HHsearch alignment for GI: peg_887 and conserved domain: COG3596

>COG3596 Predicted GTPase [General function prediction only].
Probab=91.26  E-value=0.23  Score=29.44  Aligned_cols=30  Identities=20%  Similarity=0.106  Sum_probs=22.7

Q ss_pred             CCCCEEE-EECCCCCCHHHHHHHHHHHCCCE
Q ss_conf             8984999-98798733449999999881987
Q 537021.9.peg.8    8 THTKAIF-ISGPTASGKSLCAVNLAHKFNGA   37 (133)
Q Consensus         8 ~~~~ii~-I~GpTasGKT~lai~LA~~~~~~   37 (133)
T Consensus        36 ~~~pvnvLi~G~TG~GKSSliNALF~~~~~~   66 (296)
T COG3596          36 EKEPVNVLLMGATGAGKSSLINALFQGEVKE   66 (296)
T ss_pred             CCCCEEEEEECCCCCCHHHHHHHHHHCCCCE
T ss_conf             3686158974377776889999997026734