HHsearch alignment for GI: peg_887 and conserved domain: PRK11022

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional.
Probab=92.85  E-value=0.44  Score=27.68  Aligned_cols=55  Identities=15%  Similarity=0.317  Sum_probs=36.1

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHC--CCEEEECCHHHHHCCCCCCCCCCCHHHHCCCE
Q ss_conf             898499998798733449999999881--98797500442116822242346768742340
Q 537021.9.peg.8    8 THTKAIFISGPTASGKSLCAVNLAHKF--NGAIINADSMQVYDTLRILTSRPSDQDMQSIP   66 (133)
Q Consensus         8 ~~~~ii~I~GpTasGKT~lai~LA~~~--~~~IIs~DS~QvYk~l~IgTaKps~~e~~~v~   66 (133)
T Consensus        31 ~~GEilgivGeSGsGKSTl~~~ilgll~~~~~~~~-g~-i~~~g~dl~~--~~~~~~~~~~   87 (327)
T PRK11022         31 KQGEVVGIVGESGSGKSVSSLAIMGLIDYPGRVMA-EK-LEFNGQDLQR--ISEKERRNLV   87 (327)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCCEEE-EE-EEECCEECCC--CCHHHHHHHH
T ss_conf             89999999999987899999999748898997654-27-9999999774--9999999863