HHsearch alignment for GI: peg_887 and conserved domain: cd03240

>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains. The conserved ATP-binding motifs common to Rad50 and the ABC transporter family include the Walker A and Walker B motifs, the Q loop, a histidine residue in the switch region, a D-loop, and a conserved LSGG sequence. This conserved sequence, LSGG, is the most specific and characteristic motif of this family and is thus known as the ABC signature sequence.
Probab=93.64  E-value=0.24  Score=29.30  Aligned_cols=31  Identities=19%  Similarity=0.286  Sum_probs=23.8

Q ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHHCCCE
Q ss_conf             5898499998798733449999999881987
Q 537021.9.peg.8    7 STHTKAIFISGPTASGKSLCAVNLAHKFNGA   37 (133)
Q Consensus         7 ~~~~~ii~I~GpTasGKT~lai~LA~~~~~~   37 (133)
T Consensus        19 ~f~~~itaivG~NGaGKSTLl~~i~~~l~g~   49 (204)
T cd03240          19 EFFSPLTLIVGQNGAGKTTIIEALKYALTGE   49 (204)
T ss_pred             EEECCEEEEECCCCCCHHHHHHHHHHCCCCC
T ss_conf             8508889999899999999999986304772