HHsearch alignment for GI: peg_887 and conserved domain: PRK13652

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional.
Probab=91.89  E-value=0.18  Score=30.08  Aligned_cols=32  Identities=22%  Similarity=0.427  Sum_probs=25.3

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHC---CCEEE
Q ss_conf             898499998798733449999999881---98797
Q 537021.9.peg.8    8 THTKAIFISGPTASGKSLCAVNLAHKF---NGAII   39 (133)
Q Consensus         8 ~~~~ii~I~GpTasGKT~lai~LA~~~---~~~II   39 (133)
T Consensus        28 ~~Ge~~aliG~NGaGKSTLl~~i~Gll~p~~G~I~   62 (277)
T PRK13652         28 GRKQRIAVIGPNGAGKSTLFKHFNGILKPTSGSVL   62 (277)
T ss_pred             CCCCEEEEECCCCCHHHHHHHHHHCCCCCCCEEEE
T ss_conf             89989999999994799999999669999846999