BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.834_1 (42 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.834_1 Length = 42 Score = 88.6 bits (218), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 42/42 (100%), Positives = 42/42 (100%) Query: 1 MRDNKNFSQLFTYLDIPRHKYRIMGILAEYLIANSFIKSDNR 42 MRDNKNFSQLFTYLDIPRHKYRIMGILAEYLIANSFIKSDNR Sbjct: 1 MRDNKNFSQLFTYLDIPRHKYRIMGILAEYLIANSFIKSDNR 42 >gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Score = 21.2 bits (43), Expect = 3.2, Method: Composition-based stats. Identities = 8/16 (50%), Positives = 11/16 (68%) Query: 6 NFSQLFTYLDIPRHKY 21 N + L YL +PR+KY Sbjct: 587 NENNLQDYLGVPRYKY 602 >gi|254780698|ref|YP_003065111.1| D-alanyl-D-alanine carboxypeptidase 1 penicillin-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 336 Score = 20.4 bits (41), Expect = 5.2, Method: Compositional matrix adjust. Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 5 KNFSQLFTYLDIPRHKYR 22 KNF Q + Y I + +YR Sbjct: 203 KNFPQYYKYFSIRKFRYR 220 >gi|254781066|ref|YP_003065479.1| putative lysyl-tRNA synthetase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 355 Score = 19.6 bits (39), Expect = 8.8, Method: Compositional matrix adjust. Identities = 8/19 (42%), Positives = 11/19 (57%) Query: 23 IMGILAEYLIANSFIKSDN 41 I L EY + N FI+ D+ Sbjct: 28 IQSSLREYFVENQFIEIDS 46 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.328 0.142 0.411 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,969 Number of Sequences: 1233 Number of extensions: 747 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 42 length of database: 328,796 effective HSP length: 16 effective length of query: 26 effective length of database: 309,068 effective search space: 8035768 effective search space used: 8035768 T: 11 A: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.3 bits) S2: 31 (16.5 bits)