HHsearch alignment for GI: peg_887 and conserved domain: COG4619

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only].
Probab=91.53  E-value=0.12  Score=31.03  Aligned_cols=47  Identities=26%  Similarity=0.356  Sum_probs=35.9

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHCCCEEEECCHHHH-HCCCCCCCCCCCHH
Q ss_conf             98499998798733449999999881987975004421-16822242346768
Q 537021.9.peg.8    9 HTKAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQV-YDTLRILTSRPSDQ   60 (133)
Q Consensus         9 ~~~ii~I~GpTasGKT~lai~LA~~~~~~IIs~DS~Qv-Yk~l~IgTaKps~~   60 (133)
T Consensus        28 ~Ge~iaitGPSG~GKStllk~va~-----Lisp~~G~l~f~Ge~vs~~~pea~   75 (223)
T COG4619          28 AGEFIAITGPSGCGKSTLLKIVAS-----LISPTSGTLLFEGEDVSTLKPEAY   75 (223)
T ss_pred             CCCEEEEECCCCCCHHHHHHHHHH-----CCCCCCCEEEECCCCCCCCCHHHH
T ss_conf             885488767887668899999981-----369988528874733443485999