HHsearch alignment for GI: peg_887 and conserved domain: PRK03333

>PRK03333 coaE dephospho-CoA kinase/unknown domain fusion protein; Provisional.
Probab=92.50  E-value=0.2  Score=29.83  Aligned_cols=69  Identities=13%  Similarity=0.173  Sum_probs=46.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCEEEECCHHHHHCCCCCCCCCCCHHHHCCCEEEECCEECCCCCCCHHHHH
Q ss_conf             499998798733449999999881987975004421168222423467687423404331445137655899999
Q 537021.9.peg.8   11 KAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQDMQSIPHYLYGYVPAQKSYSTGKWL   85 (133)
Q Consensus        11 ~ii~I~GpTasGKT~lai~LA~~~~~~IIs~DS~QvYk~l~IgTaKps~~e~~~v~H~lid~~~~~e~~sv~~f~   85 (133)
T Consensus         2 ~~IGLTGGIgsGKStv~~~l~-~~G~~viDaD~--iar~v---~~pg~~~~~~iv~~FG~~il~~dG~ldR~~L~   70 (394)
T PRK03333          2 LRIGLTGGIGAGKSTVSATLA-QLGAVVVDGDV--LAREV---VEPGTEGLAALVEAFGDDILLADGALDRPALA   70 (394)
T ss_pred             EEEEEECCCCCCHHHHHHHHH-HCCCEEEEHHH--HHHHH---HCCCHHHHHHHHHHHCHHHHCCCCCCCHHHHH
T ss_conf             499830675557999999999-87994998579--99999---43986899999998598963889735699999