HHsearch alignment for GI: peg_887 and conserved domain: COG2262

>COG2262 HflX GTPases [General function prediction only].
Probab=91.14  E-value=0.53  Score=27.22  Aligned_cols=89  Identities=16%  Similarity=0.163  Sum_probs=47.4

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHH--------------------C--CCEEEECCHHHHHCCCC---CCCCCCCHHH
Q ss_conf             589849999879873344999999988--------------------1--98797500442116822---2423467687
Q 537021.9.peg.8    7 STHTKAIFISGPTASGKSLCAVNLAHK--------------------F--NGAIINADSMQVYDTLR---ILTSRPSDQD   61 (133)
Q Consensus         7 ~~~~~ii~I~GpTasGKT~lai~LA~~--------------------~--~~~IIs~DS~QvYk~l~---IgTaKps~~e   61 (133)
T Consensus       189 ~~~~p~vaLvGYTNAGKSTL~N~LT~~~~~~~d~LFATLdpttR~~~l~~g~~vlLtDTVGFI~~LP~~LV~AFksTLEE  268 (411)
T COG2262         189 RSGIPLVALVGYTNAGKSTLFNALTGADVYVADQLFATLDPTTRRIELGDGRKVLLTDTVGFIRDLPHPLVEAFKSTLEE  268 (411)
T ss_pred             CCCCCEEEEEEECCCCHHHHHHHHHCCCEECCCCCCCCCCCCEEEEEECCCCEEEEECCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             16997589873234449999988724571304666421057404898079964998657567155986799999998987


Q ss_pred             HCCCEEEECCEECCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             423404331445137655899999999999999984
Q 537021.9.peg.8   62 MQSIPHYLYGYVPAQKSYSTGKWLRYAIKKIAEVQK   97 (133)
Q Consensus        62 ~~~v~H~lid~~~~~e~~sv~~f~~~a~~~i~~i~~   97 (133)
T Consensus       269 ~~~a-DlllhVVDaSdp-~~~~~~~~v~~vL~el~~  302 (411)
T COG2262         269 VKEA-DLLLHVVDASDP-EILEKLEAVEDVLAEIGA  302 (411)
T ss_pred             HHCC-CEEEEEEECCCH-HHHHHHHHHHHHHHHCCC
T ss_conf             6227-779997406885-189999999999997488