RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= 537021.9.peg.817_1 (148 letters) >2pff_B Fatty acid synthase subunit beta; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 2006 Score = 34.9 bits (80), Expect = 0.008 Identities = 23/151 (15%), Positives = 44/151 (29%), Gaps = 42/151 (27%) Query: 21 HHNRLRDRF---LQKGENALAYYE----ILEL-------ILFRLIP--RKDTKSIAKALL 64 ++L+++F L + A + EL + + P + L Sbjct: 29 IASQLQEQFNKILPEPTEGFAADDEPTTPAELVGKFLGYVSSLVEPSKVGQFDQVLNLCL 88 Query: 65 KRFAT--LGGVFGAPLHLLQEINRIGKRVALELKLVSVASQRILKANW-----SIKKFLT 117 F L G +I+ + ++ E V ++ ++K + + F Sbjct: 89 TEFENCYLEG---------NDIHALAAKLLQENDTTLVKTKELIKNYITARIMAKRPFDK 139 Query: 118 PGQPCLISVERHYPMKNANNFAYCFSINIIF 148 L R NA A IF Sbjct: 140 KSNSALF---RAVGEGNAQLVA-------IF 160 Score = 25.3 bits (55), Expect = 6.2 Identities = 27/131 (20%), Positives = 52/131 (39%), Gaps = 41/131 (31%) Query: 1 LEDFRMSKA--PSKDSHLDYIGHHNRLRDRFLQKGENA--------LAYYEILELILFR- 49 ED + SK P+ + + GH GE A ++ ++E++ +R Sbjct: 1744 FEDLK-SKGLIPADAT---FAGH---------SLGEYAALASLADVMSIESLVEVVFYRG 1790 Query: 50 -----LIPRKDTKSIAKALLKRFATLGGVFGAPLHLLQE-----INRIGKRVALELKLV- 98 +PR + + ++ A G A QE + R+GKR +++V Sbjct: 1791 MTMQVAVPRDE---LGRSNYGMIAINPGRVAASFS--QEALQYVVERVGKRTGWLVEIVN 1845 Query: 99 -SVASQRILKA 108 +V +Q+ + A Sbjct: 1846 YNVENQQYVAA 1856 >1kft_A UVRC, excinuclease ABC subunit C; helix-hairpin-helix, HHH domain, DNA-binding domain, DNA binding protein; NMR {Escherichia coli} SCOP: a.60.2.3 Length = 78 Score = 31.3 bits (71), Expect = 0.092 Identities = 8/37 (21%), Positives = 18/37 (48%) Query: 60 AKALLKRFATLGGVFGAPLHLLQEINRIGKRVALELK 96 + LLK L G+ A + + ++ I + +A ++ Sbjct: 37 RQMLLKYMGGLQGLRNASVEEIAKVPGISQGLAEKIF 73 >2bgw_A XPF endonuclease; hydrolase, structure specific endonuclease, nucleotide excision repair; 2.8A {Aeropyrum pernix} SCOP: a.60.2.5 c.52.1.20 PDB: 2bhn_A Length = 219 Score = 28.0 bits (61), Expect = 0.80 Identities = 12/41 (29%), Positives = 23/41 (56%) Query: 56 TKSIAKALLKRFATLGGVFGAPLHLLQEINRIGKRVALELK 96 + A+ +L+RF +L F A + ++ IG++ A E+K Sbjct: 171 GRRTAERILERFGSLERFFTASKAEISKVEGIGEKRAEEIK 211 >3c1y_A DNA integrity scanning protein DISA; DNA damage, DNA repair, DNA-binding, DNA binding protein; HET: DNA 2BA; 2.10A {Thermotoga maritima} PDB: 3c1z_A* 3c21_A* 3c23_A* Length = 377 Score = 27.8 bits (62), Expect = 0.96 Identities = 12/59 (20%), Positives = 29/59 (49%), Gaps = 3/59 (5%) Query: 51 IPRKDTKSIAKALLKRFATLGGVFGAPLHLLQEINRIGKRVALELK--LVSVASQRILK 107 + R SI +++ F TL + A + L+++ IG++ A + + S+ ++ + Sbjct: 320 VARI-PLSIGYNVVRMFKTLDQISKASVEDLKKVEGIGEKRARAISESISSLKHRKTSE 377 >1gqi_A Alpha-glucuronidase; (alpha-beta)8 barrel, glycoside hydrolase; 1.48A {Pseudomonas cellulosa} SCOP: c.1.8.10 d.92.2.2 PDB: 1gqj_A* 1gqk_A* 1gql_A* 1h41_A* Length = 708 Score = 26.9 bits (59), Expect = 2.1 Identities = 10/57 (17%), Positives = 22/57 (38%), Gaps = 1/57 (1%) Query: 50 LIPRKDTKSIAKALLKRFATLGGVFGAPLHLLQEINRIGKRVALELKLVSVASQRIL 106 L+ + ++ + +G ++G+ HLL+ I L L R++ Sbjct: 98 LLEQTRINKRHVVIVAANSDVGVLYGS-FHLLRLIQTQHALEKLSLSSAPRLQHRVV 153 >3c65_A Uvrabc system protein C; UVRC, endonuclease, nucleotide excision repair, DNA repair, RNAse H, cytoplasm, DNA damage, DNA excision; 1.90A {Bacillus stearothermophilus} Length = 226 Score = 26.3 bits (57), Expect = 2.5 Identities = 12/41 (29%), Positives = 20/41 (48%), Gaps = 1/41 (2%) Query: 56 TKSIAKALLKRFATLGGVFGAPLHLLQEINRIGKRVALELK 96 + KALL F ++ + A + LQ N I + VA ++ Sbjct: 182 GEKRKKALLNYFGSVKKMKEATVEELQRAN-IPRAVAEKIY 221 >1vpy_A Protein (hypothetical protein EF0366); structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.52A {Enterococcus faecalis V583} SCOP: c.1.32.1 PDB: 1ztv_A Length = 289 Score = 26.1 bits (57), Expect = 2.8 Identities = 12/79 (15%), Positives = 21/79 (26%), Gaps = 16/79 (20%) Query: 2 EDFRMS-KAPSKDSHLDYIGHHNRLRDRFLQKGENALAYYEILE---------LILFRLI 51 E+FR K S I + + + E A+ E + L + Sbjct: 69 ENFRFVMKVYS------GISCQGEWQTYYASEEEMITAFLESMAPLIESKKLFAFLVQFS 122 Query: 52 PRKDTKSIAKALLKRFATL 70 A L++ Sbjct: 123 GTFGCTKENVAYLQKIRHW 141 >3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} Length = 634 Score = 26.0 bits (56), Expect = 3.2 Identities = 11/43 (25%), Positives = 16/43 (37%), Gaps = 1/43 (2%) Query: 27 DRFLQKGENALAYYEILELILFRLI-PRKDTKSIAKALLKRFA 68 + Q E L Y++L I + I R + ALL Sbjct: 522 SEYTQTDERDLMPYDVLARIERKAIKERLSPVQVYTALLTEGP 564 >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Length = 285 Score = 26.3 bits (57), Expect = 3.2 Identities = 6/27 (22%), Positives = 11/27 (40%), Gaps = 3/27 (11%) Query: 14 SHLDYIGHHNRLRDRFLQKGENALAYY 40 +HLD + L F + ++ Y Sbjct: 250 NHLDEVNQVFGLTSLF---ETSPVSVY 273 >1z00_A DNA excision repair protein ERCC-1; helix-hairpin-helix, hydrolase; HET: DNA; NMR {Homo sapiens} SCOP: a.60.2.5 Length = 89 Score = 25.7 bits (56), Expect = 4.3 Identities = 10/40 (25%), Positives = 17/40 (42%) Query: 57 KSIAKALLKRFATLGGVFGAPLHLLQEINRIGKRVALELK 96 K+ ++ LL F +L + A L +G + A L Sbjct: 29 KTDSQTLLTTFGSLEQLIAASREDLALCPGLGPQKARRLF 68 >3dla_A Glutamine-dependent NAD(+) synthetase; glutaminase, ammonia tunneling, enzyme, glutamine-amido transferase, ATP-binding, ligase; HET: NXX ONL; 2.35A {Mycobacterium tuberculosis} Length = 680 Score = 25.3 bits (54), Expect = 5.9 Identities = 7/40 (17%), Positives = 15/40 (37%) Query: 27 DRFLQKGENALAYYEILELILFRLIPRKDTKSIAKALLKR 66 + LQ E + + + + LF+++ S L Sbjct: 552 EEELQSSEAKVGPFALQDFSLFQVLRYGFRPSKIAFLAWH 591 >1x2i_A HEF helicase/nuclease; alpha helix, helix-hairpin-helix DNA binding domain, homodimer, hydrolase; 1.45A {Pyrococcus furiosus} SCOP: a.60.2.5 Length = 75 Score = 25.2 bits (55), Expect = 6.4 Identities = 13/40 (32%), Positives = 26/40 (65%) Query: 57 KSIAKALLKRFATLGGVFGAPLHLLQEINRIGKRVALELK 96 ++A+ LLK F ++ VF A + L ++ IG+++A E++ Sbjct: 24 ATLARRLLKHFGSVERVFTASVAELMKVEGIGEKIAKEIR 63 >2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Length = 431 Score = 25.1 bits (54), Expect = 6.5 Identities = 5/27 (18%), Positives = 8/27 (29%), Gaps = 3/27 (11%) Query: 14 SHLDYIGHHNRLRDRFLQKGENALAYY 40 H D+IG+ +Y Sbjct: 389 DHSDFIGNDALDTKHS---AIELTNFY 412 >3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} Length = 590 Score = 25.1 bits (54), Expect = 7.0 Identities = 8/46 (17%), Positives = 17/46 (36%), Gaps = 6/46 (13%) Query: 31 QKGENALAYYEILELILFRLIPRKDTKS------IAKALLKRFATL 70 Q ++L Y +L+ IL + R + L+ + + Sbjct: 502 QVDTDSLPDYPVLDAILELYVDRDTGADAIVAAGYDRELVVKTLRM 547 >3iyd_D DNA-directed RNA polymerase subunit beta; transcription, initiation, class I, activator, RNA polymerase, holoenzyme, sigma70, open complex, CAP, CRP, CAMP-dependent; HET: DNA CMP; 19.80A {Escherichia coli k-12} Length = 1413 Score = 24.4 bits (52), Expect = 9.4 Identities = 7/42 (16%), Positives = 16/42 (38%) Query: 103 QRILKANWSIKKFLTPGQPCLISVERHYPMKNANNFAYCFSI 144 +R++ N +K+ L P +I ++ A + Sbjct: 270 RRVINRNNRLKRLLDLAAPDIIVRNEKRMLQEAVDALLDNGR 311 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.326 0.141 0.417 Gapped Lambda K H 0.267 0.0507 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,264,363 Number of extensions: 53927 Number of successful extensions: 152 Number of sequences better than 10.0: 1 Number of HSP's gapped: 152 Number of HSP's successfully gapped: 20 Length of query: 148 Length of database: 5,693,230 Length adjustment: 84 Effective length of query: 64 Effective length of database: 3,656,734 Effective search space: 234030976 Effective search space used: 234030976 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.3 bits)