HHsearch alignment for GI: peg_887 and conserved domain: pfam01745

>pfam01745 IPT Isopentenyl transferase. Isopentenyl transferase / dimethylallyl transferase synthesizes isopentenyladensosine 5'-monophosphate, a cytokinin that induces shoot formation on host plants infected with the Ti plasmid.
Probab=99.87  E-value=5.8e-22  Score=153.83  Aligned_cols=107  Identities=17%  Similarity=0.161  Sum_probs=89.2

Q ss_pred             CEEEEECCCCCCHHHHHHHHHHHCCCEEEECCHHHHHCCCCCCCCCCCHHHHCCCEEEECCEECCCC-CCCHHHHHHHHH
Q ss_conf             4999987987334499999998819879750044211682224234676874234043314451376-558999999999
Q 537021.9.peg.8   11 KAIFISGPTASGKSLCAVNLAHKFNGAIINADSMQVYDTLRILTSRPSDQDMQSIPHYLYGYVPAQK-SYSTGKWLRYAI   89 (133)
Q Consensus        11 ~ii~I~GpTasGKT~lai~LA~~~~~~IIs~DS~QvYk~l~IgTaKps~~e~~~v~H~lid~~~~~e-~~sv~~f~~~a~   89 (133)
T Consensus         2 ~l~~I~GpT~~GKT~~ai~lA~~~g~~iis~D~~Q~y~el~igs~rp~~~El~gT~RiYL~~R~l~~Gii~a~eA~~~Li   81 (232)
T pfam01745         2 GLYLIWGATCTGKTAEAIALAKETGWPVIVLDRVQCCSQLATGSGRPLPAELQGTRRIYLDNRPLSEGIIDAEEAHDRLI   81 (232)
T ss_pred             CEEEEECCCCCCHHHHHHHHHHHHCCCEEEECHHHHHHCCCCCCCCCCHHHHCCCCEEEECCCCCCCCCCCHHHHHHHHH
T ss_conf             26899788777716999999999599779620344300113677899979965752698616734346648899999999


Q ss_pred             HHHHHHHHHHCHHHHHHHCCCEEEEECCCHHHHHHHHCC
Q ss_conf             999999841000001332598559988930899998418
Q 537021.9.peg.8   90 KKIAEVQKTVFTYNSRWDRSLFSCINRSTLYYARNTYCN  128 (133)
Q Consensus        90 ~~i~~i~~~~~~~~~~~~r~~~piivGGTglY~~al~~~  128 (133)
T Consensus        82 ~~V~---~~-------~~-~~glILEGGSISLl~~ma~~  109 (232)
T pfam01745        82 AEVT---SH-------KD-EGGVILEGGSISLLKRMAQS  109 (232)
T ss_pred             HHHH---CC-------CC-CCCEEEECCHHHHHHHHHHC
T ss_conf             9996---04-------66-78668727509999999757