HHsearch alignment for GI: peg_887 and conserved domain: pfam01935

>pfam01935 DUF87 Domain of unknown function DUF87. The function of this prokaryotic domain is unknown. It contains several conserved aspartates and histidines that could be metal ligands.
Probab=92.65  E-value=0.15  Score=30.59  Aligned_cols=41  Identities=27%  Similarity=0.289  Sum_probs=31.8

Q ss_pred             CCEEEEECCCCCCHHHHHHHHHHH----CCCEEEECCHHHHHCCC
Q ss_conf             849999879873344999999988----19879750044211682
Q 537021.9.peg.8   10 TKAIFISGPTASGKSLCAVNLAHK----FNGAIINADSMQVYDTL   50 (133)
Q Consensus        10 ~~ii~I~GpTasGKT~lai~LA~~----~~~~IIs~DS~QvYk~l   50 (133)
T Consensus        23 ~rH~aIlg~TGsGKS~tv~vLl~~l~~~~~~~vlVfDpHgEY~~~   67 (218)
T pfam01935        23 SRHFAILGSTGSGKSNTVAVLLEELLEKKGATVLIFDPHGEYGWL   67 (218)
T ss_pred             HHHEEEECCCCCCHHHHHHHHHHHHHHCCCCCEEEECCCCCCHHH
T ss_conf             421478726999769999999999985479978998288636323