Query 537021.9.peg.874_1 Match_columns 47 No_of_seqs 1 out of 3 Neff 1.0 Searched_HMMs 39220 Date Wed May 25 00:54:32 2011 Command /home/congqian_1/programs/hhpred/hhsearch -i peg_874.hhm -d /home/congqian_1/database/cdd/Cdd.hhm No Hit Prob E-value P-value Score SS Cols Query HMM Template HMM 1 KOG4049 consensus 45.0 7.4 0.00019 20.3 0.4 16 20-36 153-168 (248) 2 TIGR01467 cobI_cbiL precorrin- 28.7 7.2 0.00018 20.4 -1.8 13 7-19 230-242 (243) 3 PRK05948 precorrin-2 methyltra 26.4 5.8 0.00015 20.8 -2.6 10 8-17 222-231 (238) 4 TIGR00938 thrB_alt homoserine 24.6 32 0.00082 17.0 1.0 16 2-17 55-70 (312) 5 pfam10167 NEP Uncharacterized 24.2 71 0.0018 15.3 2.7 30 14-43 29-60 (118) 6 KOG1753 consensus 24.2 42 0.0011 16.5 1.5 17 30-46 105-121 (145) 7 KOG0625 consensus 22.1 32 0.00082 17.0 0.5 12 5-16 311-322 (558) 8 PRK05433 GTP-binding protein L 17.7 64 0.0016 15.5 1.3 33 1-40 487-519 (601) 9 COG1626 TreA Neutral trehalase 16.7 84 0.0022 14.9 1.7 23 5-27 219-241 (558) 10 PRK10533 putative lipoprotein; 14.6 65 0.0017 15.5 0.7 32 11-42 65-98 (171) No 1 >KOG4049 consensus Probab=45.04 E-value=7.4 Score=20.30 Aligned_cols=16 Identities=50% Similarity=0.746 Sum_probs=12.3 Q ss_pred HHHHHHCCHHHHHHHHH Q ss_conf 99997201178999986 Q 537021.9.peg.8 20 VYHHIHRDNAHILQKEI 36 (47) Q Consensus 20 vyhhihrdnahilqkei 36 (47) +-|||+ |.|||++|+- T Consensus 153 IGHhIg-DRAHiI~Ksr 168 (248) T KOG4049 153 IGHHIG-DRAHIIDKSR 168 (248) T ss_pred CCCCCC-HHHHHHHHHC T ss_conf 222121-3676766511 No 2 >TIGR01467 cobI_cbiL precorrin-2 C20-methyltransferase; InterPro: IPR006364 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt. Cobalamin is usually found in one of two biologically active forms: methylcobalamin and adocobalamin. Most prokaryotes, as well as animals, have cobalamin-dependent enzymes, whereas plants and fungi do not appear to use it. In bacteria and archaea, these include methionine synthase, ribonucleotide reductase, glutamate and methylmalonyl-CoA mutases, ethanolamine ammonia lyase, and diol dehydratase . In mammals, cobalamin is obtained through the diet, and is required for methionine synthase and methylmalonyl-CoA mutase . There are at least two distinct cobalamin biosynthetic pathways in bacteria : Aerobic pathway that requires oxygen and in which cobalt is inserted late in the pathway ; found in Pseudomonas denitrificans and Rhodobacter capsulatus. Anaerobic pathway in which cobalt insertion is the first committed step towards cobalamin synthesis ; found in Salmonella typhimurium, Bacillus megaterium, and Propionibacterium freudenreichii shermanii. Either pathway can be divided into two parts: (1) corrin ring synthesis (differs in aerobic and anaerobic pathways) and (2) adenosylation of corrin ring, attachment of aminopropanol arm, and assembly of the nucleotide loop (common to both pathways) . There are about 30 enzymes involved in either pathway, where those involved in the aerobic pathway are