HHsearch alignment for GI: peg_887 and conserved domain: pfam01583

>pfam01583 APS_kinase Adenylylsulphate kinase. Enzyme that catalyses the phosphorylation of adenylylsulphate to 3'-phosphoadenylylsulfate. This domain contains an ATP binding P-loop motif.
Probab=95.18  E-value=0.031  Score=34.70  Aligned_cols=37  Identities=24%  Similarity=0.425  Sum_probs=29.4

Q ss_pred             CCCEEEEECCCCCCHHHHHHHHHHHC-----CCEEEECCHHH
Q ss_conf             98499998798733449999999881-----98797500442
Q 537021.9.peg.8    9 HTKAIFISGPTASGKSLCAVNLAHKF-----NGAIINADSMQ   45 (133)
Q Consensus         9 ~~~ii~I~GpTasGKT~lai~LA~~~-----~~~IIs~DS~Q   45 (133)
T Consensus         1 kG~viW~TGLsGsGKTTlA~~l~~~L~~~~~~~~~LDGD~~R   42 (157)
T pfam01583         1 RGCTVWFTGLSGSGKSTIANALERKLFAQGISVYVLDGDNVR   42 (157)
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHHCCCCEEEECCHHHH
T ss_conf             988999889899999999999999999759977997688775