HHsearch alignment for GI: peg_887 and conserved domain: PRK08118

>PRK08118 topology modulation protein; Reviewed.
Probab=97.62  E-value=5.6e-05  Score=51.23  Aligned_cols=36  Identities=33%  Similarity=0.387  Sum_probs=31.9

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCEEEECCHHHH
Q ss_conf             499998798733449999999881987975004421
Q 537021.9.peg.8   11 KAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQV   46 (133)
Q Consensus        11 ~ii~I~GpTasGKT~lai~LA~~~~~~IIs~DS~Qv   46 (133)
T Consensus         2 ~rI~IiG~~GsGKSTlAr~L~~~~~ip~~~LD~l~w   37 (167)
T PRK08118          2 KKIILIGSGGSGKSTLARQLGEKLNIPVHHLDALFW   37 (167)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEEECCCEEE
T ss_conf             679998899987999999999988969796443476