HHsearch alignment for GI: peg_887 and conserved domain: PRK05703

>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated.
Probab=97.42  E-value=0.00017  Score=48.31  Aligned_cols=37  Identities=27%  Similarity=0.469  Sum_probs=30.2

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHC----C---CEEEECCHH
Q ss_conf             898499998798733449999999881----9---879750044
Q 537021.9.peg.8    8 THTKAIFISGPTASGKSLCAVNLAHKF----N---GAIINADSM   44 (133)
Q Consensus         8 ~~~~ii~I~GpTasGKT~lai~LA~~~----~---~~IIs~DS~   44 (133)
T Consensus       208 ~~~~vvalVGPTGVGKTTTiAKLAA~~~l~~~~~kV~lIT~Dty  251 (412)
T PRK05703        208 EQGGVVALVGPTGVGKTTTLAKLAARYALEEGKDKVALITLDTY  251 (412)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECCC
T ss_conf             56736999888887567699999999999729981799983767