HHsearch alignment for GI: peg_887 and conserved domain: KOG3220

>KOG3220 consensus.
Probab=95.23  E-value=0.022  Score=35.58  Aligned_cols=64  Identities=14%  Similarity=0.139  Sum_probs=42.6

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCEEEECCH--HHHHCCCCCCCCCCCHHHHCCCEEEECCEECCCCCCCHH
Q ss_conf             499998798733449999999881987975004--421168222423467687423404331445137655899
Q 537021.9.peg.8   11 KAIFISGPTASGKSLCAVNLAHKFNGAIINADS--MQVYDTLRILTSRPSDQDMQSIPHYLYGYVPAQKSYSTG   82 (133)
Q Consensus        11 ~ii~I~GpTasGKT~lai~LA~~~~~~IIs~DS--~QvYk~l~IgTaKps~~e~~~v~H~lid~~~~~e~~sv~   82 (133)
T Consensus         2 ~iVGLTGgiatGKStVs~~f~-~~G~~vIDaD~vaR~vv~-------PG~p~~~~ive~FG~eiLl~~G~inR~   67 (225)
T KOG3220           2 LIVGLTGGIATGKSTVSQVFK-ALGIPVIDADVVAREVVE-------PGTPAYRRIVEAFGTEILLEDGEINRK   67 (225)
T ss_pred             EEEEEECCCCCCHHHHHHHHH-HCCCCEECHHHHHHHHHC-------CCCHHHHHHHHHHCCEEECCCCCCCHH
T ss_conf             699940565667379999999-749957627899999855-------998078999998484000568841689