HHsearch alignment for GI: peg_887 and conserved domain: pfam00485

>pfam00485 PRK Phosphoribulokinase / Uridine kinase family. In Arabidopsis the region carries two binding domains, a phosphoribosylpyrophosphate-binding domain and, at the very C-terminus, a uracil-binding domain.
Probab=97.38  E-value=0.00022  Score=47.65  Aligned_cols=109  Identities=15%  Similarity=0.118  Sum_probs=58.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHCCCE-----EEECCHHHHHCCCCCCCCCCCHHHHCCCEEEECCEECCCCCCCHHHHHH
Q ss_conf             99998798733449999999881987-----9750044211682224234676874234043314451376558999999
Q 537021.9.peg.8   12 AIFISGPTASGKSLCAVNLAHKFNGA-----IINADSMQVYDTLRILTSRPSDQDMQSIPHYLYGYVPAQKSYSTGKWLR   86 (133)
Q Consensus        12 ii~I~GpTasGKT~lai~LA~~~~~~-----IIs~DS~QvYk~l~IgTaKps~~e~~~v~H~lid~~~~~e~~sv~~f~~   86 (133)
T Consensus         1 iIgIaG~SgSGKTT~a~~L~~~l~~~~~~~~~~~~d~~~~~---d~~~~~~~~~~~~~~~~~~~~~d~P-~a~d~~ll~~   76 (196)
T pfam00485         1 IIGVAGSSGAGKTTVARTFVSIFGREGVPAAGIEGDSFHRY---DRFYMDLHMEDRKRAGNNHYSFFSP-EANDFDLLYE   76 (196)
T ss_pred             CEEEECCCCCCHHHHHHHHHHHHCCCCCCCCCCCCEEEEEE---CHHCCCCCHHHHHHCCCCCCCCCCC-CCCCHHHHHH
T ss_conf             98998998571999999999996605877641243179860---4102443757676514578897896-6235999999


Q ss_pred             HHHHHHHHHHHHHCHHHH----------HHHCCCEEEEECCCHHHHHH
Q ss_conf             999999999841000001----------33259855998893089999
Q 537021.9.peg.8   87 YAIKKIAEVQKTVFTYNS----------RWDRSLFSCINRSTLYYARN  124 (133)
Q Consensus        87 ~a~~~i~~i~~~~~~~~~----------~~~r~~~piivGGTglY~~a  124 (133)
T Consensus        77 ~l~~Lk~g~~i~~P~Ydf~~~~r~~~~~~i~p~~viIvEGi~~l~~~~  124 (196)
T pfam00485        77 QFKELKEGGSGDKPIYNHVTGEADPWPELIEGADILFIEGLHGLYDER  124 (196)
T ss_pred             HHHHHHCCCCEEEEEEECCCCCCCCCCEECCCCCEEEEECHHHCCCHH
T ss_conf             999970899457656751345336773661788569994333303277