HHsearch alignment for GI: peg_887 and conserved domain: PRK09361

>PRK09361 radB DNA repair and recombination protein RadB; Provisional.
Probab=93.72  E-value=0.12  Score=31.10  Aligned_cols=35  Identities=29%  Similarity=0.389  Sum_probs=26.5

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHH---HCCCEEEECCH
Q ss_conf             984999987987334499999998---81987975004
Q 537021.9.peg.8    9 HTKAIFISGPTASGKSLCAVNLAH---KFNGAIINADS   43 (133)
Q Consensus         9 ~~~ii~I~GpTasGKT~lai~LA~---~~~~~IIs~DS   43 (133)
T Consensus        22 ~G~itei~G~pG~GKTtl~lq~a~~~~~~g~~vlYidt   59 (224)
T PRK09361         22 RGTITQIYGPPGSGKTNICIQLAVEAARQGKKVIYIDT   59 (224)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECC
T ss_conf             88799998999985999999999999974990999678