HHsearch alignment for GI: peg_887 and conserved domain: COG0464

>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones].
Probab=95.19  E-value=0.033  Score=34.53  Aligned_cols=67  Identities=15%  Similarity=0.167  Sum_probs=45.5

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCCCEEEECCHHHHHCCCCCCCC-CCC-----HHHHCCCEEEECCEECC
Q ss_conf             898499998798733449999999881987975004421168222423-467-----68742340433144513
Q 537021.9.peg.8    8 THTKAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTS-RPS-----DQDMQSIPHYLYGYVPA   75 (133)
Q Consensus         8 ~~~~ii~I~GpTasGKT~lai~LA~~~~~~IIs~DS~QvYk~l~IgTa-Kps-----~~e~~~v~H~lid~~~~   75 (133)
T Consensus       274 ~~~~giLl~GpPGtGKT~lAkava~~~~~~fi~v~~~-~l~sk~vGesek~ir~~F~~A~~~~p~iifiDEiDs  346 (494)
T COG0464         274 RPPKGVLLYGPPGTGKTLLAKAVALESRSRFISVKGS-ELLSKWVGESEKNIRELFEKARKLAPSIIFIDEIDS  346 (494)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCCCCEEEECCH-HHHHHHHHHHHHHHHHHHHHHHHCCCCEEEHHHHHH
T ss_conf             8883699988999758999999875449824884335-554077659999999999999966998897488666