>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; InterPro: IPR012701 Members of this family are the PhnL protein of C-P lyase systems for utilization of phosphonates. These systems resemble phosphonatase-based systems in having a three-component ABC transporter, where IPR005769 from INTERPRO is the permease, IPR005770 from INTERPRO is the phosphonates binding protein, and IPR012693 from INTERPRO is the ATP-binding cassette (ABC) protein. They differ, however, in having, typically, ten or more additional genes, many of which are believed to form a membrane-associated C-P lyase complex. This protein (PhnL) and the adjacent-encoded PhnK (IPR012700 from INTERPRO) resemble transporter ATP-binding proteins but are suggested, based on mutagenesis studies, to be part of this C-P lyase complex rather than part of a transporter per se ..

Probab=90.65 E-value=0.14 Score=30.65 Aligned_cols=61 Identities=21% Similarity=0.366 Sum_probs=39.3 Q ss_pred CCCEEEEECCCCCCHHHHHHHHHHHCC---CEEEECCHHHHHCCCCCCCCCCCHHHHCCCEEEECCEEC Q ss_conf 984999987987334499999998819---879750044211682224234676874234043314451 Q 537021.9.peg.8 9 HTKAIFISGPTASGKSLCAVNLAHKFN---GAIINADSMQVYDTLRILTSRPSDQDMQSIPHYLYGYVP 74 (133) Q Consensus 9 ~~~ii~I~GpTasGKT~lai~LA~~~~---~~IIs~DS~QvYk~l~IgTaKps~~e~~~v~H~lid~~~ 74 (133) T Consensus 33 aGEcv~L~G~SGaGKSTlLk~lYaNYlp~~G~i~~~H-----~G~~~DL~~a~pr~vl~vRr~tiGYVS 96 (224) T TIGR02324 33 AGECVALSGPSGAGKSTLLKSLYANYLPDSGRILVRH-----EGAWVDLAQASPREVLEVRRKTIGYVS 96 (224) T ss_pred CCCEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEEEE-----CCHHHHHHCCCHHHHHHHHHHHCCCEE T ss_conf 6735885368887678999976630474686777762-----404767507684577877300335155

HHsearch alignment for GI: peg_887 and conserved domain: TIGR02324