Query 537021.9.peg.789_1 Match_columns 143 No_of_seqs 109 out of 6853 Neff 8.5 Searched_HMMs 23785 Date Wed May 25 00:26:12 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_789.hhm -d /home/congqian_1/database/pdb/pdb70.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 1wr1_B Ubiquitin-like protein 19.9 36 0.0015 13.0 2.3 23 28-50 18-40 (58) 2 2bwb_A Ubiquitin-like protein 17.0 42 0.0018 12.6 2.9 24 26-49 5-29 (46) 3 1vej_A Riken cDNA 4931431F19; 14.5 49 0.0021 12.3 2.0 22 28-49 30-51 (74) 4 2knz_A Ubiquilin-4; cytoplasm, 13.9 51 0.0021 12.2 2.1 23 27-49 11-33 (53) 5 2jy5_A Ubiquilin-1; UBA, alter 13.7 52 0.0022 12.2 2.4 22 28-49 13-34 (52) 6 2dah_A Ubiquilin-3; UBA domain 12.7 56 0.0024 12.0 2.3 23 28-50 10-32 (54) 7 2dna_A Unnamed protein product 10.2 68 0.0029 11.6 2.0 22 28-49 20-41 (67) 8 2jpc_A SSRB; DNA binding prote 7.4 91 0.0038 10.9 1.7 21 27-47 2-22 (61) 9 3lti_A DNA-directed RNA polyme 7.3 87 0.0036 11.0 0.3 20 31-50 60-79 (296) 10 3dhw_A D-methionine transport 5.9 1.1E+02 0.0046 10.5 4.9 35 28-62 117-151 (217) No 1 >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Probab=19.87 E-value=36 Score=13.00 Aligned_cols=23 Identities=13% Similarity=-0.035 Sum_probs=18.0 Q ss_pred HHHHHHHHHCCCCCCCCCHHHHH Q ss_conf 99999999807552222036888 Q 537021.9.peg.7 28 RRDIAILRTMGARISSIMSIFFM 50 (143) Q Consensus 28 ~~eigilkalG~s~~~I~~~~~~ 50 (143) .+|+..||.+|+++.+.-..-+. T Consensus 18 ~~qL~~L~~MGF~d~~~N~~AL~ 40 (58) T 1wr1_B 18 EHQLRQLNDMGFFDFDRNVAALR 40 (58) T ss_dssp HHHHHHHHHHTCCCHHHHHHHHH T ss_pred HHHHHHHHHCCCCCHHHHHHHHH T ss_conf 99999999959996899999999 No 2 >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Probab=17.01 E-value=42 Score=12.65 Aligned_cols=24 Identities=21% Similarity=0.105 Sum_probs=18.7 Q ss_pred HH-HHHHHHHHHCCCCCCCCCHHHH Q ss_conf 99-9999999980755222203688 Q 537021.9.peg.7 26 ER-RRDIAILRTMGARISSIMSIFF 49 (143) Q Consensus 26 ~R-~~eigilkalG~s~~~I~~~~~ 49 (143) +| .+|...||.+|+++.+.-..-+ T Consensus 5 ~ry~~QL~~L~~MGF~d~~~Ni~AL 29 (46) T 2bwb_A 5 ERYEHQLRQLNDMGFFDFDRNVAAL 29 (46) T ss_dssp HHTHHHHHHHHHTTCCCHHHHHHHH T ss_pred HHHHHHHHHHHHCCCCCHHHHHHHH T ss_conf 9999999999984999789999999 No 3 >1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Probab=14.46 E-value=49 Score=12.29 Aligned_cols=22 Identities=9% Similarity=0.150 Sum_probs=17.6 Q ss_pred HHHHHHHHHCCCCCCCCCHHHH Q ss_conf 9999999980755222203688 Q 537021.9.peg.7 28 RRDIAILRTMGARISSIMSIFF 49 (143) Q Consensus 28 ~~eigilkalG~s~~~I~~~~~ 49 (143) ++|...||.+|+++.+.-..-+ T Consensus 30 ~~QL~~L~~MGF~d~~~N~~AL 51 (74) T 1vej_A 30 QQELEELKALGFANRDANLQAL 51 (74) T ss_dssp HHHHHHHHHHTCCCHHHHHHHH T ss_pred HHHHHHHHHCCCCCHHHHHHHH T ss_conf 9999999994899789999999 No 4 >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Probab=13.93 E-value=51 Score=12.21 Aligned_cols=23 Identities=13% Similarity=0.053 Sum_probs=17.9 Q ss_pred HHHHHHHHHHCCCCCCCCCHHHH Q ss_conf 99999999980755222203688 Q 537021.9.peg.7 27 RRRDIAILRTMGARISSIMSIFF 49 (143) Q Consensus 27 R~~eigilkalG~s~~~I~~~~~ 49 (143) -.+|+..|+.+|+++++--..-+ T Consensus 11 y~~qL~~L~eMGF~D~~~Nl~AL 33 (53) T 2knz_A 11 FQQQLEQLNSMGFINREANLQAL 33 (53) T ss_dssp HHHHHHHHHTTTCCCHHHHHHHH T ss_pred HHHHHHHHHHCCCCCHHHHHHHH T ss_conf 99999999994999669999999 No 5 >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Probab=13.66 E-value=52 Score=12.17 Aligned_cols=22 Identities=14% Similarity=0.086 Sum_probs=17.2 Q ss_pred HHHHHHHHHCCCCCCCCCHHHH Q ss_conf 9999999980755222203688 Q 537021.9.peg.7 28 RRDIAILRTMGARISSIMSIFF 49 (143) Q Consensus 28 ~~eigilkalG~s~~~I~~~~~ 49 (143) .