BLASTP 2.2.22 [Sep-27-2009]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 537021.9.peg.804_1
(39 letters)
Database: las_proteome
1233 sequences; 328,796 total letters
Searching...................................................done
>537021.9.peg.804_1
Length = 39
Score = 82.8 bits (203), Expect = 9e-19, Method: Compositional matrix adjust.
Identities = 39/39 (100%), Positives = 39/39 (100%)
Query: 1 MFRNFFLGLSIILMIAGYPAFAYKTNTCHGYGTHGCKNV 39
MFRNFFLGLSIILMIAGYPAFAYKTNTCHGYGTHGCKNV
Sbjct: 1 MFRNFFLGLSIILMIAGYPAFAYKTNTCHGYGTHGCKNV 39
Database: las_proteome
Posted date: Jun 5, 2011 6:30 PM
Number of letters in database: 328,796
Number of sequences in database: 1233
Lambda K H
0.333 0.147 0.497
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 27,036
Number of Sequences: 1233
Number of extensions: 563
Number of successful extensions: 1
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 1
length of query: 39
length of database: 328,796
effective HSP length: 13
effective length of query: 26
effective length of database: 312,767
effective search space: 8131942
effective search space used: 8131942
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (22.0 bits)
S2: 31 (16.5 bits)