HHsearch alignment for GI: peg_887 and conserved domain: COG2804

>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion].
Probab=94.68  E-value=0.031  Score=34.69  Aligned_cols=32  Identities=28%  Similarity=0.436  Sum_probs=25.5

Q ss_pred             ECCCCCEEEEECCCCCCHHHHHHHHHHHCCCE
Q ss_conf             05898499998798733449999999881987
Q 537021.9.peg.8    6 LSTHTKAIFISGPTASGKSLCAVNLAHKFNGA   37 (133)
Q Consensus         6 ~~~~~~ii~I~GpTasGKT~lai~LA~~~~~~   37 (133)
T Consensus       254 ~~~p~GliLvTGPTGSGKTTTLY~~L~~ln~~  285 (500)
T COG2804         254 LNRPQGLILVTGPTGSGKTTTLYAALSELNTP  285 (500)
T ss_pred             HHCCCEEEEEECCCCCCHHHHHHHHHHHHCCC
T ss_conf             72897089996899998899999999986278