HHsearch alignment for GI: peg_887 and conserved domain: TIGR02533

>TIGR02533 type_II_gspE general secretory pathway protein E; InterPro: IPR013369 GspE, the E protein of the type II secretion system, is also referred to as the main terminal branch of the general secretion pathway. ; GO: 0005524 ATP binding, 0008565 protein transporter activity, 0015628 protein secretion by the type II secretion system, 0015627 type II protein secretion system complex.
Probab=96.73  E-value=0.0012  Score=43.12  Aligned_cols=56  Identities=21%  Similarity=0.273  Sum_probs=37.8

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHHCCCEEEECCHHHHHCCCCCCCCCCCHHHHCCCEEEECCEECCCCCCC
Q ss_conf             84999987987334499999998819879750044211682224234676874234043314451376558
Q 537021.9.peg.8   10 TKAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQDMQSIPHYLYGYVPAQKSYS   80 (133)
Q Consensus        10 ~~ii~I~GpTasGKT~lai~LA~~~~~~IIs~DS~QvYk~l~IgTaKps~~e~~~v~H~lid~~~~~e~~s   80 (133)
T Consensus       245 HGIiLVTGPTGSGKtTTLYaaL~~LN~~-----------~~NIlTvE-DPVE---Y~i~GIgQ~Qvn~kIg  300 (495)
T TIGR02533       245 HGIILVTGPTGSGKTTTLYAALSRLNTP-----------ERNILTVE-DPVE---YQIEGIGQIQVNPKIG  300 (495)
T ss_pred             CCEEEECCCCCCCHHHHHHHHHHHHCCC-----------CCCEEEEE-CCEE---EEECCCCEEEECCCCC
T ss_conf             9618841778985258899999863589-----------97156865-7824---7624876365146543