

Query: 11  VAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVI 70
           +A RYL S + +  +   +FISF GV + V A+++ + V  GF++ + +++L    HV++
Sbjct: 7   IALRYLLSVKGSTLL--ITFISFFGVFLSVGAILLTLGVFTGFQDSLKEKILSTAPHVIV 64

Query: 71  QQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQ 130
                   D + I   ++ +  V + LPF+   A + G       V V+ +   DF   +
Sbjct: 65  S--VVGDADLKEIRKDVERVKGVKETLPFILYSAIL-GKEERLQPVTVKAV---DFG--E 116

Query: 131 NSFSRFYGN--VSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKS 188
            +F R  G+  V  D    KG+++GK +A  LG+S GD   ++ P G  TP G   +++ 
Sbjct: 117 KAFKRLVGSHLVKGDL---KGLVVGKGIADVLGVSAGDTAVLVFPMGIRTPTGFIPKTRE 173

Query: 189 YTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL 248
             + G+F     D D  +V+M  +EA+ +F       G+E++++DP   ++  E I + +
Sbjct: 174 VVIGGVFHTGAYDRDFVIVFMERREAKRFFRRGFKFEGLEIYLEDPYRAQEVKERIEKAV 233

Query: 249 GNGVVVI-DWQQRYQIFFSCYE 269
            N ++++  W    +  F+  +
Sbjct: 234 NNELILVRSWIDLNKPLFNALQ 255


>gi|304559307|gb|ADM41971.1| Lipoprotein releasing system transmembrane protein LolC
           [Edwardsiella tarda FL6-60]
          Length = 375

 Score = 92.8 bits (229), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 70/246 (28%), Positives = 122/246 (49%), Gaps = 15/246 (6%)

Query: 29  SFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLD 88
           S++S IG+ +GVMAL+ V+SVMNGF  D+ + +L +    V+      L   ++ A+ L 
Sbjct: 2   SWLSTIGITLGVMALVTVLSVMNGFERDLEQSILNLMPQAVVTTPQGQLDPARYPASLLQ 61

Query: 89  FIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSND-FDRG 147
            +P V +V P  +G   +    S G GV++ G++ ++     +   R+   VS      G
Sbjct: 62  GLPGVHRVAPLTTGDVVLQSPHSVGVGVMI-GVNPTE----ADPLDRYLNGVSQSALQPG 116

Query: 148 K-GVIIGKDLARNLGISIGDKINILSPYG-DVTPMGMGIRSKSYTVLGMFRMRFPDYDNG 205
           +   I+G  LA  LG+  GD++ ++ P     TPMG     + +TV+G F     + D  
Sbjct: 117 QYRAILGSQLAAELGVKAGDRVRLMVPSASQFTPMGRIPSQRIFTVIGTFNADS-EVDQT 175

Query: 206 MVYMSLQEAQ--LYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQI 263
            + ++ Q+A   + + L + +SG  +F+  P  IE     +   L +G+V  DW+ R   
Sbjct: 176 QLLVNQQDASRLMRYPLGH-ISGWRLFMDRPLDIEAL---VAHALPDGLVWQDWRARKGE 231

Query: 264 FFSCYE 269
            F   +
Sbjct: 232 LFQAVK 237


>gi|323492535|ref|ZP_08097683.1| outer membrane-specific lipoprotein transporter subunit LolE
           [Vibrio brasiliensis LMG 20546]
 gi|323313322|gb|EGA66438.1| outer membrane-specific lipoprotein transporter subunit LolE
           [Vibrio brasiliensis LMG 20546]
          Length = 414

 Score = 92.8 bits (229), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 71/267 (26%), Positives = 125/267 (46%), Gaps = 17/267 (6%)

Query: 3   IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVL 62
           +FS   + +  R+  + ++N  +S  S  S IG+ +GV  +I+ +S MNGF  ++  RVL
Sbjct: 1   MFSSLSLFIGGRFSRAKQRNKMVSFISLSSTIGIAVGVAVIIIGLSAMNGFERELNNRVL 60

Query: 63  GINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGS---GVLVR 119
            +  H   +    PL D+Q +  + +  P ++   P+V     ++ L+  GS    + VR
Sbjct: 61  SVISHGEFEGVRGPLSDWQEVVQQAEKHPKIVAAAPYVK----LTALAEKGSQLKAIEVR 116

Query: 120 GISNSDFSYLQNSFSRFYGNVSNDFDRG-KGVIIGKDLARNLGISIGDKINILSPYGDVT 178
           G+       + N  +     V  +F    + VI+G+ +A  L +  GD + ++ P    T
Sbjct: 117 GVDPQQEGKVSNLNAFIDSQVWQNFQPNQQQVILGQGVANLLNVDKGDYLTLMIPTSGAT 176

Query: 179 PMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIE 238
                 +     V G+  +     D+ +  + L++AQ Y  L + VSG+ V V   D ++
Sbjct: 177 TKVQAPKRVRVQVAGLLTLN-GQIDHNLALIPLEDAQAYARLGDGVSGVSVRVT--DVLQ 233

Query: 239 KTHENIVRILGNG----VVVIDWQQRY 261
            T   IVR  GN     V +  WQQ+Y
Sbjct: 234 ATQ--IVREAGNTLDVYVYLRSWQQKY 258


>gi|299769096|ref|YP_003731122.1| ABC-type transport system [Acinetobacter sp. DR1]
 gi|298699184|gb|ADI89749.1| ABC-type transport sys