HHsearch alignment for GI: peg_887 and conserved domain: PRK12337

>PRK12337 2-phosphoglycerate kinase; Provisional.
Probab=97.13  E-value=0.00054  Score=45.30  Aligned_cols=106  Identities=10%  Similarity=0.080  Sum_probs=62.6

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHCC-CEEEECCHH-HHHCCCCCCCCCCCHHHHCCCEEEECCEEC---------CC
Q ss_conf             8984999987987334499999998819-879750044-211682224234676874234043314451---------37
Q 537021.9.peg.8    8 THTKAIFISGPTASGKSLCAVNLAHKFN-GAIINADSM-QVYDTLRILTSRPSDQDMQSIPHYLYGYVP---------AQ   76 (133)
Q Consensus         8 ~~~~ii~I~GpTasGKT~lai~LA~~~~-~~IIs~DS~-QvYk~l~IgTaKps~~e~~~v~H~lid~~~---------~~   76 (133)
T Consensus       260 ~~PiiILIGGaSGvGKSTlAseLA~RLGI~~VIsTDsIREVMR~~i--s~el~P~Lh~-SSy~Awk~L~~~~~~~~~~~~  336 (492)
T PRK12337        260 PRPLHVLLGGVSGTGKSVLAAELAYRLGITRVVPTDAIREVMRAMV--SKDLLPTLHA-STFNAWEALVPPGLGLPGEPT  336 (492)
T ss_pred             CCCEEEEEECCCCCCHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHC--CHHHCCHHHH-HHHHHHHHCCCCCCCCCCCCC
T ss_conf             8876999607888668889999999609881025447999999845--9764845777-556888860873457777860


Q ss_pred             CCCCHHHHHHHHHHHHHHHHHHHCHHHHHHHCCCEEEEECCCHH
Q ss_conf             65589999999999999998410000013325985599889308
Q 537021.9.peg.8   77 KSYSTGKWLRYAIKKIAEVQKTVFTYNSRWDRSLFSCINRSTLY  120 (133)
Q Consensus        77 e~~sv~~f~~~a~~~i~~i~~~~~~~~~~~~r~~~piivGGTgl  120 (133)
T Consensus       337 ~~~vi~GF~~Qv~~V~vGl~aV----ieRa~~EG~SvVIEGVHL  376 (492)
T PRK12337        337 RVELLAGFRDQVQQVSVGLKAV----VRRSILEGTSLVLEGVHL  376 (492)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHH----HHHHHHCCCCEEEEEEEE
T ss_conf             7689989999999999999999----999997288679983330