BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.851_1 (38 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.851_1 Length = 38 Score = 79.0 bits (193), Expect = 1e-17, Method: Compositional matrix adjust. Identities = 38/38 (100%), Positives = 38/38 (100%) Query: 1 MLLYDYILGLHENFWLFFLKKDDFYRIMVCVISLKTNN 38 MLLYDYILGLHENFWLFFLKKDDFYRIMVCVISLKTNN Sbjct: 1 MLLYDYILGLHENFWLFFLKKDDFYRIMVCVISLKTNN 38 >gi|254780836|ref|YP_003065249.1| putative type I restriction-modification system DNA methylase [Candidatus Liberibacter asiaticus str. psy62] Length = 674 Score = 20.8 bits (42), Expect = 4.0, Method: Composition-based stats. Identities = 7/11 (63%), Positives = 9/11 (81%) Query: 10 LHENFWLFFLK 20 LH++FWL LK Sbjct: 510 LHQSFWLDILK 520 >gi|254780916|ref|YP_003065329.1| putative sigma-54-dependent transcription regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 482 Score = 20.4 bits (41), Expect = 5.5, Method: Composition-based stats. Identities = 8/18 (44%), Positives = 13/18 (72%) Query: 19 LKKDDFYRIMVCVISLKT 36 +KD +YRI V +I++ T Sbjct: 294 FRKDLYYRISVFLINIST 311 >gi|254780240|ref|YP_003064653.1| adenylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 201 Score = 20.4 bits (41), Expect = 6.2, Method: Composition-based stats. Identities = 10/28 (35%), Positives = 13/28 (46%) Query: 4 YDYILGLHENFWLFFLKKDDFYRIMVCV 31 YD L EN+ L +YR M C+ Sbjct: 144 YDVFLKRIENYRKTILPLSSYYRDMGCL 171 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.336 0.152 0.502 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 28,485 Number of Sequences: 1233 Number of extensions: 644 Number of successful extensions: 6 Number of sequences better than 100.0: 6 Number of HSP's better than 100.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of query: 38 length of database: 328,796 effective HSP length: 12 effective length of query: 26 effective length of database: 314,000 effective search space: 8164000 effective search space used: 8164000 T: 11 A: 40 X1: 15 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 39 (21.7 bits) S2: 31 (16.5 bits)