prefixed Cob and those of the anaerobic pathway Cbi. Several of these enzymes are pathway-specific: CbiD, CbiG, and CbiK are specific to the anaerobic route of S. typhimurium, whereas CobE, CobF, CobG, CobN, CobS, CobT, and CobW are unique to the aerobic pathway of P. denitrificans. In the anaerobic pathway, cobalt is inserted into precorrin-2 by CbiK to generate cobalt-precorrin-2, which is the substrate for CbiL, a C20 methyltransferase . In Clostridium difficile, CbiK and CbiL are fused into a bifunctional enzyme. In the aerobic pathway, CobI catalyses the methylation of precorrin-2 to precorrin-3a. This entry represents CbiL and CobI precorrin-2 C20-methyltransferases (2.1.1.130 from EC), both as stand-alone enzymes and when CbiL forms part of a bifunctional enzyme. This entry also includes other closely related S-adenosylmethionine-dependent methyltransferases involved in Cbl biosynthesis. ; GO: 0008757 S-adenosylmethionine-dependent methyltransferase activity, 0009236 cobalamin biosynthetic process. Probab=28.66 E-value=7.2 Score=20.36 Aligned_cols=13 Identities=46% Similarity=0.950 Sum_probs=8.9 Q ss_pred HHHCCHHHHHHHH Q ss_conf 4438069999999 Q 537021.9.peg.8 7 AEEIPYFSLMLYR 19 (47) Q Consensus 7 aeeipyfslmlyr 19 (47) .++.||||+||-| T Consensus 230 ~~~~~YfS~~lv~ 242 (243) T TIGR01467 230 DAKLPYFSTILVR 242 (243) T ss_pred CCCCCCEEEEEEC T ss_conf 7889844566643 No 3 >PRK05948 precorrin-2 methyltransferase; Provisional Probab=26.35 E-value=5.8 Score=20.83 Aligned_cols=10 Identities=50% Similarity=1.152 Sum_probs=4.9 Q ss_pred HHCCHHHHHH Q ss_conf 4380699999 Q 537021.9.peg.8 8 EEIPYFSLML 17 (47) Q Consensus 8 eeipyfslml 17 (47) +++||||+|+ T Consensus 222 ~~~~YfSlii 231 (238) T PRK05948 222 LRLPYFSLLI 231 (238) T ss_pred CCCCCEEEEE T ss_conf 8899328999 No 4 >TIGR00938 thrB_alt homoserine kinase; InterPro: IPR005280 Homoserine kinase is required in the biosynthesis of threonine from aspartate.The member of this family from Pseudomonas aeruginosa was shown by direct assay and complementation to act specifically as a homoserine kinase. . Probab=24.58 E-value=32 Score=17.02 Aligned_cols=16 Identities=44% Similarity=0.839 Sum_probs=12.1 Q ss_pred CHHCCHHHCCHHHHHH Q ss_conf 1000744380699999 Q 537021.9.peg.8 2 DKLLNAEEIPYFSLML 17 (47) Q Consensus 2 dkllnaeeipyfslml 17 (47) .+..|+||.|||--|. T Consensus 55 E~~~~~EeLPfFL~L~ 70 (312) T TIGR00938 55 EKRVKAEELPFFLELL 70 (312) T ss_pred EECCCCCCCCHHHHHH T ss_conf 2016865771088999 No 5 >pfam10167 NEP Uncharacterized conserved protein. This is the N-terminal 80 residues of a family of proteins conserved from plants to humans. It contains a characteristic NEP sequence motif. The function is not known. Probab=24.21 E-value=71 Score=15.28 Aligned_cols=30 Identities=27% Similarity=0.571 Sum_probs=21.4 Q ss_pred HHHHHHHHHHHHCCHHHHHH--HHHHHHHHEE Q ss_conf 99999999997201178999--9862100303 Q 537021.9.peg.8 14 SLMLYRVYHHIHRDNAHILQ--KEIVSYDRTL 43 (47) Q Consensus 14 slmlyrvyhhihrdnahilq--keivsydrtl 43 (47) |+-|||+-.