HHsearch alignment for GI: peg_887 and conserved domain: cd00009

>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold. The ASCE division also includes ABC, RecA-like, VirD4-like, PilT-like, and SF1/2 helicases. Members of the AAA+ ATPases function as molecular chaperons, ATPase subunits of proteases, helicases, or nucleic-acid stimulated ATPases. The AAA+ proteins contain several distinct features in addition to the conserved alpha-beta-alpha core domain structure and the Walker A and B motifs of the P-loop NTPases.
Probab=97.09  E-value=0.00053  Score=45.36  Aligned_cols=67  Identities=12%  Similarity=0.198  Sum_probs=48.7

Q ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHC---CCEEEECCHHHHHCCCCCCCCCCC--------HHHHCCCEEEECCEEC
Q ss_conf             898499998798733449999999881---987975004421168222423467--------6874234043314451
Q 537021.9.peg.8    8 THTKAIFISGPTASGKSLCAVNLAHKF---NGAIINADSMQVYDTLRILTSRPS--------DQDMQSIPHYLYGYVP   74 (133)
Q Consensus         8 ~~~~ii~I~GpTasGKT~lai~LA~~~---~~~IIs~DS~QvYk~l~IgTaKps--------~~e~~~v~H~lid~~~   74 (133)
T Consensus        17 ~~~~~ill~GppGtGKT~la~~ia~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~vl~iDEi~   94 (151)
T cd00009          17 PPPKNLLLYGPPGTGKTTLARAIANELFRPGAPFLYLNASDLLEGLVVAELFGHFLVRLLFELAEKAKPGVLFIDEID   94 (151)
T ss_pred             CCCCEEEEECCCCCCHHHHHHHHHHHHCCCCCCEEEEEHHHCCHHHHHHHHHHHHHHHHHHHHHHHCCCCEEEEECHH
T ss_conf             799808998999988659999999971213798278547770467777576057788989999997699869820166