BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= 537021.9.peg.869_1 (39 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >537021.9.peg.869_1 Length = 39 Score = 80.5 bits (197), Expect = 4e-18, Method: Compositional matrix adjust. Identities = 39/39 (100%), Positives = 39/39 (100%) Query: 1 MIVLEKACDCYRQIEDILQGKIAKCPVRGLYNKAKNNLL 39 MIVLEKACDCYRQIEDILQGKIAKCPVRGLYNKAKNNLL Sbjct: 1 MIVLEKACDCYRQIEDILQGKIAKCPVRGLYNKAKNNLL 39 >gi|254780229|ref|YP_003064642.1| hypothetical protein CLIBASIA_00570 [Candidatus Liberibacter asiaticus str. psy62] Length = 1775 Score = 21.9 bits (45), Expect = 2.3, Method: Composition-based stats. Identities = 8/14 (57%), Positives = 12/14 (85%) Query: 26 PVRGLYNKAKNNLL 39 P+R L ++AKN+LL Sbjct: 1325 PIRQLISRAKNSLL 1338 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.142 0.433 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 23,823 Number of Sequences: 1233 Number of extensions: 492 Number of successful extensions: 2 Number of sequences better than 100.0: 2 Number of HSP's better than 100.0 without gapping: 2 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2 length of query: 39 length of database: 328,796 effective HSP length: 13 effective length of query: 26 effective length of database: 312,767 effective search space: 8131942 effective search space used: 8131942 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 31 (16.5 bits)