|++|--..+++ +++++..+.+ T Consensus 29 SlalyrvQeHvrkslP~~v~~k~~v~~~~~~l 60 (118) T pfam10167 29 SVGLYRVQEHVRRSLPNLVELKNNVVELQEQI 60 (118) T ss_pred HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH T ss_conf 49999999999987589999999999999998 No 6 >KOG1753 consensus Probab=24.17 E-value=42 Score=16.45 Aligned_cols=17 Identities=35% Similarity=0.702 Sum_probs=12.9 Q ss_pred HHHHHHHHHHHHEEEEC Q ss_conf 89999862100303430 Q 537021.9.peg.8 30 HILQKEIVSYDRTLMVQ 46 (47) Q Consensus 30 hilqkeivsydrtlmvq 46 (47) .-+++-.+.|||||.|. T Consensus 105 keiKd~li~yDrtlLVA 121 (145) T KOG1753 105 KEIKDILIQYDRTLLVA 121 (145) T ss_pred HHHHHHHHHCCCEEEEC T ss_conf 99999998578568973 No 7 >KOG0625 consensus Probab=22.08 E-value=32 Score=17.03 Aligned_cols=12 Identities=58% Similarity=0.880 Sum_probs=8.2 Q ss_pred CCHHHCCHHHHH Q ss_conf 074438069999 Q 537021.9.peg.8 5 LNAEEIPYFSLM 16 (47) Q Consensus 5 lnaeeipyfslm 16 (47) -|+++||||.-+ T Consensus 311 ~na~~IPYF~~~ 322 (558) T KOG0625 311 ANAEAIPYFRKQ 322 (558) T ss_pred HHHHHCCHHHHC T ss_conf 300216556653 No 8 >PRK05433 GTP-binding protein LepA; Provisional Probab=17.74 E-value=64 Score=15.50 Aligned_cols=33 Identities=33% Similarity=0.469 Sum_probs=26.0 Q ss_pred CCHHCCHHHCCHHHHHHHHHHHHHHCCHHHHHHHHHHHHH Q ss_conf 9100074438069999999999972011789999862100 Q 537021.9.peg.8 1 LDKLLNAEEIPYFSLMLYRVYHHIHRDNAHILQKEIVSYD 40 (47) Q Consensus 1 ldkllnaeeipyfslmlyrvyhhihrdnahilqkeivsyd 40 (47) +|-|+|.|.+.-||.+ +||++|.-.-++++.-= T Consensus 487 ldIliNg~~Vdals~i-------~h~~~a~~~gr~~~~kL 519 (601) T PRK05433 487 LDILINGEPVDALSFI-------VHRDKAYERGRALVEKL 519 (601) T ss_pred EEEEECCCCCCHHHHH-------HHHHHHHHHHHHHHHHH T ss_conf 9999888542466511-------22888999999999999 No 9 >COG1626 TreA Neutral trehalase [Carbohydrate transport and metabolism] Probab=16.65 E-value=84 Score=14.89 Aligned_cols=23 Identities=30% Similarity=0.447 Sum_probs=19.6 Q ss_pred CCHHHCCHHHHHHHHHHHHHHCC Q ss_conf 07443806999999999997201 Q 537021.9.peg.8 5 LNAEEIPYFSLMLYRVYHHIHRD 27 (47) Q Consensus 5 lnaeeipyfslmlyrvyhhihrd 27 (47) |+..+-|+|++|.-.++.|+.-+ T Consensus 219 L~RSQPPff~~Mv~~~~~~~g~~ 241 (558) T COG1626 219 LSRSQPPFFALMVELVAEHEGVA 241 (558) T ss_pred EECCCCCCHHHHHHHHHHHHCHH T ss_conf 52589974899999999760589 No 10 >PRK10533 putative lipoprotein; Provisional Probab=14.59 E-value=65 Score=15.47 Aligned_cols=32 Identities=34% Similarity=0.475 Sum_probs=0.0 Q ss_pred CHHHHHHHHHHHHHHCCHHH--HHHHHHHHHHHE Q ss_conf 06999999999997201178--999986210030 Q 537021.9.peg.8 11 PYFSLMLYRVYHHIHRDNAH--ILQKEIVSYDRT 42 (47) Q Consensus 11 pyfslmlyrvyhhihrdnah--ilqkeivsydrt 42 (47) ||+|--||.....-.|+|.| .++.+|.|-.++ T Consensus 65 PylS~~L~~~L~~a~~~~~~~~~~~~D~FSs~~~ 98 (171) T PRK10533 65 PYLSDKLATLLSDASRDNSHRQLLSGDPFSSRTT 98 (171) T ss_pred CHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCC T ss_conf 2457899999999875445677634663433234 Done!