+|...|+.+|+++++.-..-+ T Consensus 13 ~~qL~~L~eMGF~d~~~n~~AL 34 (52) T 2jy5_A 13 QQQLEQLSAMGFLNREANLQAL 34 (52) T ss_dssp HHHHHHHHHTTCCCHHHHHHHH T ss_pred HHHHHHHHHCCCCCHHHHHHHH T ss_conf 9999999994999669999999 No 6 >2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Probab=12.66 E-value=56 Score=12.01 Aligned_cols=23 Identities=17% Similarity=0.151 Sum_probs=18.1 Q ss_pred HHHHHHHHHCCCCCCCCCHHHHH Q ss_conf 99999999807552222036888 Q 537021.9.peg.7 28 RRDIAILRTMGARISSIMSIFFM 50 (143) Q Consensus 28 ~~eigilkalG~s~~~I~~~~~~ 50 (143) .+|...|+.+|+++.+.-..-+. T Consensus 10 ~~qL~~L~~MGF~d~~~Nl~aL~ 32 (54) T 2dah_A 10 QVQLEQLRSMGFLNREANLQALI 32 (54) T ss_dssp HHHHHHHHHHTCCCHHHHHHHHH T ss_pred HHHHHHHHHCCCCCHHHHHHHHH T ss_conf 99999999949996899999999 No 7 >2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Probab=10.23 E-value=68 Score=11.57 Aligned_cols=22 Identities=14% Similarity=0.126 Sum_probs=17.5 Q ss_pred HHHHHHHHHCCCCCCCCCHHHH Q ss_conf 9999999980755222203688 Q 537021.9.peg.7 28 RRDIAILRTMGARISSIMSIFF 49 (143) Q Consensus 28 ~~eigilkalG~s~~~I~~~~~ 49 (143) ..|+..|+.+|+++.+.-..-+ T Consensus 20 ~~qL~~L~~MGF~d~~~nl~AL 41 (67) T 2dna_A 20 SKEMECLQAMGFVNYNANLQAL 41 (67) T ss_dssp HHHHHHHHHHTCCCHHHHHHHH T ss_pred HHHHHHHHHCCCCCHHHHHHHH T ss_conf 9999999994898699999999 No 8 >2jpc_A SSRB; DNA binding protein, structural genomics, PSI-2, protein structure initiative; NMR {Salmonella typhimurium} Probab=7.37 E-value=91 Score=10.93 Aligned_cols=21 Identities=24% Similarity=0.199 Sum_probs=15.0 Q ss_pred HHHHHHHHHHCCCCCCCCCHH Q ss_conf 999999999807552222036 Q 537021.9.peg.7 27 RRRDIAILRTMGARISSIMSI 47 (143) Q Consensus 27 R~~eigilkalG~s~~~I~~~ 47 (143) |.+|+--+-+-|.|.++|-.. T Consensus 2 RE~evl~ll~~G~s~~eIA~~ 22 (61) T 2jpc_A 2 RERQVLKLIDEGYTNHGISEK 22 (61) T ss_dssp HHHHHHHHHHTSCCSHHHHHH T ss_pred HHHHHHHHHHCCCCHHHHHHH T ss_conf 799999999827999999989 No 9 >3lti_A DNA-directed RNA polymerase subunit beta; BBM2, nucleotidyltransferase, transcription, transferase; HET: MLY MSE; 1.60A {Escherichia coli} PDB: 3e7h_A Probab=7.28 E-value=87 Score=11.04 Aligned_cols=20 Identities=30% Similarity=0.577 Sum_probs=15.5 Q ss_pred HHHHHHCCCCCCCCCHHHHH Q ss_conf 99999807552222036888 Q 537021.9.peg.7 31 IAILRTMGARISSIMSIFFM 50 (143) Q Consensus 31 igilkalG~s~~~I~~~~~~ 50 (143) .-.|||+|++..++...++. T Consensus 60 t~lLrAlG~~~~~il~~~~~ 79 (296) T 3lti_A 60 TIILRALNYTTEQILDLFFE 79 (296) T ss_dssp HHHHHHTTCCHHHHHHHHCC T ss_pred HHHHHHHCCCHHHHHHHHCC T ss_conf 99998710325667787516 No 10 >3dhw_A D-methionine transport system permease protein METI; ABC-transporter, methionine uptake transporter, membrane protein, amino-acid transport; 3.70A {Escherichia coli K12} SCOP: f.58.1.1 Probab=5.92 E-value=1.1e+02 Score=10.51 Aligned_cols=35 Identities=23% Similarity=0.264 Sum_probs=24.4 Q ss_pred HHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHHH Q ss_conf 99999999807552222036888987653233456 Q 537021.9.peg.7 28 RRDIAILRTMGARISSIMSIFFMIGAFIGIAGTGM 62 (143) Q Consensus 28 ~~eigilkalG~s~~~I~~~~~~E~~~l~~ig~i~ 62 (143) ++..-.-|++|+|++|+++...+=...-+++.... T Consensus 117 ~~~~eAA~~lGas~~q~f~~vilP~~~p~ii~~~~ 151 (217) T 3dhw_A 117 TGLIEASRAMGATPMQIVRKVLLPEALPGLVNAAT 151 (217) T ss_dssp TTTTTHHHHHTCCTHHHHHHTTHHHHHHHHHHHHH T ss_pred HHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHH T ss_conf 89999987189898999697419978999999999 Done!