BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.813_1 (41 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.813_1 Length = 41 Score = 81.6 bits (200), Expect = 2e-18, Method: Compositional matrix adjust. Identities = 41/41 (100%), Positives = 41/41 (100%) Query: 1 MIITNISGNHPFNAKIRIFSFVPPKASHHKSIFFSFVNISC 41 MIITNISGNHPFNAKIRIFSFVPPKASHHKSIFFSFVNISC Sbjct: 1 MIITNISGNHPFNAKIRIFSFVPPKASHHKSIFFSFVNISC 41 >gi|254781102|ref|YP_003065515.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 497 Score = 23.5 bits (49), Expect = 0.75, Method: Compositional matrix adjust. Identities = 9/16 (56%), Positives = 12/16 (75%) Query: 12 FNAKIRIFSFVPPKAS 27 FNAK+R+F + PK S Sbjct: 227 FNAKMRLFEELLPKES 242 >gi|254780915|ref|YP_003065328.1| oligoendopeptidase F [Candidatus Liberibacter asiaticus str. psy62] Length = 626 Score = 20.0 bits (40), Expect = 8.3, Method: Composition-based stats. Identities = 7/14 (50%), Positives = 9/14 (64%) Query: 9 NHPFNAKIRIFSFV 22 +H FN IFSF+ Sbjct: 246 SHTFNKSSHIFSFI 259 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.331 0.140 0.443 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 25,854 Number of Sequences: 1233 Number of extensions: 556 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 41 length of database: 328,796 effective HSP length: 15 effective length of query: 26 effective length of database: 310,301 effective search space: 8067826 effective search space used: 8067826 T: 11 A: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.5 bits) S2: 31 (16.5 bits)