HHsearch alignment for GI: peg_887 and conserved domain: TIGR00382

>TIGR00382 clpX ATP-dependent Clp protease, ATP-binding subunit ClpX; InterPro: IPR004487 ClpX is a member of the HSP (heat-shock protein) 100 family. Gel filtration and electron microscopy showed that ClpX subunits associate to form a six-membered ring that is stabilized by binding of ATP or nonhydrolyzable analogs of ATP . It functions as an ATP-depedent molecular chaperone and is the regulatory subunit of the ClpXP protease . ClpXP is involved in DNA damage repair, stationary-phase gene expression, and ssrA-mediated protein quality control. To date more than 50 proteins include transcription factors, metabolic enzymes, and proteins involved in the starvation and oxidative stress responses have been identified as substrates . The N-terminal domain of ClpX is a C4-type zinc binding domain (ZBD) involved in substrate recognition. ZBD forms a very stable dimer that is essential for promoting the degradation of some typical ClpXP substrates such as lO and MuA . ; GO: 0005515 protein binding, 0005524 ATP binding, 0016887 ATPase activity, 0015031 protein transport.
Probab=98.15  E-value=1.7e-06  Score=60.36  Aligned_cols=115  Identities=20%  Similarity=0.149  Sum_probs=71.7

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCEEEECCHHHHHCCCCCCCCC-------------CCHHHHCCCEEEECCEECC---
Q ss_conf             999987987334499999998819879750044211682224234-------------6768742340433144513---
Q 537021.9.peg.8   12 AIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSR-------------PSDQDMQSIPHYLYGYVPA---   75 (133)
Q Consensus        12 ii~I~GpTasGKT~lai~LA~~~~~~IIs~DS~QvYk~l~IgTaK-------------ps~~e~~~v~H~lid~~~~---   75 (133)
T Consensus       154 NILLiGPTGSGKTLLAqTLA~~L~VPfAiADATtLTEAGYVGEDVENIL~~Llq~ad~DV~kA~kGI--iYIDEIDKIaR  231 (452)
T TIGR00382       154 NILLIGPTGSGKTLLAQTLARILNVPFAIADATTLTEAGYVGEDVENILLKLLQAADYDVEKAQKGI--IYIDEIDKIAR  231 (452)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHCCCCEEECCHHHHHCCCCCCCCHHHHHHHHHHHCCCCHHHHCCCE--EEEECCCCHHH
T ss_conf             6245468885268999999987388742111110200664242288999999874145524527850--89842231012


Q ss_pred             -CCCCCHH------HHHHHHHHHHHHHHHHHCHHHHH---------HHCCCEEEEECCCHHHHHHHHCC
Q ss_conf             -7655899------99999999999998410000013---------32598559988930899998418
Q 537021.9.peg.8   76 -QKSYSTG------KWLRYAIKKIAEVQKTVFTYNSR---------WDRSLFSCINRSTLYYARNTYCN  128 (133)
Q Consensus        76 -~e~~sv~------~f~~~a~~~i~~i~~~~~~~~~~---------~~r~~~piivGGTglY~~al~~~  128 (133)
T Consensus       232 kSEN~SITRDVSGEGVQQALLKi~EGTvA~vPPqGGRKHP~~~~iqiDTs~ILFICGGAF~GL~~iI~~  300 (452)
T TIGR00382       232 KSENPSITRDVSGEGVQQALLKIIEGTVANVPPQGGRKHPQQEFIQIDTSNILFICGGAFVGLEKIIKK  300 (452)
T ss_pred             HCCCCEEEEEECCCHHHHHHHHHHHCCEEEECCCCCCCCCCCCEEEECCCCEEEEECCHHHHHHHHHHH
T ss_conf             157780112217554999999876032343175448868865768864764001105434448999988